Citrus Sinensis ID: 045487

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73
MGRSDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF
ccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEEccccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEEEcccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccEEEEccccccccccccccEEcccccccccccHHHHccccccEEEccccEEEEEccccccccccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccc
ccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcHccccEEEcccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccccccEEEEEccccccccccHHHccHHHHHHHEEcccccccccccHHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHccHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHcccccccEEEcccccccccccccccccHHHccccccEEEEEccccccccccHHHccccHHccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEcccccccccccccc
mgrsdpdlfvPYLILFSVIVAAAANISRDQDALLSVKAHiindnprnilaqnwtsntsVCSWMGItcdiygnrvtsltipdlgltgtipsylgNLSSLQTLVlshnwfsgtipreignltkLKELRLRYNKLQGeipeelgnLAELEVLVLNnnlltgtipasifnlssistgldfsnnsltgsfpddmceglprlkgLYVSYnqfkgpipnnlwhckglssaslsfnqftgrlprdlgnltrLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNlltgaipaSIFNLSSMLTALdftnnsltgsfpddtchglprlkglYMSYnqfkgpipnnlwhckdlstvslsfnqftgriprdlgnstklKSLHLGLNNLIGeipqeignlrnleilgidqsnlvgfvpdtiLNISTLKILSLFnntfsgnlpssknliglpnlellnlglnnfsgsipsfcfnASKLYALELGYNSFSGLIPEALGNlrnlkrlglrrnyLTSSTSELMSFFSALVNCKSLKVIvlsenpldgvlpssignhsvSVEEIYMYKCnihgripkeiGSLInlttlglgdnnlsgslpmtLGRLKKLQGLYlqnnkfegpipqefchfsrlyevdmngnklsgsipsclgdlnslrilslssneltsiipstfwnledilsfdfssnslngslpleignLKAVVNIDLswnrlsgnipstivGLKNLQRLSlkhnklqgpipesf
mgrsdpdlFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSEnpldgvlpssiGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKnlqrlslkhnklqgpipesf
MGRSDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPeelgnlaelevlvlnnnllTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKnliglpnlellnlglnnFSGSIPSFCFNASKLYALELGYNSFSGLIPEAlgnlrnlkrlglrrnylTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSlinlttlglgdnnlsgslPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDlnslrilslssnelTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF
*******LFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRL***************
***SDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHII***********WTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF
MGRSDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF
***SDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRSDPDLFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query729 2.2.26 [Sep-21-2011]
C0LGQ5 1249 LRR receptor-like serine/ yes no 0.943 0.550 0.351 1e-97
Q9FL28 1173 LRR receptor-like serine/ no no 0.964 0.599 0.360 2e-97
P93194 1109 Receptor-like protein kin N/A no 0.927 0.609 0.348 5e-91
Q9LVP0 1102 Probable leucine-rich rep no no 0.864 0.571 0.369 5e-90
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.969 0.564 0.340 6e-90
Q9LP24 1120 Probable leucine-rich rep no no 0.984 0.641 0.342 2e-87
C0LGS2 1136 Probable LRR receptor-lik no no 0.935 0.600 0.335 1e-85
O49318 1124 Probable leucine-rich rep no no 0.906 0.588 0.330 8e-85
Q9SHI2 1101 Leucine-rich repeat recep no no 0.930 0.615 0.334 6e-84
Q9SSL9 1123 Leucine-rich repeat recep no no 0.871 0.565 0.339 3e-83
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function desciption
 Score =  358 bits (918), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 264/751 (35%), Positives = 379/751 (50%), Gaps = 63/751 (8%)

Query: 26  ISRDQDALLSVKAHIINDNPRNILAQNWTS-NTSVCSWMGITCDIYG-NRVTSLTIPDLG 83
           I+ D   LL VK  ++ +   +   + W S N + CSW G+TCD  G  RV +L +  LG
Sbjct: 23  INNDLQTLLEVKKSLVTNPQEDDPLRQWNSDNINYCSWTGVTCDNTGLFRVIALNLTGLG 82

Query: 84  LTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNL 143
           LTG+I  + G   +L  L LS N   G IP  + NLT L+ L L  N+L GEIP +LG+L
Sbjct: 83  LTGSISPWFGRFDNLIHLDLSSNNLVGPIPTALSNLTSLESLFLFSNQLTGEIPSQLGSL 142

Query: 144 AELEVLVLNNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSY 203
             +  L + +N L G IP ++ NL ++   L  ++  LTG  P  +   L R++ L +  
Sbjct: 143 VNIRSLRIGDNELVGDIPETLGNLVNLQM-LALASCRLTGPIPSQLGR-LVRVQSLILQD 200

Query: 204 NQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELG 263
           N  +GPIP  L +C  L+  + + N   G +P +LG L  L+ L L  N+L GEIP +LG
Sbjct: 201 NYLEGPIPAELGNCSDLTVFTAAENMLNGTIPAELGRLENLEILNLANNSLTGEIPSQLG 260

Query: 264 NLAELEMLVLTSNLLTGAIPASIFNLS-----------------------SMLTALDFTN 300
            +++L+ L L +N L G IP S+ +L                        S L  L   N
Sbjct: 261 EMSQLQYLSLMANQLQGLIPKSLADLGNLQTLDLSANNLTGEIPEEFWNMSQLLDLVLAN 320

Query: 301 NSLTGSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDL 360
           N L+GS P   C     L+ L +S  Q  G IP  L  C+ L  + LS N   G IP  L
Sbjct: 321 NHLSGSLPKSICSNNTNLEQLVLSGTQLSGEIPVELSKCQSLKQLDLSNNSLAGSIPEAL 380

Query: 361 ------------------------GNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGID 396
                                    N T L+ L L  NNL G++P+EI  LR LE+L + 
Sbjct: 381 FELVELTDLYLHNNTLEGTLSPSISNLTNLQWLVLYHNNLEGKLPKEISALRKLEVLFLY 440

Query: 397 QSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIG-LPNLELLNLGLNNFSGSIP 455
           ++   G +P  I N ++LK++ +F N F G +P S   IG L  L LL+L  N   G +P
Sbjct: 441 ENRFSGEIPQEIGNCTSLKMIDMFGNHFEGEIPPS---IGRLKELNLLHLRQNELVGGLP 497

Query: 456 SFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNC 515
           +   N  +L  L+L  N  SG IP + G L+ L++L L  N L  +  +      +L++ 
Sbjct: 498 ASLGNCHQLNILDLADNQLSGSIPSSFGFLKGLEQLMLYNNSLQGNLPD------SLISL 551

Query: 516 KSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLGLGDN 575
           ++L  I LS N L+G +    G  S S     +        IP E+G+  NL  L LG N
Sbjct: 552 RNLTRINLSHNRLNGTIHPLCG--SSSYLSFDVTNNGFEDEIPLELGNSQNLDRLRLGKN 609

Query: 576 NLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGD 635
            L+G +P TLG++++L  L + +N   G IP +     +L  +D+N N LSG IP  LG 
Sbjct: 610 QLTGKIPWTLGKIRELSLLDMSSNALTGTIPLQLVLCKKLTHIDLNNNFLSGPIPPWLGK 669

Query: 636 LNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWN 695
           L+ L  L LSSN+    +P+  +N   +L      NSLNGS+P EIGNL A+  ++L  N
Sbjct: 670 LSQLGELKLSSNQFVESLPTELFNCTKLLVLSLDGNSLNGSIPQEIGNLGALNVLNLDKN 729

Query: 696 RLSGNIPSTIVGLKNLQRLSLKHNKLQGPIP 726
           + SG++P  +  L  L  L L  N L G IP
Sbjct: 730 QFSGSLPQAMGKLSKLYELRLSRNSLTGEIP 760
Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
147776333 1205 hypothetical protein VITISV_000078 [Viti 0.953 0.576 0.439 1e-157
147853795 1420 hypothetical protein VITISV_005816 [Viti 0.951 0.488 0.439 1e-154
359485453 1202 PREDICTED: probable LRR receptor-like se 0.951 0.577 0.446 1e-154
359483683 1228 PREDICTED: LRR receptor-like serine/thre 0.951 0.565 0.432 1e-153
359483675 1250 PREDICTED: LRR receptor-like serine/thre 0.954 0.556 0.432 1e-151
359483677 1229 PREDICTED: LRR receptor-like serine/thre 0.954 0.566 0.415 1e-148
359485451 1454 PREDICTED: LRR receptor-like serine/thre 0.880 0.441 0.482 1e-148
449500845 982 PREDICTED: probable LRR receptor-like se 0.914 0.679 0.437 1e-147
147852480 1229 hypothetical protein VITISV_039533 [Viti 0.954 0.566 0.413 1e-146
359497186 1140 PREDICTED: LRR receptor-like serine/thre 0.920 0.588 0.431 1e-145
>gi|147776333|emb|CAN72034.1| hypothetical protein VITISV_000078 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  563 bits (1451), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 341/776 (43%), Positives = 464/776 (59%), Gaps = 81/776 (10%)

Query: 29  DQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTI 88
           D+ AL+++KAHI  D+ + ILA NW++ +S C+W GI+C+    RV+ + + ++GL GTI
Sbjct: 9   DESALIALKAHITYDS-QGILATNWSTKSSYCNWYGISCNAPHQRVSXINLSNMGLEGTI 67

Query: 89  PSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEV 148
              +GNLS L +L LS+N+F  ++P++IG   +L++L L  NKL G IPE + NL++LE 
Sbjct: 68  APQVGNLSFLVSLDLSNNYFHDSLPKDIGKCKELQQLNLFNNKLVGGIPEAICNLSKLEE 127

Query: 149 LVLNNNLLTG------------------------TIPASIFNLSSISTGLDFSNNSLTGS 184
           L L NN L G                        +IPA+IF++SS+   +  SNN+L+GS
Sbjct: 128 LYLGNNQLIGEIPKKMNXLQNLKVLSFPMNNLTSSIPATIFSISSL-LNISLSNNNLSGS 186

Query: 185 FPDDMCEGLPRLKGLYVS------------------------YNQFKGPIPN-------- 212
            P DMC   P+LK L +S                        YN F G IPN        
Sbjct: 187 LPMDMCYANPKLKELNLSSNHLSGKIPTGLGQCIKLQVISLAYNDFTGSIPNGIGNLVEL 246

Query: 213 ----------------NLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIG 256
                           NL HC+ L   S SFNQFTG +P+ +G+L  L+ LYL FN L G
Sbjct: 247 QRLSLRNNSLTGEIPSNLSHCRELRVLSSSFNQFTGGIPQAIGSLCNLEELYLAFNKLTG 306

Query: 257 EIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLP 316
            IP E+GNL+ L +L L SN ++G IPA IFN+SS L  +DFTNNSL+GS P   C  LP
Sbjct: 307 GIPREIGNLSNLNILQLGSNGISGPIPAEIFNISS-LQVIDFTNNSLSGSLPMGICKHLP 365

Query: 317 RLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNL 376
            L+GLY++ N   G +P  L  C +L  +SLSFN+F G IPR++GN +KL+ + L  N+L
Sbjct: 366 NLQGLYLAQNHLSGQLPTTLSLCGELLFLSLSFNKFRGSIPREIGNLSKLEHIDLRSNSL 425

Query: 377 IGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIG 436
           +G IP   GNL+ L+ L +  + L G VP+ I NIS L+ L+L  N  SG+LPSS   IG
Sbjct: 426 VGSIPTSFGNLKALKFLNLGINFLTGTVPEAIFNISELQNLALVQNHLSGSLPSS---IG 482

Query: 437 --LPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLR 494
             LP+LE L +G N FSG+IP    N SKL  L L  NSF+G +P+ L NL  LK L L 
Sbjct: 483 TWLPDLEGLYIGANEFSGTIPMSISNMSKLTVLSLSDNSFTGNVPKDLCNLTKLKFLNLA 542

Query: 495 RNYLTSST-SELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNI 553
            N LT    +  + F ++L NCK L+ + +  NPL G LP+S+GN  +++E    Y C  
Sbjct: 543 HNQLTDEHLASGVGFLTSLTNCKFLRYLWIGYNPLKGTLPNSLGNLPIALESFTAYACQF 602

Query: 554 HGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFS 613
            G IP  IG+L NL  L LG N+L+GS+P TLGRL+KLQ L++  N+  G IP + CH  
Sbjct: 603 RGTIPTGIGNLTNLIWLDLGANDLTGSIPTTLGRLQKLQRLHIAGNRIRGSIPNDLCHLK 662

Query: 614 RLYEVDMNGNKLSGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSL 673
            L  + ++ NKLSGS PSC GDL +LR L L SN L   IP++ W+L D+L  + SSN L
Sbjct: 663 NLGYLGLSSNKLSGSTPSCFGDLLALRELFLDSNALAFNIPTSLWSLRDLLVLNLSSNFL 722

Query: 674 NGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIVGLKNLQRLSLKHNKLQGPIPESF 729
            G+LP E+GN+K++  +DLS N +SG IPS +  L+ L  LSL  N+LQGPI   F
Sbjct: 723 TGNLPPEVGNMKSITTLDLSKNLVSGYIPSRMGKLQYLITLSLSQNRLQGPIXVEF 778

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147853795|emb|CAN81714.1| hypothetical protein VITISV_005816 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485453|ref|XP_003633276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483683|ref|XP_003633001.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483675|ref|XP_003632999.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483677|ref|XP_003633000.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449500845|ref|XP_004161209.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147852480|emb|CAN78527.1| hypothetical protein VITISV_039533 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359497186|ref|XP_003635448.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.965 0.600 0.320 3.9e-83
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.978 0.636 0.305 1.2e-78
UNIPROTKB|P93194 1109 INRPK1 "Receptor-like protein 0.958 0.630 0.299 2.8e-78
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.965 0.563 0.296 5.2e-75
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.967 0.563 0.301 1e-72
TAIR|locus:2032697 1123 PEPR1 "PEP1 receptor 1" [Arabi 0.964 0.626 0.293 1e-71
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.950 0.581 0.292 1.5e-71
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.947 0.627 0.296 2.3e-70
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.965 0.619 0.289 4.9e-70
TAIR|locus:2096349 860 RLP31 "receptor like protein 3 0.960 0.813 0.267 5.9e-70
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 834 (298.6 bits), Expect = 3.9e-83, P = 3.9e-83
 Identities = 233/728 (32%), Positives = 330/728 (45%)

Query:     8 LFVPYLILFSVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSV--CSWMGI 65
             L +     F  I  A  +   + +AL S K  I ND P  +L+ +WT   S+  C+W GI
Sbjct:     9 LILTLTFFFFGIALAKQSFEPEIEALKSFKNGISND-PLGVLS-DWTIIGSLRHCNWTGI 66

Query:    66 TCDIYGNRVTSLTIPDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKEL 125
             TCD  G+ V S+++ +  L G +   + NL+ LQ L L+ N F+G IP EIG LT+L +L
Sbjct:    67 TCDSTGH-VVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQL 125

Query:   126 RLRYNKLQGEIPXXXXXXXXXXXXXXXXXXXTGTIPASIFNLSSISTGLDFSNNSLTGSF 185
              L  N   G IP                   +G +P  I   SS+   + F  N+LTG  
Sbjct:   126 ILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVL-IGFDYNNLTGKI 184

Query:   186 PDDMCEG-LPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRL 244
             P+  C G L  L+    + N   G IP ++     L+   LS NQ TG++PRD GNL  L
Sbjct:   185 PE--CLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNL 242

Query:   245 KSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLT 304
             +SL L  N L G+IP E+GN + L  L L  N LTG IPA + NL   L AL    N LT
Sbjct:   243 QSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQ-LQALRIYKNKLT 301

Query:   305 GSFPDDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNST 364
              S P      L +L  L +S N   GPI   +   + L  ++L  N FTG  P+ + N  
Sbjct:   302 SSIPSSLFR-LTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLR 360

Query:   365 KLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTF 424
              L  L +G NN+ GE+P ++G L NL  L    + L G +P +I N + LK+L L +N  
Sbjct:   361 NLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQM 420

Query:   425 SGNLPSSKXXXXXXXXXXXXXXXXXFSGSIPSFCFNASKLYALELGYNSFSGLIPEAXXX 484
             +G +P                    F+G IP   FN S L  L +  N+ +G +      
Sbjct:   421 TGEIPRG---FGRMNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGK 477

Query:   485 XXXXXXXXXXXXXXTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVE 544
                           T      +       N K L ++ L  N   G +P  + N ++ ++
Sbjct:   478 LQKLRILQVSYNSLTGPIPREIG------NLKDLNILYLHSNGFTGRIPREMSNLTL-LQ 530

Query:   545 EIYMYKCNIHGRIPKEIGSXXXXXXXXXXXXXXXXXXPMTLGRLKKLQGLYLQNNKFEGP 604
              + MY  ++ G IP+E+                    P    +L+ L  L LQ NKF G 
Sbjct:   531 GLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGS 590

Query:   605 IPQEFCHFSRLYEVDMNGNKLSGSIPSCL--GDXXXXXXXXXXXXXXTSIIPSTFWNLED 662
             IP      S L   D++ N L+G+IP  L                  T  IP     LE 
Sbjct:   591 IPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEM 650

Query:   663 ILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTIV-GLKNLQRLSLKHNKL 721
             +   D S+N  +GS+P  +   K V  +D S N LSG+IP  +  G+  +  L+L  N  
Sbjct:   651 VQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSF 710

Query:   722 QGPIPESF 729
              G IP+SF
Sbjct:   711 SGEIPQSF 718
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006468 "protein phosphorylation" evidence=ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0004675 "transmembrane receptor protein serine/threonine kinase activity" evidence=ISS
GO:0016020 "membrane" evidence=ISS;IDA
GO:0016045 "detection of bacterium" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0042742 "defense response to bacterium" evidence=RCA;IMP
GO:0052544 "defense response by callose deposition in cell wall" evidence=IMP
GO:0010359 "regulation of anion channel activity" evidence=IMP
GO:0016310 "phosphorylation" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0006898 "receptor-mediated endocytosis" evidence=IDA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P93194 INRPK1 "Receptor-like protein kinase" [Ipomoea nil (taxid:35883)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032697 PEPR1 "PEP1 receptor 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096349 RLP31 "receptor like protein 31" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018759001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (1058 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-84
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-82
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-76
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-59
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-54
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-04
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  285 bits (731), Expect = 6e-84
 Identities = 217/625 (34%), Positives = 312/625 (49%), Gaps = 69/625 (11%)

Query: 33  LLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGTIPSYL 92
           LLS K+ I  ++P   L+ NW S+  VC W GITC+   +RV S+ +    ++G I S +
Sbjct: 34  LLSFKSSI--NDPLKYLS-NWNSSADVCLWQGITCN-NSSRVVSIDLSGKNISGKISSAI 89

Query: 93  GNLSSLQTLVLSHNWFSGTIPREIGNLT-KLKELRLRYNKLQGEIPEELGNLAELEVLVL 151
             L  +QT+ LS+N  SG IP +I   +  L+ L L  N   G IP   G++  LE L L
Sbjct: 90  FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDL 147

Query: 152 NNNLLTGTIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIP 211
           +NN+L+G IP  I + SS+   LD   N L G  P+ +   L  L+ L ++ NQ  G IP
Sbjct: 148 SNNMLSGEIPNDIGSFSSLKV-LDLGGNVLVGKIPNSLTN-LTSLEFLTLASNQLVGQIP 205

Query: 212 NNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEML 271
             L   K L    L +N  +G +P ++G LT L  L L +NNL G IP  LGNL  L+ L
Sbjct: 206 RELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYL 265

Query: 272 VLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGP 331
            L  N L+G IP SIF+L   L +LD ++NSL+G  P+     L  L+ L++  N F G 
Sbjct: 266 FLYQNKLSGPIPPSIFSLQK-LISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGK 323

Query: 332 IPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLE 391
           IP  L     L  + L  N+F+G IP++LG    L  L L  NNL GEIP+ + +  NL 
Sbjct: 324 IPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLF 383

Query: 392 ILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFS 451
            L +  ++L G +P ++    +L+ + L +N+FSG LPS      LP +  L++  NN  
Sbjct: 384 KLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS--EFTKLPLVYFLDISNNNLQ 441

Query: 452 GSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRNLKRLGLRRNYLTSSTSELMSFFSA 511
           G I S  ++   L  L L  N F G +P++ G+                           
Sbjct: 442 GRINSRKWDMPSLQMLSLARNKFFGGLPDSFGS--------------------------- 474

Query: 512 LVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINLTTLG 571
               K L+ + LS N   G +P  +G+ S                          L  L 
Sbjct: 475 ----KRLENLDLSRNQFSGAVPRKLGSLS-------------------------ELMQLK 505

Query: 572 LGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPS 631
           L +N LSG +P  L   KKL  L L +N+  G IP  F     L ++D++ N+LSG IP 
Sbjct: 506 LSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPK 565

Query: 632 CLGDLNSLRILSLSSNELTSIIPST 656
            LG++ SL  +++S N L   +PST
Sbjct: 566 NLGNVESLVQVNISHNHLHGSLPST 590

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 729
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.8
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.64
PLN03150623 hypothetical protein; Provisional 99.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.2
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.13
PLN03150623 hypothetical protein; Provisional 99.12
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.11
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.78
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.63
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.48
KOG4341483 consensus F-box protein containing LRR [General fu 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.37
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.13
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.08
KOG4341483 consensus F-box protein containing LRR [General fu 98.05
PRK15386 426 type III secretion protein GogB; Provisional 98.03
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.0
PRK15386 426 type III secretion protein GogB; Provisional 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.9
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.65
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.64
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.59
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.45
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.93
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.69
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.62
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.23
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.95
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.25
KOG4308 478 consensus LRR-containing protein [Function unknown 94.99
KOG4308 478 consensus LRR-containing protein [Function unknown 94.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.83
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.72
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.72
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.78
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.64
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.56
smart0037026 LRR Leucine-rich repeats, outliers. 87.92
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 87.92
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.64
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.37
smart0037026 LRR Leucine-rich repeats, outliers. 86.37
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-66  Score=610.46  Aligned_cols=603  Identities=35%  Similarity=0.556  Sum_probs=394.6

Q ss_pred             CCCCCCchHHHHHHHH-HHHHHhccCCHHHHHHHHHHHhhccCCCCCCcccCCCCCCCCCCccceeEeeCCCCcEEEEEc
Q 045487            1 MGRSDPDLFVPYLILF-SVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTI   79 (729)
Q Consensus         1 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~l~l   79 (729)
                      |+||-|..-..+++++ ++++-.+...++|+.+|++||+++  .+|.+.+ .+|....+||.|.||+|+. .++|+.|++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~--~~~~~~~-~~w~~~~~~c~w~gv~c~~-~~~v~~L~L   76 (968)
T PLN00113          1 MAKKGPQHCPYLIFMLFFLFLNFSMLHAEELELLLSFKSSI--NDPLKYL-SNWNSSADVCLWQGITCNN-SSRVVSIDL   76 (968)
T ss_pred             CCCCCCCCCChHHHHHHHHHHHccCCCHHHHHHHHHHHHhC--CCCcccC-CCCCCCCCCCcCcceecCC-CCcEEEEEe
Confidence            8888776543322222 222222333567899999999999  5676666 8998888999999999985 569999999


Q ss_pred             CCCCCccccCCCCCCCCCCCEEeCCCccCcccCCcccc-CCCCCceeeccCCcCCCcCcccccCCCCCCEEEccCCcCCC
Q 045487           80 PDLGLTGTIPSYLGNLSSLQTLVLSHNWFSGTIPREIG-NLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTG  158 (729)
Q Consensus        80 ~~~~~~~~~~~~l~~l~~L~~L~Ls~~~~~~~~~~~l~-~l~~L~~L~L~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~  158 (729)
                      +++.+.|.+++.+..+++|++|+|++|.+.+.+|..+. .+++|++|++++|.+++.+|.  +.+++|++|++++|.+.+
T Consensus        77 ~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~  154 (968)
T PLN00113         77 SGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSG  154 (968)
T ss_pred             cCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccc
Confidence            99999999988999999999999999999888887654 899999999999999888775  568899999999999887


Q ss_pred             CCCccccccccccccccccccccccCCCcchhccCCCccEEEeeecCCcCCCCccccccCCCCeEeccccccCCCCCccc
Q 045487          159 TIPASIFNLSSISTGLDFSNNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDL  238 (729)
Q Consensus       159 ~~p~~l~~l~~ll~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l  238 (729)
                      .+|..++++                          ++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+
T Consensus       155 ~~p~~~~~l--------------------------~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l  208 (968)
T PLN00113        155 EIPNDIGSF--------------------------SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPREL  208 (968)
T ss_pred             cCChHHhcC--------------------------CCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHH
Confidence            888777766                          788888888888877888888888888888888888877788888


Q ss_pred             cCCCCCCEEEcccCcCcccCChhhhCCCCCcEEEeecCcCccccChhhhhhccccceEEcccCcccccCCchhhccCCCC
Q 045487          239 GNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRL  318 (729)
Q Consensus       239 ~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L  318 (729)
                      +++++|++|++++|.+.+.+|..++++++|++|++++|.+.+.+|..+..+++ |+.|++++|.+.+.+|..+. .+++|
T Consensus       209 ~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~-L~~L~L~~n~l~~~~p~~l~-~l~~L  286 (968)
T PLN00113        209 GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKN-LQYLFLYQNKLSGPIPPSIF-SLQKL  286 (968)
T ss_pred             cCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCC-CCEEECcCCeeeccCchhHh-hccCc
Confidence            88888888888888888778888888888888888888777777777666665 66666666666554444332 23345


Q ss_pred             cEEEccccccCCCCCCCCCCCCCCCEEEccccccccccCcCccCCCCCcEEEeeCccccccccccccCCCCccEEEcccc
Q 045487          319 KGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRDLGNSTKLKSLHLGLNNLIGEIPQEIGNLRNLEILGIDQS  398 (729)
Q Consensus       319 ~~L~l~~~~~~~~~~~~l~~~~~L~~L~L~~~~l~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~  398 (729)
                      ++|++++|.+.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|
T Consensus       287 ~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n  366 (968)
T PLN00113        287 ISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN  366 (968)
T ss_pred             CEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCC
Confidence            55555555555444544555555555555555554444444444444555555444444444444444444444444444


Q ss_pred             cceeeCCccccCCCCCcEEECcCccCcccCCCccccCCCCCCcEEECCCCcCcccCCcchhcCCCCcEEEccCCcceecc
Q 045487          399 NLVGFVPDTILNISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLI  478 (729)
Q Consensus       399 ~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~  478 (729)
                      .+.+..|..+..                          +++|+.+++++|.+.+.+|..+..+++|+.+++++|.+++..
T Consensus       367 ~l~~~~p~~~~~--------------------------~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~  420 (968)
T PLN00113        367 NLTGEIPEGLCS--------------------------SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGEL  420 (968)
T ss_pred             eeEeeCChhHhC--------------------------cCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeEC
Confidence            444443333333                          344444444444444444444555555555555555555555


Q ss_pred             CccccccCCCcEEeccCCcccCCcchhhhhhhhhccCCCCcEEEccCCcccccCCcchhcCccccceEecccCcccccCC
Q 045487          479 PEALGNLRNLKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIP  558 (729)
Q Consensus       479 ~~~~~~l~~L~~L~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~  558 (729)
                      |..+..+++|+.+++++|.+.+.      .+..+..+++|+.|++++|.+                         .+.+|
T Consensus       421 p~~~~~l~~L~~L~Ls~N~l~~~------~~~~~~~l~~L~~L~L~~n~~-------------------------~~~~p  469 (968)
T PLN00113        421 PSEFTKLPLVYFLDISNNNLQGR------INSRKWDMPSLQMLSLARNKF-------------------------FGGLP  469 (968)
T ss_pred             ChhHhcCCCCCEEECcCCcccCc------cChhhccCCCCcEEECcCcee-------------------------eeecC
Confidence            54444444444444444443332      112222333333333333333                         33333


Q ss_pred             ccccCCCCccEEEccCCcccccCCccccccccCceEecCCCcccccCChhccCCCCCCEEECcCCccccccChhhcCCCC
Q 045487          559 KEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQEFCHFSRLYEVDMNGNKLSGSIPSCLGDLNS  638 (729)
Q Consensus       559 ~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~  638 (729)
                      ..+ ..++|+.|++++|++++..|..+.++++|+.|++++|++.+.+|..+..+++|++|++++|.+++.+|..+..+++
T Consensus       470 ~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~  548 (968)
T PLN00113        470 DSF-GSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPV  548 (968)
T ss_pred             ccc-ccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCccc
Confidence            322 2356677777777777666666666777777777777777666666666777777777777777667766776777


Q ss_pred             CCEEECcCCcCccCCChhhhccCCCCEEeCCCCcCcccCCccCcCCCCCCEEeCCCCc
Q 045487          639 LRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNR  696 (729)
Q Consensus       639 L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~ls~n~  696 (729)
                      |++|++++|++++.+|..+..+++|+.|++++|++.+.+|.. +.+..+....+.+|.
T Consensus       549 L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~  605 (968)
T PLN00113        549 LSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNI  605 (968)
T ss_pred             CCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCc
Confidence            777777777777667776766677777777777776666643 223334444444444

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-43
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-35
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-43
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-35
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-09
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-08
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-04
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-04
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 200/747 (26%), Positives = 307/747 (41%), Gaps = 81/747 (10%)
Query: 17  SVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTS 76
           S   + + ++ R+   L+S K  + + N    L  +W+SN + C++ G+TC    ++VTS
Sbjct: 1   SFQASPSQSLYREIHQLISFKDVLPDKN----LLPDWSSNKNPCTFDGVTC--RDDKVTS 54
Query: 77  LTIPDLGLT---GTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQ 133
           + +    L      + S L +L+ L++L LS++  +G++         L  L L  N L 
Sbjct: 55  IDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSV-SGFKCSASLTSLDLSRNSLS 113
Query: 134 GEIPXXXXXXXXXXXXXXXXXXXTGTIPASI---FNLSSISTGLDFSNNSLTGSFPDD-- 188
           G +                    T   P  +     L+S+   LD S NS++G+      
Sbjct: 114 GPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEV-LDLSANSISGANVVGWV 172
Query: 189 MCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLY 248
           + +G   LK L +S N+  G +  ++  C  L    +S N F+  +P  LG+ + L+ L 
Sbjct: 173 LSDGCGELKHLAISGNKISGDV--DVSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLD 229
Query: 249 LGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFP 308
           +  N L G+    +    EL++L ++SN   G IP     L S L  L    N  TG  P
Sbjct: 230 ISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPP--LPLKS-LQYLSLAENKFTGEIP 286
Query: 309 DDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRD-LGNSTKLK 367
           D        L GL +S N F G +P     C  L +++LS N F+G +P D L     LK
Sbjct: 287 DFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK 346
Query: 368 SLHLGLNNLIGEIPQEIGNLR-NLEILGIDQSNLVG-FVPDTILN-ISTLKILSLFNNTF 424
            L L  N   GE+P+ + NL  +L  L +  +N  G  +P+   N  +TL+ L L NN F
Sbjct: 347 VLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF 406
Query: 425 SGNLPSSKXXXXXXXXXXXXXXXXXFSGSIPSFCFNASKLYALELGYNSFSGLIPEAXXX 484
           +G +P +                   SG+IPS   + SKL  L+L  N   G IP+    
Sbjct: 407 TGKIPPT--LSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQ---- 460
Query: 485 XXXXXXXXXXXXXXTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVE 544
                              ELM         K+L+ ++L  N L G +PS + N   ++ 
Sbjct: 461 -------------------ELMYV-------KTLETLILDFNDLTGEIPSGLSN-CTNLN 493
Query: 545 EIYMYKCNIHGRIPKEIGSXXXXXXXXXXXXXXXXXXPMTLGRLKKLQGLYLQNNKFEGP 604
            I +    + G IPK IG                   P  LG  + L  L L  N F G 
Sbjct: 494 WISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGT 553
Query: 605 IPQE-----------FCHFSRLYEVDMNGNK-----------LSGSIPSCLGDXXXXXXX 642
           IP             F    R   +  +G K             G     L         
Sbjct: 554 IPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPC 613
Query: 643 XXXXXXXTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIP 702
                        TF N   ++  D S N L+G +P EIG++  +  ++L  N +SG+IP
Sbjct: 614 NITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 673
Query: 703 STIVGLKNLQRLSLKHNKLQGPIPESF 729
             +  L+ L  L L  NKL G IP++ 
Sbjct: 674 DEVGDLRGLNILDLSSNKLDGRIPQAM 700
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-179
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-98
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-69
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-89
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-82
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-81
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-80
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-80
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-77
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-74
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-71
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-49
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-75
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-71
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-66
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-25
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-58
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-55
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-50
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-34
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-69
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-66
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-51
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-50
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-50
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-49
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-25
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-45
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-40
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-41
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-37
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-32
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-32
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-38
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-30
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-36
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-30
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-35
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-26
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-25
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-29
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-28
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-25
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-24
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-27
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-24
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-26
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 7e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-26
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 9e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-21
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-22
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-16
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-20
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-20
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-11
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 5e-04
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-10
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 7e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  528 bits (1363), Expect = e-179
 Identities = 212/744 (28%), Positives = 333/744 (44%), Gaps = 75/744 (10%)

Query: 17  SVIVAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTS 76
           S   + + ++ R+   L+S K  + + N    L  +W+SN + C++ G+TC    ++VTS
Sbjct: 1   SFQASPSQSLYREIHQLISFKDVLPDKN----LLPDWSSNKNPCTFDGVTCR--DDKVTS 54

Query: 77  LTIPDLGLT---GTIPSYLGNLSSLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQ 133
           + +    L      + S L +L+ L++L LS++  +G++         L  L L  N L 
Sbjct: 55  IDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVS-GFKCSASLTSLDLSRNSLS 113

Query: 134 GEIPE--ELGNLAELEVLVLNNNLLTGTIPASIF-NLSSISTGLDFSNNSLTGSFPDD-- 188
           G +     LG+ + L+ L +++N L      S    L+S+   LD S NS++G+      
Sbjct: 114 GPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEV-LDLSANSISGANVVGWV 172

Query: 189 MCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLY 248
           + +G   LK L +S N+  G +   +  C  L    +S N F+  +P  LG+ + L+ L 
Sbjct: 173 LSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLD 229

Query: 249 LGFNNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFP 308
           +  N L G+    +    EL++L ++SN   G IP         L  L    N  TG  P
Sbjct: 230 ISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPL---KSLQYLSLAENKFTGEIP 286

Query: 309 DDTCHGLPRLKGLYMSYNQFKGPIPNNLWHCKDLSTVSLSFNQFTGRIPRD-LGNSTKLK 367
           D        L GL +S N F G +P     C  L +++LS N F+G +P D L     LK
Sbjct: 287 DFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLK 346

Query: 368 SLHLGLNNLIGEIPQEIGNLRNLEILGIDQSNLVGFVPDTILNISTLKILSLFNNTFSGN 427
            L L  N   GE+P+ + NL                        ++L  L L +N FSG 
Sbjct: 347 VLDLSFNEFSGELPESLTNLS-----------------------ASLLTLDLSSNNFSGP 383

Query: 428 LPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRN 487
           +  +        L+ L L  N F+G IP    N S+L +L L +N  SG IP +LG+L  
Sbjct: 384 ILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK 443

Query: 488 LKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIY 547
           L+ L L  N L             L+  K+L+ ++L  N L G +PS + N + ++  I 
Sbjct: 444 LRDLKLWLNMLEGE------IPQELMYVKTLETLILDFNDLTGEIPSGLSNCT-NLNWIS 496

Query: 548 MYKCNIHGRIPKEIGSLINLTTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNNKFEGPIPQ 607
           +    + G IPK IG L NL  L L +N+ SG++P  LG  + L  L L  N F G IP 
Sbjct: 497 LSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPA 556

Query: 608 EF----------------------CHFSRLYEVDMNGNKLSGSIPSCLGDLNSLRILSLS 645
                                       +      N  +  G     L  L++    +++
Sbjct: 557 AMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNIT 616

Query: 646 SNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTI 705
           S         TF N   ++  D S N L+G +P EIG++  +  ++L  N +SG+IP  +
Sbjct: 617 SRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEV 676

Query: 706 VGLKNLQRLSLKHNKLQGPIPESF 729
             L+ L  L L  NKL G IP++ 
Sbjct: 677 GDLRGLNILDLSSNKLDGRIPQAM 700
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.72
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.57
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.16
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.06
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.91
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.22
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.47
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.75
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.65
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-84  Score=744.66  Aligned_cols=686  Identities=30%  Similarity=0.470  Sum_probs=544.7

Q ss_pred             HHhccCCHHHHHHHHHHHhhccCCCCCCcccCCCCCCCCCCccceeEeeCCCCcEEEEEcCCCCCccc---cCCCCCCCC
Q 045487           20 VAAAANISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCSWMGITCDIYGNRVTSLTIPDLGLTGT---IPSYLGNLS   96 (729)
Q Consensus        20 ~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~~~~~~v~~l~l~~~~~~~~---~~~~l~~l~   96 (729)
                      .+++++.++|++||++||+++  .||. ++ .+|..+++||+|.||+|+  .+||++|++++.++.|.   +++.+.+++
T Consensus         4 ~~~~~~~~~~~~all~~k~~~--~~~~-~l-~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~   77 (768)
T 3rgz_A            4 ASPSQSLYREIHQLISFKDVL--PDKN-LL-PDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLT   77 (768)
T ss_dssp             ----CCHHHHHHHHHHHHTTC--SCTT-SS-TTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCT
T ss_pred             CccccCCHHHHHHHHHHHhhC--CCcc-cc-cCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccC
Confidence            345566788999999999999  5777 66 899988999999999999  68999999999999998   888999999


Q ss_pred             CCCEEeCCCccCcccCCccccCCCCCceeeccCCcCCCcCcc--cccCCCCCCEEEccCCcCCCCCCccc-ccccccccc
Q 045487           97 SLQTLVLSHNWFSGTIPREIGNLTKLKELRLRYNKLQGEIPE--ELGNLAELEVLVLNNNLLTGTIPASI-FNLSSISTG  173 (729)
Q Consensus        97 ~L~~L~Ls~~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~p~--~~~~l~~L~~L~l~~~~~~~~~p~~l-~~l~~ll~~  173 (729)
                      +|+.++++.+.+. .+|..++++++|++|+|++|.+.+.+|.  .++++++|++|++++|.+.+..|..+ .+++++ ++
T Consensus        78 ~L~~l~~~~~~~~-~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L-~~  155 (768)
T 3rgz_A           78 GLESLFLSNSHIN-GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSL-EV  155 (768)
T ss_dssp             TCCEEECTTSCEE-ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTC-SE
T ss_pred             cccccCCcCCCcC-CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCC-CE
Confidence            9999999998775 4678899999999999999999988998  99999999999999999988888766 677666 88


Q ss_pred             ccccccccccCCCcch--hccCCCccEEEeeecCCcCCCCccccccCCCCeEeccccccCCCCCccccCCCCCCEEEccc
Q 045487          174 LDFSNNSLTGSFPDDM--CEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGF  251 (729)
Q Consensus       174 L~l~~~~~~~~~~~~~--~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~  251 (729)
                      |++++|.+.+..+..+  +..+++|++|++++|.+++..+.  ..+++|++|++++|.+.+.+|. ++++++|++|++++
T Consensus       156 L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~  232 (768)
T 3rgz_A          156 LDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISG  232 (768)
T ss_dssp             EECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCS
T ss_pred             EECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcC
Confidence            8888888887666553  55668888888888888765543  7788888888888888877666 88888888888888


Q ss_pred             CcCcccCChhhhCCCCCcEEEeecCcCccccChhhhhhccccceEEcccCcccccCCchhhccCCCCcEEEccccccCCC
Q 045487          252 NNLIGEIPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQFKGP  331 (729)
Q Consensus       252 ~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~~~~~~~  331 (729)
                      |.+++.+|..++++++|++|++++|.+.+.+|..  .+++ |++|++++|.+.+.+|..+...+++|++|++++|.+.+.
T Consensus       233 n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~--~l~~-L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~  309 (768)
T 3rgz_A          233 NKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKS-LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGA  309 (768)
T ss_dssp             SCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC--CCTT-CCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEEC
T ss_pred             CcCCCcccHHHhcCCCCCEEECCCCcccCccCcc--ccCC-CCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCc
Confidence            8888888888888888888888888887777654  4555 888888888888788877776667788888888888877


Q ss_pred             CCCCCCCCCCCCEEEccccccccccCcC-ccCCCCCcEEEeeCccccccccccccCCC-CccEEEcccccceeeCCcccc
Q 045487          332 IPNNLWHCKDLSTVSLSFNQFTGRIPRD-LGNSTKLKSLHLGLNNLIGEIPQEIGNLR-NLEILGIDQSNLVGFVPDTIL  409 (729)
Q Consensus       332 ~~~~l~~~~~L~~L~L~~~~l~~~~~~~-~~~l~~L~~L~l~~~~~~~~~~~~~~~l~-~L~~L~l~~~~~~~~~~~~~~  409 (729)
                      .|..+..+++|++|++++|.+.+.+|.. +..+++|++|++++|.+.+.+|..+..++ +|++|++++|.+.+..+..+.
T Consensus       310 ~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~  389 (768)
T 3rgz_A          310 VPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC  389 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTT
T ss_pred             cchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhh
Confidence            7888888888888888888887777655 77788888888888888777787777776 788888888888877777666


Q ss_pred             C--CCCCcEEECcCccCcccCCCccccCCCCCCcEEECCCCcCcccCCcchhcCCCCcEEEccCCcceeccCccccccCC
Q 045487          410 N--ISTLKILSLFNNTFSGNLPSSKNLIGLPNLELLNLGLNNFSGSIPSFCFNASKLYALELGYNSFSGLIPEALGNLRN  487 (729)
Q Consensus       410 ~--l~~L~~L~l~~n~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~  487 (729)
                      .  +++|++|++++|.+.+.+|..+..  +++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+..|..+..+++
T Consensus       390 ~~~~~~L~~L~L~~n~l~~~~p~~l~~--l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~  467 (768)
T 3rgz_A          390 QNPKNTLQELYLQNNGFTGKIPPTLSN--CSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT  467 (768)
T ss_dssp             CSTTCCCCEEECCSSEEEEECCGGGGG--CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTT
T ss_pred             hcccCCccEEECCCCccccccCHHHhc--CCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCC
Confidence            5  677888888888887776655443  778888888888888777888888888888888888888777878888888


Q ss_pred             CcEEeccCCcccCCcchhhhhhhhhccCCCCcEEEccCCcccccCCcchhcCccccceEecccCcccccCCccccCCCCc
Q 045487          488 LKRLGLRRNYLTSSTSELMSFFSALVNCKSLKVIVLSENPLDGVLPSSIGNHSVSVEEIYMYKCNIHGRIPKEIGSLINL  567 (729)
Q Consensus       488 L~~L~l~~~~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L  567 (729)
                      |++|++++|++++.      ++..+..+++|++|++++|.+.+.+|.++...+ +|+.|++++|.+.+.+|..+..+++|
T Consensus       468 L~~L~L~~N~l~~~------~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~-~L~~L~L~~N~l~~~~p~~l~~l~~L  540 (768)
T 3rgz_A          468 LETLILDFNDLTGE------IPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLE-NLAILKLSNNSFSGNIPAELGDCRSL  540 (768)
T ss_dssp             CCEEECCSSCCCSC------CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECCSSCCEEECCGGGGGCTTC
T ss_pred             ceEEEecCCcccCc------CCHHHhcCCCCCEEEccCCccCCcCChHHhcCC-CCCEEECCCCcccCcCCHHHcCCCCC
Confidence            88888888887765      345677778888888888888888888777766 78888888888888888888888888


Q ss_pred             cEEEccCCcccccCCccccccccCceEecCCC----------------------cccccCChhccCCCCCCEEECcCCcc
Q 045487          568 TTLGLGDNNLSGSLPMTLGRLKKLQGLYLQNN----------------------KFEGPIPQEFCHFSRLYEVDMNGNKL  625 (729)
Q Consensus       568 ~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n----------------------~l~~~~~~~~~~l~~L~~L~l~~n~~  625 (729)
                      ++|++++|++++.+|..+..+..+..+++...                      .+.+..+..+..++.++.++++.|.+
T Consensus       541 ~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~  620 (768)
T 3rgz_A          541 IWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVY  620 (768)
T ss_dssp             CEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEE
T ss_pred             CEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhcccccccccccccee
Confidence            88888888888777777665555444433321                      12223333444455556666777777


Q ss_pred             ccccChhhcCCCCCCEEECcCCcCccCCChhhhccCCCCEEeCCCCcCcccCCccCcCCCCCCEEeCCCCcccccccccc
Q 045487          626 SGSIPSCLGDLNSLRILSLSSNELTSIIPSTFWNLEDILSFDFSSNSLNGSLPLEIGNLKAVVNIDLSWNRLSGNIPSTI  705 (729)
Q Consensus       626 ~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~ls~n~~~~~~p~~l  705 (729)
                      .|.+|..+..+++|+.|++++|++++.+|..++.+++|+.|+|++|+++|.+|..++++++|+.|||++|+++|.+|..+
T Consensus       621 ~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l  700 (768)
T 3rgz_A          621 GGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAM  700 (768)
T ss_dssp             EEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGG
T ss_pred             cccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHH
Confidence            77777777778888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             ccCCCCCeeeccCCccccCCCCC
Q 045487          706 VGLKNLQRLSLKHNKLQGPIPES  728 (729)
Q Consensus       706 ~~l~~L~~l~l~~n~l~~~~p~~  728 (729)
                      +.+++|++|++++|+++|.||++
T Consensus       701 ~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          701 SALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             GGCCCCSEEECCSSEEEEECCSS
T ss_pred             hCCCCCCEEECcCCcccccCCCc
Confidence            88888888888888888888764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 729
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-24
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 2e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1 242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 4e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 5e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 9e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score =  100 bits (250), Expect = 5e-24
 Identities = 77/310 (24%), Positives = 110/310 (35%), Gaps = 57/310 (18%)

Query: 26  ISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVC--SWMGITCDIYGN--RVTSLTIPD 81
             +D+ ALL +K  + N         +W   T  C  +W+G+ CD      RV +L +  
Sbjct: 4   NPQDKQALLQIKKDLGNPT----TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSG 59

Query: 82  LGLTG--TIPSYLGNLSSLQTLVLSHNW-FSGTIPREIGNLTKLKELRLRYN-------- 130
           L L     IPS L NL  L  L +       G IP  I  LT+L  L + +         
Sbjct: 60  LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD 119

Query: 131 ----------------KLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGL 174
                            L G +P  + +L  L  +  + N ++G IP S  + S + T +
Sbjct: 120 FLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSM 179

Query: 175 DFSNNSLTGSFPDDMCEGLPRLK---------------------GLYVSYNQFKGPIPNN 213
             S N LTG  P                                                
Sbjct: 180 TISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGK 239

Query: 214 LWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGEIPEELGNLAELEMLVL 273
           +   K L+   L  N+  G LP+ L  L  L SL + FNNL GEIP + GNL   ++   
Sbjct: 240 VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAY 298

Query: 274 TSNLLTGAIP 283
            +N      P
Sbjct: 299 ANNKCLCGSP 308
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.32
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.54
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.49
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.4
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=6.6e-37  Score=309.35  Aligned_cols=293  Identities=30%  Similarity=0.483  Sum_probs=209.3

Q ss_pred             CCHHHHHHHHHHHhhccCCCCCCcccCCCCCCCCCCc--cceeEeeCCC--CcEEEEEcCCCCCcc--ccCCCCCCCCCC
Q 045487           25 NISRDQDALLSVKAHIINDNPRNILAQNWTSNTSVCS--WMGITCDIYG--NRVTSLTIPDLGLTG--TIPSYLGNLSSL   98 (729)
Q Consensus        25 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~w~~~~~~c~--w~gv~c~~~~--~~v~~l~l~~~~~~~--~~~~~l~~l~~L   98 (729)
                      |.++|++||++||+++  .+|. .+ .+|..++|||.  |.||+|+...  .||++|+++++++.|  .+|+.++++++|
T Consensus         3 c~~~e~~aLl~~k~~~--~~~~-~l-~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L   78 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDL--GNPT-TL-SSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYL   78 (313)
T ss_dssp             SCHHHHHHHHHHHHHT--TCCG-GG-TTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTC
T ss_pred             CCHHHHHHHHHHHHHC--CCCC-cC-CCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccc
Confidence            7889999999999999  5663 45 89998999994  9999998644  389999999999987  578999999999


Q ss_pred             CEEeCCC-ccCcccCCccccCCCCCceeeccCCcCCCcCcccccCCCCCCEEEccCCcCCCCCCcccccccccccccccc
Q 045487           99 QTLVLSH-NWFSGTIPREIGNLTKLKELRLRYNKLQGEIPEELGNLAELEVLVLNNNLLTGTIPASIFNLSSISTGLDFS  177 (729)
Q Consensus        99 ~~L~Ls~-~~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~p~~~~~l~~L~~L~l~~~~~~~~~p~~l~~l~~ll~~L~l~  177 (729)
                      ++|+|++ |.+.|.+|..|+++++|++|+|++|++.+..+..+..+.+|++++++.|.+.+.+|..+.+++.+ +.++++
T Consensus        79 ~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L-~~l~l~  157 (313)
T d1ogqa_          79 NFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNL-VGITFD  157 (313)
T ss_dssp             SEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTC-CEEECC
T ss_pred             cccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCccc-ceeecc
Confidence            9999997 68999999999999999999999999998889889999999999999999988899999888555 566666


Q ss_pred             ccccccCCCcchhccCCCccEEEeeecCCcCCCCccccccCCCCeEeccccccCCCCCccccCCCCCCEEEcccCcCccc
Q 045487          178 NNSLTGSFPDDMCEGLPRLKGLYVSYNQFKGPIPNNLWHCKGLSSASLSFNQFTGRLPRDLGNLTRLKSLYLGFNNLIGE  257 (729)
Q Consensus       178 ~~~~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~~L~~L~l~~~~~~~~  257 (729)
                      +|.+.+.+|..+......++.+++++|++++..|..+..+..+ ++++..+...+.+|..+..+++++.++++++.+.+.
T Consensus       158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~  236 (313)
T d1ogqa_         158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFD  236 (313)
T ss_dssp             SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCB
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccccccccccccccccccc
Confidence            6666666665555442333556666666655555555544333 455555555555555555666666666666655544


Q ss_pred             CChhhhCCCCCcEEEeecCcCccccChhhhhhccccceEEcccCcccccCCchhhccCCCCcEEEccccc
Q 045487          258 IPEELGNLAELEMLVLTSNLLTGAIPASIFNLSSMLTALDFTNNSLTGSFPDDTCHGLPRLKGLYMSYNQ  327 (729)
Q Consensus       258 ~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~~L~~L~l~~~~  327 (729)
                      ++ .++.+++|++|++++|+++|.+|.++..+++ |++|++++|+++|.+|..  ..+++|+.+++++|+
T Consensus       237 ~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~-L~~L~Ls~N~l~g~iP~~--~~L~~L~~l~l~~N~  302 (313)
T d1ogqa_         237 LG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKF-LHSLNVSFNNLCGEIPQG--GNLQRFDVSAYANNK  302 (313)
T ss_dssp             GG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTT-CCEEECCSSEEEEECCCS--TTGGGSCGGGTCSSS
T ss_pred             cc-ccccccccccccCccCeecccCChHHhCCCC-CCEEECcCCcccccCCCc--ccCCCCCHHHhCCCc
Confidence            33 3555556666666666665555555555554 555555555555555431  223334444444443
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure