Citrus Sinensis ID: 045304
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 540 | ||||||
| 255585401 | 843 | serine-threonine protein kinase, plant-t | 0.985 | 0.631 | 0.525 | 1e-134 | |
| 255572272 | 1089 | serine-threonine protein kinase, plant-t | 0.996 | 0.494 | 0.498 | 1e-131 | |
| 224116832 | 1061 | predicted protein [Populus trichocarpa] | 0.994 | 0.506 | 0.502 | 1e-131 | |
| 359485451 | 1454 | PREDICTED: LRR receptor-like serine/thre | 0.990 | 0.367 | 0.497 | 1e-128 | |
| 359485453 | 1202 | PREDICTED: probable LRR receptor-like se | 0.987 | 0.443 | 0.496 | 1e-126 | |
| 359483675 | 1250 | PREDICTED: LRR receptor-like serine/thre | 0.990 | 0.428 | 0.488 | 1e-126 | |
| 359483683 | 1228 | PREDICTED: LRR receptor-like serine/thre | 0.990 | 0.435 | 0.486 | 1e-126 | |
| 359483685 | 1046 | PREDICTED: LRR receptor-like serine/thre | 0.990 | 0.511 | 0.488 | 1e-125 | |
| 147776333 | 1205 | hypothetical protein VITISV_000078 [Viti | 0.990 | 0.443 | 0.488 | 1e-124 | |
| 359497186 | 1140 | PREDICTED: LRR receptor-like serine/thre | 0.990 | 0.469 | 0.484 | 1e-123 |
| >gi|255585401|ref|XP_002533396.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526770|gb|EEF28996.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 486 bits (1252), Expect = e-134, Method: Compositional matrix adjust.
Identities = 284/540 (52%), Positives = 360/540 (66%), Gaps = 8/540 (1%)
Query: 2 IPHEIGNLRNLELLVLSHNKLVGVIPTKVFNVSTLKVFEVSNNSLSGSLSSIAGVRLPNL 61
IP EIG L NL L+L +N L G IP+ + N+S +K ++ N LSG L S G LPNL
Sbjct: 67 IPTEIGKLSNLVHLLLRYNFLTGSIPSTLLNISAIKTISINVNQLSGHLPSTLGYGLPNL 126
Query: 62 EVLRMRSNNFCGTIPHFIFNASKLSLLELGDNSFSGFIPDTFGNLRNLNKVTLYNNYLTS 121
E L + N F GT+P I NASKL++LE NS SG IPDT NL+NL ++ L +N S
Sbjct: 127 EELYITRNQFIGTLPPSISNASKLTILESSSNSLSGPIPDTLCNLKNLKRLNLADN---S 183
Query: 122 STSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLSHSLEYFYMPNCNVSGGIPEE 181
T +L FL+SL+ CK L + L NPL+ LP TS+GNLS S+EYF + +CN+ G IP E
Sbjct: 184 FTDELGFLASLARCKELRRLVLIGNPLNSTLP-TSIGNLS-SIEYFNVQSCNIKGNIPSE 241
Query: 182 ISNLTNLIIIYLGGNKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELYELDL 241
I L+NLI ++L N+L GSIP+T+ LQKLQ L L N L GSIP +IC L+ L EL L
Sbjct: 242 IGVLSNLITLHLQNNELVGSIPVTIGGLQKLQRLYLHGNLLYGSIPTDICHLSNLGELFL 301
Query: 242 GSNKFSRSIPACFSNLASLRTLSLGSNELTS-IPLTFWNLKDILYLNFSSNFLTGPLPLE 300
+N +PACF +L SLR L L SN TS IP + W+LKD+L LN SSN L+G +PL
Sbjct: 302 SNNSLFGPLPACFGDLISLRILHLHSNNFTSGIPFSLWSLKDVLELNLSSNSLSGHIPLS 361
Query: 301 IENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLISLKSLNL 360
I NLKVL +DFS N+ SG+IP IGSL+ L L + +NR +G IP G+LISL+SL+L
Sbjct: 362 IGNLKVLTQVDFSYNSLSGIIPNAIGSLRNLMSLSLTHNRFEGPIPEPFGELISLESLDL 421
Query: 361 SNNNLSGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNELLCGSPNLR 420
S+NNLSG IP SLE+L YL+ LN+SFN L GE+P G+F NFSA SF GN LCGS L
Sbjct: 422 SSNNLSGKIPKSLEQLKYLKYLNVSFNNLDGEVPNKGAFANFSASSFLGNLALCGSRLLP 481
Query: 421 VPPCKTSTHHTSWKNA-LLLGTVLPLSTIFMIVVILLILRYRKRVKPPPNDANMPPVATW 479
+ PCK +TH S + LLL VLP ++I I IL+ LR +K N ++ V TW
Sbjct: 482 LMPCKNNTHGGSKTSTKLLLIYVLP-ASILTIAFILVFLRCQKVKLELENVMDIITVGTW 540
Query: 480 RRFSYLELCRATDRFSENNLIGRGGFGSVYKARIQDGMEVAVKVFHLHCSGAFKSFDVEC 539
RR S+ EL +ATD F +NL+G GG+GSVYK R++DG VA+KVF+L GAFK FD EC
Sbjct: 541 RRISFQELEQATDGFCASNLLGAGGYGSVYKGRLEDGTNVAIKVFNLGVEGAFKIFDTEC 600
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255572272|ref|XP_002527075.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533580|gb|EEF35319.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224116832|ref|XP_002317405.1| predicted protein [Populus trichocarpa] gi|222860470|gb|EEE98017.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359485453|ref|XP_003633276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359483675|ref|XP_003632999.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359483683|ref|XP_003633001.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359483685|ref|XP_002263372.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase EFR-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147776333|emb|CAN72034.1| hypothetical protein VITISV_000078 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359497186|ref|XP_003635448.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 540 | ||||||
| UNIPROTKB|Q40640 | 1025 | Xa21 "Receptor kinase-like pro | 0.985 | 0.519 | 0.375 | 3.6e-82 | |
| UNIPROTKB|O24435 | 813 | O24435 "Receptor kinase-like p | 0.985 | 0.654 | 0.362 | 1.1e-78 | |
| TAIR|locus:2075661 | 1025 | AT3G47110 [Arabidopsis thalian | 0.994 | 0.523 | 0.351 | 4e-74 | |
| TAIR|locus:2149922 | 1031 | EFR "EF-TU receptor" [Arabidop | 0.994 | 0.520 | 0.334 | 1.6e-71 | |
| TAIR|locus:2079142 | 1010 | AT3G47570 [Arabidopsis thalian | 0.992 | 0.530 | 0.348 | 1.8e-71 | |
| TAIR|locus:2075631 | 1009 | AT3G47090 [Arabidopsis thalian | 0.994 | 0.532 | 0.327 | 2.7e-67 | |
| TAIR|locus:2079157 | 1011 | AT3G47580 [Arabidopsis thalian | 0.994 | 0.531 | 0.313 | 1.8e-63 | |
| TAIR|locus:2120362 | 1249 | GSO1 "GASSHO1" [Arabidopsis th | 0.727 | 0.314 | 0.347 | 4.1e-55 | |
| TAIR|locus:2170483 | 1173 | FLS2 "FLAGELLIN-SENSITIVE 2" [ | 0.948 | 0.436 | 0.300 | 4.8e-55 | |
| TAIR|locus:2092810 | 1164 | BRL3 "BRI1-like 3" [Arabidopsi | 0.755 | 0.350 | 0.311 | 2.5e-42 |
| UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] | Back alignment and assigned GO terms |
|---|
Score = 824 (295.1 bits), Expect = 3.6e-82, P = 3.6e-82
Identities = 204/544 (37%), Positives = 285/544 (52%)
Query: 2 IPHEIGNLRNLELLVLSHNKLVGVIPTKVFNVSTLKVFEVXXXXXXXXXXXIAGVRLPNL 61
IP +G L +L + L N L G+IP ++N+S+L+ F V A L L
Sbjct: 216 IPSSLGQLSSLLTMNLGQNNLSGMIPNSIWNLSSLRAFSVRENKLGGMIPTNAFKTLHLL 275
Query: 62 EVLRMRSNNFCGTIPHFIFNASKLSLLELGDNSFSGFIPDTFGNLRNLNKVTLYNN-YLT 120
EV+ M +N F G IP + NAS L+++++ N FSG I FG LRNL ++ L+ N + T
Sbjct: 276 EVIDMGTNRFHGKIPASVANASHLTVIQIYGNLFSGIITSGFGRLRNLTELYLWRNLFQT 335
Query: 121 SSTSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLSHSLEYFYMPNCNVSGGIPE 180
D F+S L+NC L ++L +N L G+LP S NLS SL + + ++G IP+
Sbjct: 336 REQDDWGFISDLTNCSKLQTLNLGENNLGGVLPN-SFSNLSTSLSFLALELNKITGSIPK 394
Query: 181 EISNLTNLIIIYLGGNKLNGSIPITXXXXXXXXXXXXADNKLEGSIPNNICRLTELYELD 240
+I NL L +YL N GS+P + +N L GSIP I LTEL L
Sbjct: 395 DIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILL 454
Query: 241 LGSNKFSRSIPACFSNLASLRTLSLGSNELTS-IPLTFWNLKDI-LYLNFSSNFLTGPLP 298
LG+NKFS IP SNL +L +L L +N L+ IP +N++ + + +N S N L G +P
Sbjct: 455 LGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIP 514
Query: 299 LEIENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLIXXXXX 358
EI +LK LV N SG IP T+G + L+YL++ N L GSIP ++G L
Sbjct: 515 QEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRYLYLQNNLLSGSIPSALGQLKGLETL 574
Query: 359 XXXXXXXXGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNELLCGS-P 417
G IP SL ++ L LNLSFN GE+P G+F S S +GN LCG P
Sbjct: 575 DLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTIGAFAAASGISIQGNAKLCGGIP 634
Query: 418 NLRVPPCKTSTHHTSWKNALLLGTVLPLSTIFMIVVILLILRYRKRVKPPPNDANMP--P 475
+L +P C + L + L + + + LLI +++ K P+ +M P
Sbjct: 635 DLHLPRCCPLLENRKHFPVLPISVSLAAALAILSSLYLLITWHKRTKKGAPSRTSMKGHP 694
Query: 476 VATWRRFSYLELCRATDRFSENNLIGRGGFGSVYKARIQDGMEVAVKVFHLHCSGAFKSF 535
+ SY +L +ATD F+ NL+G G FGSVYK ++ VAVKV L A KSF
Sbjct: 695 LV-----SYSQLVKATDGFAPTNLLGSGSFGSVYKGKLNIQDHVAVKVLKLENPKALKSF 749
Query: 536 DVEC 539
EC
Sbjct: 750 TAEC 753
|
|
| UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2092810 BRL3 "BRI1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025217001 | SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (2202 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 540 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 9e-55 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-48 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-47 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-47 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-17 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-12 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-10 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-09 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-09 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-08 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 1e-08 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 1e-08 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 4e-08 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-06 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 7e-06 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 1e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 7e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 0.001 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 0.001 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 0.001 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 0.001 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 0.002 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 0.003 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.004 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 198 bits (505), Expect = 9e-55
Identities = 143/434 (32%), Positives = 212/434 (48%), Gaps = 57/434 (13%)
Query: 1 EIPHEIGNLRNLELLVLSHNKLVGVIPTKVFNVSTLKVFEVSNNSLSGSLSSIAGVRLPN 60
IP +GNL+NL+ L L NKL G IP +F++ L ++S+NSLSG + + ++L N
Sbjct: 251 PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELV-IQLQN 309
Query: 61 LEVLRMRSNNFCGTIPHFIFNASKLSLLELGDNSFSGFIPDTFGNLRNLNKVTLYNNYLT 120
LE+L + SNNF G IP + + +L +L+L N FSG IP +NL K +NN
Sbjct: 310 LEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIP------KNLGK---HNN--- 357
Query: 121 SSTSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLSHSLEYFYMPNCNVSGGIPE 180
LT +DLS N N++G IPE
Sbjct: 358 -----------------LTVLDLSTN--------------------------NLTGEIPE 374
Query: 181 EISNLTNLIIIYLGGNKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELYELD 240
+ + NL + L N L G IP +L + L+ + L DN G +P+ +L +Y LD
Sbjct: 375 GLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLD 434
Query: 241 LGSNKFSRSIPACFSNLASLRTLSLGSNELTSIPLTFWNLKDILYLNFSSNFLTGPLPLE 300
+ +N I + ++ SL+ LSL N+ + K + L+ S N +G +P +
Sbjct: 435 ISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRK 494
Query: 301 IENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLISLKSLNL 360
+ +L L+ + S N SG IP + S K L L + +N+L G IP S ++ L L+L
Sbjct: 495 LGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDL 554
Query: 361 SNNNLSGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNELLCGSPNLR 420
S N LSG IP +L + L +N+S N L G +P G+F +A + GN LCG
Sbjct: 555 SQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTS 614
Query: 421 -VPPCKTSTHHTSW 433
+PPCK SW
Sbjct: 615 GLPPCKRVRKTPSW 628
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 100.0 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 100.0 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 100.0 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.98 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.96 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.96 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.94 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.94 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.93 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.89 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.88 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.88 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.86 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.83 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.82 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.76 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.76 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.73 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.67 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.55 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.32 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.29 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.28 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.28 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.28 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.26 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.24 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.16 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.14 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.13 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.12 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.09 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.06 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.06 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.0 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.0 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.87 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.84 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.83 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.81 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.58 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 98.45 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.43 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.37 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.36 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.33 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.27 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.21 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 98.2 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.15 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.14 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.04 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.02 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.96 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 97.94 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.87 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.86 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.81 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.8 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.79 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 97.77 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.75 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.68 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.65 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 97.59 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 97.54 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 97.5 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.39 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.28 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 97.23 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.18 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.15 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 96.99 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 96.93 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.88 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 96.73 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 96.56 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.49 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 96.45 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 96.39 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 96.35 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 96.24 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 96.23 | |
| PTZ00284 | 467 | protein kinase; Provisional | 96.22 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 96.17 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 96.08 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 96.07 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 96.04 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 96.01 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 95.97 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 95.94 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 95.93 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.92 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.9 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 95.9 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 95.88 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 95.86 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 95.83 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 95.78 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 95.77 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 95.71 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 95.68 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 95.68 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 95.64 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 95.57 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 95.57 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 95.37 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 95.36 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 95.32 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 95.3 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 95.23 | |
| smart00090 | 237 | RIO RIO-like kinase. | 95.2 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 95.15 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 95.12 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 95.08 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 95.06 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 95.04 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 95.01 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 94.99 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 94.99 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 94.98 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 94.94 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 94.92 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.89 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 94.86 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 94.84 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 94.81 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 94.8 | |
| PF08693 | 40 | SKG6: Transmembrane alpha-helix domain; InterPro: | 94.8 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 94.79 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 94.74 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 94.73 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 94.69 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 94.69 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 94.69 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 94.67 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 94.64 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 94.63 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 94.58 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 94.58 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 94.56 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 94.43 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 94.38 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 94.16 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 94.08 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 94.06 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 94.03 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 94.0 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 93.93 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 93.83 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 93.81 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 93.7 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 93.59 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 93.55 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 93.54 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 93.46 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 93.43 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 93.42 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 93.36 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 93.34 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 93.22 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 93.15 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 93.11 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 93.1 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 92.68 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 92.56 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 92.56 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 92.47 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 92.21 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 92.19 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 92.1 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 91.95 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 91.8 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 91.31 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 91.27 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.04 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 91.04 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 90.97 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 90.22 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 90.14 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 90.07 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 90.07 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 89.76 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 89.73 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 89.24 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 89.04 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 88.72 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 88.59 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 88.55 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 88.43 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 88.39 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 87.94 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 86.95 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 86.79 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 86.5 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 86.39 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 86.31 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 85.98 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 85.31 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 83.95 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 83.42 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 83.17 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 83.1 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 82.95 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 82.23 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 81.92 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 81.85 | |
| KOG1235 | 538 | consensus Predicted unusual protein kinase [Genera | 81.73 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 81.6 | |
| KOG4258 | 1025 | consensus Insulin/growth factor receptor (contains | 80.11 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-60 Score=530.04 Aligned_cols=512 Identities=29% Similarity=0.450 Sum_probs=361.7
Q ss_pred CCcccCCCCCCCEEeccCcccccCCCccccCCCCCCEEEcccCcCccccchhhhcCCCCCCEEEccCCcccccCCccccC
Q 045304 2 IPHEIGNLRNLELLVLSHNKLVGVIPTKVFNVSTLKVFEVSNNSLSGSLSSIAGVRLPNLEVLRMRSNNFCGTIPHFIFN 81 (540)
Q Consensus 2 lp~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~ 81 (540)
+|..++++++|++|+|++|.+.+.+|..++.+++|++|++++|.+.+.+|..+ ..+++|++|++++|.+++.+|..+++
T Consensus 180 ~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~ 258 (968)
T PLN00113 180 IPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEI-GGLTSLNHLDLVYNNLTGPIPSSLGN 258 (968)
T ss_pred CChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhH-hcCCCCCEEECcCceeccccChhHhC
Confidence 57778888888888888888888888888888888888888888887777776 67888888888888888788888888
Q ss_pred CCCCCEEEccCCcccccCCccccCCCCCCEEECcCccccCCCCCccccccCCCCCCCCEEECcCCCCCccCCcccccccc
Q 045304 82 ASKLSLLELGDNSFSGFIPDTFGNLRNLNKVTLYNNYLTSSTSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLS 161 (540)
Q Consensus 82 l~~L~~L~L~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~l~ 161 (540)
+++|++|++++|.+.+.+|..+.++++|++|++++|.+.+. +|..+.++++|+.|++++|.+.+.+| ..+..+
T Consensus 259 l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~-----~p~~~~~l~~L~~L~l~~n~~~~~~~-~~~~~l- 331 (968)
T PLN00113 259 LKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE-----IPELVIQLQNLEILHLFSNNFTGKIP-VALTSL- 331 (968)
T ss_pred CCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccC-----CChhHcCCCCCcEEECCCCccCCcCC-hhHhcC-
Confidence 88888888888888777777777788888888887777654 44455556666666666666655555 444444
Q ss_pred ccCcEEEccCCcceecCChhccCCCCCCeeeccCCccccc------------------------cCccccCCCCCCeeee
Q 045304 162 HSLEYFYMPNCNVSGGIPEEISNLTNLIIIYLGGNKLNGS------------------------IPITLSKLQKLQGLSL 217 (540)
Q Consensus 162 ~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~------------------------~~~~l~~l~~L~~L~l 217 (540)
++|+.|++++|.+.+.+|..++.+++|+.|++++|++.+. +|..+..+++|+.|++
T Consensus 332 ~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L 411 (968)
T PLN00113 332 PRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRL 411 (968)
T ss_pred CCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEEC
Confidence 4555555555555555555555555555555555555444 4444455555555555
Q ss_pred eCccccCcCCccccCCCCCCeEEcCCCCCccccCccCCCCCCCCEeeCCCCCCCC-CCccccCCCCCcEEECCCCcccCC
Q 045304 218 ADNKLEGSIPNNICRLTELYELDLGSNKFSRSIPACFSNLASLRTLSLGSNELTS-IPLTFWNLKDILYLNFSSNFLTGP 296 (540)
Q Consensus 218 ~~n~~~~~~p~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~-ip~~~~~l~~L~~L~L~~n~l~~~ 296 (540)
++|.+++.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|.+.+ +|.. ...++|+.|++++|++.+.
T Consensus 412 ~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~-~~~~~L~~L~ls~n~l~~~ 490 (968)
T PLN00113 412 QDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKRLENLDLSRNQFSGA 490 (968)
T ss_pred cCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcc-cccccceEEECcCCccCCc
Confidence 5555555555555566666666666666666555555566666666666666655 4433 3446788888888888888
Q ss_pred CccccccccCcceEEcccceeeecCccccccCCCCcEEeCcCccCcccCCcccCCCCCCCEEECCCCcCccccCccccCC
Q 045304 297 LPLEIENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLISLKSLNLSNNNLSGTIPVSLEKL 376 (540)
Q Consensus 297 ~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~ 376 (540)
+|..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|.+++.+|..+..+++|+.|++++|++++.+|..+..+
T Consensus 491 ~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l 570 (968)
T PLN00113 491 VPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNV 570 (968)
T ss_pred cChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcC
Confidence 88889999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCeEEcccCcceeeCCCCCCCCCCCcccccCCCCCCCCC-CCCCCCCCCCCCcCccccceecccchhhHHHHHHHHHh
Q 045304 377 SYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNELLCGSP-NLRVPPCKTSTHHTSWKNALLLGTVLPLSTIFMIVVIL 455 (540)
Q Consensus 377 ~~L~~l~l~~n~l~~~~p~~~~~~~~~~~~~~~n~~~c~~~-~~~~~~~~~~~~~~~~~~~~~i~~~i~~~~~~~~~~~~ 455 (540)
++|+.+++++|++.|.+|..+.+..+....+.||+.+|+.+ ....++|..... ......++++++++++++++++++
T Consensus 571 ~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~~~~~~~~c~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~ 648 (968)
T PLN00113 571 ESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCKRVRK--TPSWWFYITCTLGAFLVLALVAFG 648 (968)
T ss_pred cccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCccccCCCCCccccc--cceeeeehhHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999864 223456643211 111222222222222222222222
Q ss_pred hheeeeccCCCCCCC---CCCCCCc-----ccccccHHHHHHHhccCCccCeeccCCCCcEEEEEe-cCCCEEEEEEecc
Q 045304 456 LILRYRKRVKPPPND---ANMPPVA-----TWRRFSYLELCRATDRFSENNLIGRGGFGSVYKARI-QDGMEVAVKVFHL 526 (540)
Q Consensus 456 ~~~~~~~~~~~~~~~---~~~~~~~-----~~~~~~~~~l~~at~~f~~~~~ig~G~~G~Vykg~l-~~g~~vAVK~l~~ 526 (540)
++++++|++...... ...+... ..+.++++++. ..|.++++||+|+||.||||+. .+|..||||++..
T Consensus 649 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~ig~G~~g~Vy~~~~~~~~~~vavK~~~~ 725 (968)
T PLN00113 649 FVFIRGRNNLELKRVENEDGTWELQFFDSKVSKSITINDIL---SSLKEENVISRGKKGASYKGKSIKNGMQFVVKEIND 725 (968)
T ss_pred HHHHHhhhcccccccccccccccccccccccchhhhHHHHH---hhCCcccEEccCCCeeEEEEEECCCCcEEEEEEccC
Confidence 222222221111100 0001100 11234445444 4578889999999999999997 5789999999964
Q ss_pred c
Q 045304 527 H 527 (540)
Q Consensus 527 ~ 527 (540)
.
T Consensus 726 ~ 726 (968)
T PLN00113 726 V 726 (968)
T ss_pred C
Confidence 3
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08693 SKG6: Transmembrane alpha-helix domain; InterPro: IPR014805 SKG6 and AXL2 are membrane proteins that show polarised intracellular localisation [, ] | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1235 consensus Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4258 consensus Insulin/growth factor receptor (contains protein kinase domain) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 540 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 3e-28 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 9e-28 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 1e-20 | ||
| 2o6q_A | 270 | Structural Diversity Of The Hagfish Variable Lympho | 6e-09 | ||
| 2omv_A | 461 | Crystal Structure Of Inla S192n Y369s/hec1 Complex | 8e-08 | ||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 1e-07 | ||
| 3cig_A | 697 | Crystal Structure Of Mouse Tlr3 Ectodomain Length = | 2e-07 | ||
| 2omu_A | 462 | Crystal Structure Of Inla G194s+s Y369s/hec1 Comple | 2e-07 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 4e-07 | ||
| 2omz_A | 466 | Crystal Structure Of Inla Y369a/hec1 Complex Length | 4e-07 | ||
| 2omy_A | 461 | Crystal Structure Of Inla S192n/hec1 Complex Length | 5e-07 | ||
| 2omx_A | 462 | Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX | 8e-07 | ||
| 1o6s_A | 466 | Internalin (Listeria Monocytogenes) E-Cadherin (Hum | 1e-06 | ||
| 2omt_A | 462 | Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt | 2e-06 | ||
| 3v47_A | 455 | Crystal Structure Of The N-Tetminal Fragment Of Zeb | 1e-05 | ||
| 3m18_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 4e-04 | ||
| 3m19_A | 251 | Crystal Structure Of Variable Lymphocyte Receptor V | 4e-04 | ||
| 2ft3_A | 332 | Crystal Structure Of The Biglycan Dimer Core Protei | 7e-04 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 | Back alignment and structure |
| >pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
| >pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 | Back alignment and structure |
| >pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 | Back alignment and structure |
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 | Back alignment and structure |
| >pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 | Back alignment and structure |
| >pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
| >pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 | Back alignment and structure |
| >pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 | Back alignment and structure |
| >pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 | Back alignment and structure |
| >pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 | Back alignment and structure |
| >pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 | Back alignment and structure |
| >pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 540 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-122 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-98 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-97 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-97 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-86 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-76 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-88 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 9e-58 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 8e-55 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-47 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-44 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 7e-18 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-70 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-70 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-67 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-60 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-53 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-52 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-43 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 5e-35 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-66 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-66 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-65 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-58 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-18 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-63 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-63 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-57 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-46 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-30 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-10 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-58 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-58 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-54 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-52 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-43 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-20 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-57 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-52 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-47 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-47 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-43 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-32 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-22 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-49 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-42 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-41 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-38 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-34 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-29 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 9e-20 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-49 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-46 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-46 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-41 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-32 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-30 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-47 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-46 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-43 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-33 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-45 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-39 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-32 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-29 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-17 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-42 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-40 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-28 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-26 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-41 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-38 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-38 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-29 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-19 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-39 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-37 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-33 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-33 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-23 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-10 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-09 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-38 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-37 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-29 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-27 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-38 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-37 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-31 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-29 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-37 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-35 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-29 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-19 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-36 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-30 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 9e-25 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-35 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-32 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-21 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-35 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-32 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 6e-31 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-34 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-34 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-34 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-30 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 7e-22 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-20 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-11 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-33 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-29 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-28 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 9e-18 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-12 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-32 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-29 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-26 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-23 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-22 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-31 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 5e-28 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-24 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-16 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-14 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-11 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-30 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-26 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-22 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-21 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-12 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 9e-09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-28 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-27 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-13 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-27 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 3e-25 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-25 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-23 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-13 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-10 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 9e-27 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 8e-26 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-13 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 9e-27 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-26 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-25 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-17 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 8e-17 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 8e-26 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 3e-22 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 8e-10 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 9e-26 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 1e-24 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-23 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 7e-12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-25 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-25 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-23 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-21 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-12 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 8e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-23 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-23 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 9e-22 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-20 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-14 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-23 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-23 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 3e-20 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 6e-18 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-14 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-22 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-16 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-14 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-14 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-10 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-10 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-20 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 5e-19 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-11 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-20 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-19 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 7e-19 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-11 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-20 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-20 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 7e-19 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-15 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 7e-19 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-17 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 4e-18 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-17 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-16 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-11 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 6e-18 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-17 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-17 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-08 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 3e-07 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 9e-18 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-15 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-12 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 5e-17 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 2e-16 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-15 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 7e-14 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 6e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 4e-15 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 8e-12 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 7e-15 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 5e-12 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-11 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-09 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-09 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 9e-14 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-10 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 2e-14 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 3e-12 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 3e-11 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 4e-06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 4e-14 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 6e-07 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 2e-06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 3e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-13 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 6e-11 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 9e-09 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 1e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-04 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-12 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 7e-05 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 3e-12 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 3e-11 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-10 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 6e-08 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-06 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 2e-11 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 8e-11 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 3e-10 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 7e-07 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 6e-06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 8e-06 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 2e-11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 3e-11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 3e-04 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 5e-11 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 3e-09 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 1e-08 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 7e-07 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 6e-06 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 4e-05 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 3e-09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-09 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 6e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-09 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 4e-08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 7e-08 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 7e-06 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-05 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 8e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-08 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 6e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-05 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 4e-08 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 5e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 9e-08 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 3e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 3e-05 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 4e-07 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 6e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 9e-07 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-04 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 2e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-06 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 3e-05 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 4e-05 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 5e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 7e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 7e-05 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 7e-05 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 9e-05 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 1e-04 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 1e-04 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 1e-04 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 2e-04 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 2e-04 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 2e-04 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-04 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 2e-04 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 3e-04 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 3e-04 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 3e-04 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 3e-04 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 3e-04 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 3e-04 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 4e-04 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 4e-04 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 4e-04 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 4e-04 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 5e-04 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 5e-04 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 5e-04 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 5e-04 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 6e-04 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 6e-04 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 6e-04 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 7e-04 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 7e-04 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 8e-04 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
Score = 376 bits (967), Expect = e-122
Identities = 133/438 (30%), Positives = 203/438 (46%), Gaps = 20/438 (4%)
Query: 1 EIPHE-IGNLRNLELLVLSHNKLVGVIPTKVFNVST-LKVFEVSNNSLSGSL-SSIAGVR 57
E+P + + +R L++L LS N+ G +P + N+S L ++S+N+ SG + ++
Sbjct: 333 ELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNP 392
Query: 58 LPNLEVLRMRSNNFCGTIPHFIFNASKLSLLELGDNSFSGFIPDTFGNLRNLNKVTLYNN 117
L+ L +++N F G IP + N S+L L L N SG IP + G+L L + L+ N
Sbjct: 393 KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLN 452
Query: 118 YLTSSTSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLSHSLEYFYMPNCNVSGG 177
L L KTL + L N L G +P + + N + +L + + N ++G
Sbjct: 453 MLEGE-----IPQELMYVKTLETLILDFNDLTGEIP-SGLSNCT-NLNWISLSNNRLTGE 505
Query: 178 IPEEISNLTNLIIIYLGGNKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELY 237
IP+ I L NL I+ L N +G+IP L + L L L N G+IP + + +
Sbjct: 506 IPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS--- 562
Query: 238 ELDLGSNKFSRSIPACFSNLASLRTLSLGSNELT---SIPLTFWNLKDILYLNFSSNFLT 294
+ +N + N + N L L N +S
Sbjct: 563 -GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYG 621
Query: 295 GPLPLEIENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLIS 354
G +N ++ +D S N SG IP IGS+ L L +G+N + GSIP +GDL
Sbjct: 622 GHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRG 681
Query: 355 LKSLNLSNNNLSGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNELLC 414
L L+LS+N L G IP ++ L+ L +++LS N L+G IP G F F F N LC
Sbjct: 682 LNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLC 741
Query: 415 GSPNLRVPPCKTSTHHTS 432
G P +P C S
Sbjct: 742 GYP---LPRCDPSNADGY 756
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 100.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 100.0 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 100.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 100.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 100.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 100.0 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 100.0 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 100.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 100.0 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 100.0 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 100.0 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 100.0 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 100.0 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 100.0 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 100.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 100.0 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 100.0 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 100.0 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 100.0 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 100.0 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 100.0 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 100.0 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 100.0 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 100.0 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 100.0 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 100.0 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 100.0 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 100.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 100.0 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 100.0 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 100.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 100.0 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 100.0 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 100.0 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 100.0 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 100.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 100.0 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 100.0 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.96 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.96 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.96 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.96 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.96 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.96 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.96 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.96 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.96 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.96 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.95 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.95 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.95 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.95 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.95 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.95 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.94 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.94 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.94 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.93 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.92 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.92 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.92 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.92 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.91 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.91 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.91 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.9 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.89 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.89 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.89 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.89 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.89 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.89 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.88 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.88 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.88 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.88 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.88 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.88 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.87 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.87 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.84 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.84 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.84 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.83 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.82 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.81 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.81 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.8 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.79 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.79 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.79 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.79 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.78 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.78 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.77 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.77 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.77 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.76 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.76 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.75 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.75 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.75 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.74 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.74 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.73 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.73 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.72 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.72 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.68 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.67 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.66 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.66 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.65 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.65 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 99.64 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.63 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.63 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.63 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.62 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 99.6 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.57 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.57 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.55 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.54 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.47 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 99.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.45 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.43 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 99.42 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.41 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.28 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.26 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 99.24 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.23 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.22 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 99.16 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.97 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.88 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.44 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.44 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.38 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.33 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 98.13 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 98.12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.08 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 98.07 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.99 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.96 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.93 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 97.91 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.9 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.66 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 97.6 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 97.5 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 97.43 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 97.35 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 97.33 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 97.3 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 97.26 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 97.21 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 97.15 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.14 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 97.13 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 97.12 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 97.11 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.11 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.05 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 97.03 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 96.98 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 96.97 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 96.96 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 96.86 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 96.85 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 96.84 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 96.8 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 96.8 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 96.8 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 96.79 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 96.77 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 96.77 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 96.75 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 96.75 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 96.74 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 96.74 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 96.72 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 96.7 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 96.68 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 96.68 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 96.68 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 96.66 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.64 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 96.63 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 96.58 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.58 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 96.57 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 96.57 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.56 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 96.56 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 96.56 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 96.54 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 96.54 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 96.52 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 96.5 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 96.49 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 96.47 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 96.47 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 96.46 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 96.45 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 96.45 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 96.45 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 96.44 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 96.44 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 96.42 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 96.4 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 96.4 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 96.38 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 96.38 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 96.37 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 96.32 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 96.32 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 96.32 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 96.31 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 96.3 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 96.3 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 96.3 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 96.3 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 96.29 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 96.29 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 96.25 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 96.25 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 96.25 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 96.24 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 96.23 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 96.23 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 96.22 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 96.22 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 96.22 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.21 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 96.2 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 96.18 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 96.17 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 96.16 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 96.15 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 96.14 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 96.14 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 96.14 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 96.14 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 96.14 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 96.14 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 96.14 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 96.13 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 96.12 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 96.11 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 96.1 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 96.1 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 96.1 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 96.08 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 96.08 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 96.07 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 96.07 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 96.06 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 96.05 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 96.04 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 96.02 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 96.01 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 95.98 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 95.98 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 95.98 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 95.97 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 95.95 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 95.95 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 95.95 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 95.94 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 95.94 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 95.93 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 95.91 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 95.91 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 95.9 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 95.9 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 95.88 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 95.87 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 95.87 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 95.86 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 95.85 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 95.85 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 95.85 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 95.84 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 95.84 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 95.84 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 95.84 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 95.83 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 95.82 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 95.82 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 95.81 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 95.81 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 95.76 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 95.76 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 95.76 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 95.74 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 95.66 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 95.66 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 95.64 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 95.63 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 95.61 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 95.6 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 95.6 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 95.59 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 95.58 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 95.57 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 95.57 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 95.51 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 95.48 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 95.48 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 95.46 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 95.45 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 95.45 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 95.42 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 95.41 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 95.38 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 95.37 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 95.36 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 95.36 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 95.34 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 95.33 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 95.32 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 95.31 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 95.27 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 95.25 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 95.15 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 95.14 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 95.12 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 95.05 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 94.95 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 94.93 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 94.84 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 94.65 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 94.58 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 94.44 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 94.23 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 93.23 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 91.8 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 89.35 | |
| 3f7w_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 84.71 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 84.26 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 83.1 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 81.61 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-56 Score=479.64 Aligned_cols=409 Identities=33% Similarity=0.545 Sum_probs=320.9
Q ss_pred CCCCCCEEeccCcccccCCCccccCC-CCCCEEEcccCcCccccchhhhcCCCCCCEEEccCCcccccCCcc-ccCCCCC
Q 045304 8 NLRNLELLVLSHNKLVGVIPTKVFNV-STLKVFEVSNNSLSGSLSSIAGVRLPNLEVLRMRSNNFCGTIPHF-IFNASKL 85 (540)
Q Consensus 8 ~l~~L~~L~L~~n~l~~~~~~~~~~l-~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~-l~~l~~L 85 (540)
.+++|++|++++|.+++.+|..+... ++|++|++++|.+++.+|..+ ..+++|++|++++|.+++.+|.. +.++++|
T Consensus 267 ~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L 345 (768)
T 3rgz_A 267 PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFF-GSCSLLESLALSSNNFSGELPMDTLLKMRGL 345 (768)
T ss_dssp CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGG-GGCTTCCEEECCSSEEEEECCHHHHTTCTTC
T ss_pred ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHH-hcCCCccEEECCCCcccCcCCHHHHhcCCCC
Confidence 56777777777777777777776654 777777777777776666665 57777777777777777666655 6777777
Q ss_pred CEEEccCCcccccCCccccCCC-CCCEEECcCccccCCCCCccccccCCC--CCCCCEEECcCCCCCccCCccccccccc
Q 045304 86 SLLELGDNSFSGFIPDTFGNLR-NLNKVTLYNNYLTSSTSDLNFLSSLSN--CKTLTYIDLSDNPLDGILPGTSVGNLSH 162 (540)
Q Consensus 86 ~~L~L~~n~~~~~~~~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~~~l~~--l~~L~~L~l~~n~l~~~~~~~~~~~l~~ 162 (540)
++|++++|.+++.+|..+.+++ +|++|++++|.+.+. ++..+.. +++|+.|++++|.+.+.+| ..++.+ +
T Consensus 346 ~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~-----~~~~~~~~~~~~L~~L~L~~n~l~~~~p-~~l~~l-~ 418 (768)
T 3rgz_A 346 KVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGP-----ILPNLCQNPKNTLQELYLQNNGFTGKIP-PTLSNC-S 418 (768)
T ss_dssp CEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEE-----CCTTTTCSTTCCCCEEECCSSEEEEECC-GGGGGC-T
T ss_pred CEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCC-----cChhhhhcccCCccEEECCCCccccccC-HHHhcC-C
Confidence 7777777777777777777666 777777777777654 3344444 6677777777777776666 566666 6
Q ss_pred cCcEEEccCCcceecCChhccCCCCCCeeeccCCccccccCccccCCCCCCeeeeeCccccCcCCccccCCCCCCeEEcC
Q 045304 163 SLEYFYMPNCNVSGGIPEEISNLTNLIIIYLGGNKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELYELDLG 242 (540)
Q Consensus 163 ~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~~~~l~~L~~L~l~ 242 (540)
+|++|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..+..+++|++|++++|.+++.+|..+..+++|++|+++
T Consensus 419 ~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~ 498 (768)
T 3rgz_A 419 ELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLS 498 (768)
T ss_dssp TCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECC
T ss_pred CCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEcc
Confidence 77777777777777777777777777777777777777777777777777777777777777777777777777777777
Q ss_pred CCCCccccCccCCCCCCCCEeeCCCCCCCC-CCccccCCCCCcEEECCCCcccCCCccc---------------------
Q 045304 243 SNKFSRSIPACFSNLASLRTLSLGSNELTS-IPLTFWNLKDILYLNFSSNFLTGPLPLE--------------------- 300 (540)
Q Consensus 243 ~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~-ip~~~~~l~~L~~L~L~~n~l~~~~~~~--------------------- 300 (540)
+|++++.+|..++.+++|++|++++|.+++ +|..+..+++|++|++++|++.|.+|..
T Consensus 499 ~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~ 578 (768)
T 3rgz_A 499 NNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYI 578 (768)
T ss_dssp SSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEE
T ss_pred CCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccc
Confidence 777777777777777777777777777765 6777777777777777777776666543
Q ss_pred -------------------------------------------------cccccCcceEEcccceeeecCccccccCCCC
Q 045304 301 -------------------------------------------------IENLKVLVGIDFSVNNFSGVIPTTIGSLKGL 331 (540)
Q Consensus 301 -------------------------------------------------~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L 331 (540)
+..++.|+.||+++|+++|.+|..++.++.|
T Consensus 579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L 658 (768)
T 3rgz_A 579 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYL 658 (768)
T ss_dssp ECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTC
T ss_pred ccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccC
Confidence 4445778999999999999999999999999
Q ss_pred cEEeCcCccCcccCCcccCCCCCCCEEECCCCcCccccCccccCCCCCCeEEcccCcceeeCCCCCCCCCCCcccccCCC
Q 045304 332 QYLFVGYNRLQGSIPYSIGDLISLKSLNLSNNNLSGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGGSFGNFSAESFEGNE 411 (540)
Q Consensus 332 ~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n~l~~~~p~~~~~~~~~~~~~~~n~ 411 (540)
+.|+|++|.++|.+|..++.+++|+.|||++|+++|.+|..+..+++|+.||+++|+++|.+|..+.+.++...++.||+
T Consensus 659 ~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~ 738 (768)
T 3rgz_A 659 FILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNP 738 (768)
T ss_dssp CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCT
T ss_pred CEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCCCCCCC
Q 045304 412 LLCGSPNLRVPPCKTS 427 (540)
Q Consensus 412 ~~c~~~~~~~~~~~~~ 427 (540)
.+||.|. ++|...
T Consensus 739 ~Lcg~~l---~~C~~~ 751 (768)
T 3rgz_A 739 GLCGYPL---PRCDPS 751 (768)
T ss_dssp EEESTTS---CCCCSC
T ss_pred hhcCCCC---cCCCCC
Confidence 9999763 367644
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 540 | ||||
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-25 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-18 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-11 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 7e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-21 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-20 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 2e-17 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-17 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-16 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-16 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 1e-06 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-19 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 3e-14 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 2e-13 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 4e-18 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-17 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 4e-12 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 3e-04 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 6e-13 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 9e-08 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-07 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 2e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-05 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 3e-09 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 5e-08 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 7e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 1e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-07 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 7e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 1e-08 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 1e-04 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 0.003 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-08 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 3e-04 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 4e-08 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 5e-08 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 7e-08 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 1e-07 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 1e-07 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 2e-07 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-07 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 4e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 6e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-04 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 3e-07 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 3e-07 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 4e-07 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 4e-07 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 5e-07 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 5e-07 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 6e-07 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 8e-07 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 8e-07 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 9e-07 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 1e-06 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 1e-06 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 1e-06 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 2e-06 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 2e-06 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-06 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 3e-06 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 3e-06 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 3e-06 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 3e-06 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-06 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 4e-06 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 5e-06 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 5e-06 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 1e-04 | |
| d2omxa2 | 199 | c.10.2.1 (A:37-235) Internalin B {Listeria monocyt | 5e-04 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 5e-06 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 7e-06 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 8e-06 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 8e-06 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 8e-06 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 8e-06 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 9e-06 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 9e-06 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 1e-05 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 1e-05 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 1e-05 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 1e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 1e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 8e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.004 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 1e-05 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 1e-05 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 2e-05 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 2e-05 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 2e-05 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 2e-05 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 2e-05 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 3e-05 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 3e-05 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 3e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 4e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 4e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.001 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 4e-05 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 8e-05 | |
| d1w8aa_ | 192 | c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga | 0.003 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 7e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 9e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 6e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 7e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 9e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 4e-05 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 5e-05 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 5e-05 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 5e-05 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 6e-05 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 7e-05 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 7e-05 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 7e-05 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 9e-05 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 1e-04 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 2e-04 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 3e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 4e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.004 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 0.004 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.002 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.004 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.004 |
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Internalin LRR domain domain: Internalin A species: Listeria monocytogenes [TaxId: 1639]
Score = 105 bits (263), Expect = 2e-25
Identities = 80/386 (20%), Positives = 145/386 (37%), Gaps = 28/386 (7%)
Query: 8 NLRNLELLVLSHNKLVGVIPTKVFNVSTLKVFEVSNNSLSGSLSSIAGVRLPNLEVLRMR 67
L VL + + ++ + + + S+ + L NL +
Sbjct: 20 ALAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIK-SIDGVE--YLNNLTQINFS 74
Query: 68 SNNFCGTIPHFIFNASKLSLLELGDNSFSGFIPDTFGNLRNLN------KVTLYNNYLTS 121
+N P + N +KL + + +N + P + +
Sbjct: 75 NNQLTDITP--LKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLT 132
Query: 122 STSDLNFLSSLSNCKTLTYIDLSDNPLDGILPGTSVGNLSHSLEYFYMPNCNVSGGIPEE 181
+ + L S+ + + S L T + L++ + +
Sbjct: 133 NLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISV 192
Query: 182 ISNLTNLIIIYLGGNKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELYELDL 241
++ LTNL + N+++ P+ + L LSL N+L+ + LT L +LDL
Sbjct: 193 LAKLTNLESLIATNNQISDITPLGILT--NLDELSLNGNQLKD--IGTLASLTNLTDLDL 248
Query: 242 GSNKFSRSIPACFSNLASLRTLSLGSNELTSIPLTFWNLKDILYLNFSSNFLTGPLPLEI 301
+N+ S P S L L L LG+N++++I L + L + N L P I
Sbjct: 249 ANNQISNLAP--LSGLTKLTELKLGANQISNIS-PLAGLTALTNLELNENQLEDISP--I 303
Query: 302 ENLKVLVGIDFSVNNFSGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLISLKSLNLS 361
NLK L + NN S + P + SL LQ LF N++ S+ +L ++ L+
Sbjct: 304 SNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAG 359
Query: 362 NNNLSGTIPVSLEKLSYLEDLNLSFN 387
+N +S P L L+ + L L+
Sbjct: 360 HNQISDLTP--LANLTRITQLGLNDQ 383
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 540 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.97 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.97 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.95 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.94 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.93 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.92 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.91 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.91 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.9 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.84 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.82 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.77 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.77 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.76 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.76 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.75 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.73 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.72 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.72 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.69 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.69 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.63 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.58 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.54 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.51 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.51 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.49 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.49 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.48 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.31 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.31 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.29 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.25 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.34 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.32 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 98.28 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 98.08 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 97.94 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 97.85 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 97.83 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.73 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 97.68 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.66 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.65 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 97.62 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 97.59 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 97.57 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 97.49 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 97.38 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 97.3 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 97.29 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 97.28 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 97.27 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 97.23 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 97.22 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 97.13 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 97.11 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 97.09 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.03 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 97.01 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 97.0 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.92 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 96.84 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 96.38 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00 E-value=3.9e-32 Score=259.61 Aligned_cols=257 Identities=33% Similarity=0.596 Sum_probs=226.3
Q ss_pred cCcEEEccCCccee--cCChhccCCCCCCeeeccC-CccccccCccccCCCCCCeeeeeCccccCcCCccccCCCCCCeE
Q 045304 163 SLEYFYMPNCNVSG--GIPEEISNLTNLIIIYLGG-NKLNGSIPITLSKLQKLQGLSLADNKLEGSIPNNICRLTELYEL 239 (540)
Q Consensus 163 ~L~~L~l~~~~~~~--~~~~~l~~l~~L~~L~l~~-n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~~~~l~~L~~L 239 (540)
+++.|+++++.+.| .+|+.++++++|++|++++ |.++|.+|..++++++|++|++++|++.+..+..+..+.+|+.+
T Consensus 51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l 130 (313)
T d1ogqa_ 51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTL 130 (313)
T ss_dssp CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEE
T ss_pred EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhccc
Confidence 46777777777765 5788888899999999986 78888888888899999999999999888888888888899999
Q ss_pred EcCCCCCccccCccCCCCCCCCEeeCCCCCCCC-CCccccCCCCC-cEEECCCCcccCCCccccccccCcceEEccccee
Q 045304 240 DLGSNKFSRSIPACFSNLASLRTLSLGSNELTS-IPLTFWNLKDI-LYLNFSSNFLTGPLPLEIENLKVLVGIDFSVNNF 317 (540)
Q Consensus 240 ~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~-ip~~~~~l~~L-~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~l 317 (540)
+++.|.+.+.+|..+..++.++.+++++|.+.+ +|..+..+..+ +.+++++|++++..|..+..+..+ .++++.+..
T Consensus 131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~ 209 (313)
T d1ogqa_ 131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNML 209 (313)
T ss_dssp ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEE
T ss_pred ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccc
Confidence 999998888888889999999999999998886 88888777776 889999999999988888877554 799999999
Q ss_pred eecCccccccCCCCcEEeCcCccCcccCCcccCCCCCCCEEECCCCcCccccCccccCCCCCCeEEcccCcceeeCCCCC
Q 045304 318 SGVIPTTIGSLKGLQYLFVGYNRLQGSIPYSIGDLISLKSLNLSNNNLSGTIPVSLEKLSYLEDLNLSFNKLAGEIPRGG 397 (540)
Q Consensus 318 ~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~l~l~~n~l~~~~p~~~ 397 (540)
.+.+|..+..+++++.+++++|.+.+.+| .+..+++|+.|++++|+++|.+|..+..+++|+.|++++|+++|.+|..+
T Consensus 210 ~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~ 288 (313)
T d1ogqa_ 210 EGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGG 288 (313)
T ss_dssp EECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCST
T ss_pred ccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcc
Confidence 99999999999999999999999997765 58889999999999999999999999999999999999999999999888
Q ss_pred CCCCCCcccccCCCCCCCCCCCCCCCC
Q 045304 398 SFGNFSAESFEGNELLCGSPNLRVPPC 424 (540)
Q Consensus 398 ~~~~~~~~~~~~n~~~c~~~~~~~~~~ 424 (540)
.+..+...++.+|+.+||.|. |+|
T Consensus 289 ~L~~L~~l~l~~N~~l~g~pl---p~c 312 (313)
T d1ogqa_ 289 NLQRFDVSAYANNKCLCGSPL---PAC 312 (313)
T ss_dssp TGGGSCGGGTCSSSEEESTTS---SCC
T ss_pred cCCCCCHHHhCCCccccCCCC---CCC
Confidence 888999999999999999763 566
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|