Citrus Sinensis ID: 045549
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 134 | ||||||
| 225459979 | 979 | PREDICTED: receptor-like protein 12-like | 0.865 | 0.118 | 0.382 | 8e-17 | |
| 225462116 | 1001 | PREDICTED: receptor-like protein 12-like | 0.776 | 0.103 | 0.458 | 6e-16 | |
| 359493479 | 814 | PREDICTED: receptor-like protein 12-like | 0.873 | 0.143 | 0.366 | 2e-15 | |
| 359493546 | 985 | PREDICTED: LRR receptor-like serine/thre | 0.843 | 0.114 | 0.369 | 3e-15 | |
| 359493544 | 978 | PREDICTED: receptor-like protein 12-like | 0.828 | 0.113 | 0.375 | 1e-14 | |
| 359493539 | 1001 | PREDICTED: receptor-like protein 12-like | 0.895 | 0.119 | 0.339 | 7e-14 | |
| 356553697 | 895 | PREDICTED: receptor-like protein 12-like | 0.768 | 0.115 | 0.362 | 9e-14 | |
| 356553670 | 909 | PREDICTED: receptor-like protein 12-like | 0.768 | 0.113 | 0.362 | 9e-14 | |
| 224116970 | 921 | predicted protein [Populus trichocarpa] | 0.783 | 0.114 | 0.374 | 2e-13 | |
| 225455498 | 980 | PREDICTED: receptor-like protein 12-like | 0.828 | 0.113 | 0.354 | 2e-13 |
| >gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 8e-17, Method: Compositional matrix adjust.
Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 33/149 (22%)
Query: 16 IQFGKNSFDGIKKLPWKNLEYLDFRSNLLQGLFLDPSSNMKVFLISNNRFTREIPCLICN 75
+ NS G K LPWKN+ LD SNLLQG P ++ F +S+N+ + EI LIC
Sbjct: 534 LNLSYNSISGFKMLPWKNIGILDLHSNLLQGPLPTPPNSTFFFSVSHNKLSGEISSLICR 593
Query: 76 LSTIEI---------------------------------PWPIPETLSKGSNLRTLNFNG 102
S++EI IP+T KG+ +R L+FN
Sbjct: 594 ASSMEILDLSDNNLSGRLPHCLGNFSKYLSVLNLRRNRFHGNIPQTFLKGNAIRDLDFND 653
Query: 103 NELVGSVPRSLLNCENLQVVDLGNNKIED 131
N+L G VPRSL+ C L+V+DLGNNKI D
Sbjct: 654 NQLDGLVPRSLIICRKLEVLDLGNNKIND 682
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356553697|ref|XP_003545189.1| PREDICTED: receptor-like protein 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356553670|ref|XP_003545176.1| PREDICTED: receptor-like protein 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 134 | ||||||
| TAIR|locus:2205005 | 1019 | RLP7 "AT1G47890" [Arabidopsis | 0.828 | 0.108 | 0.363 | 7.4e-11 | |
| TAIR|locus:2825389 | 784 | RLP11 "AT1G71390" [Arabidopsis | 0.970 | 0.165 | 0.330 | 6.1e-10 | |
| TAIR|locus:2046600 | 800 | RLP26 "receptor like protein 2 | 0.947 | 0.158 | 0.333 | 6.3e-10 | |
| TAIR|locus:2040035 | 671 | RLP20 "receptor like protein 2 | 0.425 | 0.084 | 0.456 | 5.8e-09 | |
| TAIR|locus:2825384 | 847 | RLP12 "AT1G71400" [Arabidopsis | 0.977 | 0.154 | 0.317 | 6.2e-09 | |
| TAIR|locus:2046357 | 890 | RLP23 "receptor like protein 2 | 0.820 | 0.123 | 0.325 | 1.4e-08 | |
| TAIR|locus:2046535 | 740 | RLP28 "receptor like protein 2 | 0.589 | 0.106 | 0.357 | 1.4e-08 | |
| TAIR|locus:2046515 | 864 | RLP24 "receptor like protein 2 | 0.813 | 0.126 | 0.330 | 1.7e-08 | |
| TAIR|locus:2086974 | 881 | RLP41 "AT3G25010" [Arabidopsis | 0.820 | 0.124 | 0.358 | 2.2e-08 | |
| TAIR|locus:2087253 | 884 | RLP39 "AT3G24900" [Arabidopsis | 0.820 | 0.124 | 0.375 | 2.2e-08 |
| TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 164 (62.8 bits), Expect = 7.4e-11, P = 7.4e-11
Identities = 48/132 (36%), Positives = 68/132 (51%)
Query: 16 IQFGKNSFDG----IKKLPWKNLEYLDFRSNLLQG-LFLDPSSNMKVFLISNNRFTREIP 70
+ NS G +K P L +D SN QG LFL PS +++ F SNN FT +IP
Sbjct: 570 VDLSNNSLSGFHVSVKASPESQLTSVDLSSNAFQGPLFL-PSKSLRYFSGSNNNFTGKIP 628
Query: 71 CLICNLSTIEI------------PWPIPETLSKGSNLRTLNFNGNELVGSVPRSLLNCEN 118
IC LS++EI PW + ETL S+L L+ N L GS+P +N
Sbjct: 629 RSICGLSSLEILDLSNNNLNGSLPWCL-ETLM--SSLSDLDLRNNSLSGSLPEIFMNATK 685
Query: 119 LQVVDLGNNKIE 130
L+ +D+ +N++E
Sbjct: 686 LRSLDVSHNRME 697
|
|
| TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046600 RLP26 "receptor like protein 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040035 RLP20 "receptor like protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046535 RLP28 "receptor like protein 28" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00032000001 | SubName- Full=Chromosome chr18 scaffold_61, whole genome shotgun sequence; (539 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 134 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-07 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 6e-07 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-06 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 4e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-05 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 5e-04 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 5e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.001 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.003 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.003 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 0.004 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 48.7 bits (116), Expect = 1e-07
Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 20/146 (13%)
Query: 2 LEEEVTQEV--CRDIK-IQFGKNSFDG-----IKKLPWKNLEYLDFRSNLLQGLFLDPSS 53
LE E+ + + CR ++ ++ NSF G KLP +LD +N LQG
Sbjct: 392 LEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVY--FLDISNNNLQGRINSRKW 449
Query: 54 NM---KVFLISNNRFTREIPCLI-------CNLSTIEIPWPIPETLSKGSNLRTLNFNGN 103
+M ++ ++ N+F +P +LS + +P L S L L + N
Sbjct: 450 DMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN 509
Query: 104 ELVGSVPRSLLNCENLQVVDLGNNKI 129
+L G +P L +C+ L +DL +N++
Sbjct: 510 KLSGEIPDELSSCKKLVSLDLSHNQL 535
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.73 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.7 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.52 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.49 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.4 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.38 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.35 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.31 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.3 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.28 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.28 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.22 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.2 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.2 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.18 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 99.17 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.16 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.13 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.12 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.11 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.1 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.01 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.95 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.91 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.82 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.79 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.78 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.75 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.75 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.6 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.56 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.54 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.49 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.45 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.4 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.37 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.32 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.28 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.18 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.15 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.11 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.1 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.08 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.99 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.95 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.91 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 97.89 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.78 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.62 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.62 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.6 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.59 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.57 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.14 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 97.11 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.85 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.84 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.7 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 96.58 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.57 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.53 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.52 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 96.46 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 96.4 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.37 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.17 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 95.97 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 95.97 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.23 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.5 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 93.33 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 92.47 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 91.81 | |
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 90.47 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.2 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 87.9 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=99.73 E-value=1.2e-17 Score=130.06 Aligned_cols=46 Identities=24% Similarity=0.377 Sum_probs=19.1
Q ss_pred CccCcCCCCCcEEEccCCccccCccccccCCCCCcEEEcCCCcccc
Q 045549 86 PETLSKGSNLRTLNFNGNELVGSVPRSLLNCENLQVVDLGNNKIED 131 (134)
Q Consensus 86 ~~~~~~~~~L~~l~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~ 131 (134)
|..++.+++|+.|++++|.+.+.+|..++++++|+.|++++|.+++
T Consensus 205 p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~ 250 (968)
T PLN00113 205 PRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTG 250 (968)
T ss_pred ChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceecc
Confidence 3333344444444444444443344444444444444444444433
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 134 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-19 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-16 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-13 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-12 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-10 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-09 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-08 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-07 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-12 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 6e-11 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 5e-10 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-11 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-09 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 9e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 9e-10 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-10 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-09 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-08 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-09 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 9e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-09 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-08 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-07 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 9e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 9e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 6e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 9e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 4e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 7e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-04 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-04 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 8e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 9e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 4e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-04 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-05 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 6e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 8e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 4e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 5e-04 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
Score = 81.5 bits (202), Expect = 3e-19
Identities = 36/138 (26%), Positives = 52/138 (37%), Gaps = 37/138 (26%)
Query: 31 WKNLEYLDFRSNLLQG-----LFLDPSSNMKVFLISNNRFTREIPCLICNLSTIE----- 80
+L LD SN G L +P + ++ + NN FT +IP + N S +
Sbjct: 367 SASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLS 426
Query: 81 -------IPW--------------------PIPETLSKGSNLRTLNFNGNELVGSVPRSL 113
IP IP+ L L TL + N+L G +P L
Sbjct: 427 FNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL 486
Query: 114 LNCENLQVVDLGNNKIED 131
NC NL + L NN++
Sbjct: 487 SNCTNLNWISLSNNRLTG 504
|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.82 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.79 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.79 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.78 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.78 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.77 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.77 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.77 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.77 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.77 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.77 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.76 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.76 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.76 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.76 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.76 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.76 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.75 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.75 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.74 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.74 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.74 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.73 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.72 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.72 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.72 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.72 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.71 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.71 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.7 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.7 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.7 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.69 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.68 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.68 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.68 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.68 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.68 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.68 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.67 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.67 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.67 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.67 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.67 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.67 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.66 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.66 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.66 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.66 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.66 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.66 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.65 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.65 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.65 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.65 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.65 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.65 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.64 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.64 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.64 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.64 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.64 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.64 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.64 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.64 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.64 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.64 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.63 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.63 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.63 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.63 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.62 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.62 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.62 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.62 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.62 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.61 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.61 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.61 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.6 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.6 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.6 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.6 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.59 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.59 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.59 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.58 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.58 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.58 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.57 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.57 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.57 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.57 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.56 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.55 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.55 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.54 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.54 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.53 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.53 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.52 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.52 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.51 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.51 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.5 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.5 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.49 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.48 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.47 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.47 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.46 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.45 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.44 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.44 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.44 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.43 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.42 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.41 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.4 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.37 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.37 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.35 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.34 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.33 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.31 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.3 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.3 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.25 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.25 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.24 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.22 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.2 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.14 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.14 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.1 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.02 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.02 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.98 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.95 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.86 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.78 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.72 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.58 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.48 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.47 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 98.42 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.32 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.28 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.23 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.09 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.07 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.04 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.86 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.41 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.38 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.38 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.28 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 97.22 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 97.13 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.06 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.17 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.57 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 95.31 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 94.34 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=99.82 E-value=6.7e-20 Score=138.68 Aligned_cols=82 Identities=24% Similarity=0.370 Sum_probs=60.7
Q ss_pred CCccEEEcccCccccccCccccCCCCccc--------cccCCccCcCCCCCcEEEccCCccccCccccccCCCCCcEEEc
Q 045549 53 SNMKVFLISNNRFTREIPCLICNLSTIEI--------PWPIPETLSKGSNLRTLNFNGNELVGSVPRSLLNCENLQVVDL 124 (134)
Q Consensus 53 ~~l~~L~l~~n~l~~~~~~~~~~l~~L~~--------~~~~~~~~~~~~~L~~l~l~~n~l~~~~p~~~~~l~~L~~L~l 124 (134)
+++++||+++|++++.+|..++.++.|+. .+.+|..++.+++|+.|++++|+++|.+|..+.++++|++|++
T Consensus 632 ~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~l 711 (768)
T 3rgz_A 632 GSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDL 711 (768)
T ss_dssp BCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEEC
T ss_pred ccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEEC
Confidence 34666777777777777777777666665 4467777777777777787777777777777777777888888
Q ss_pred CCCcccccCC
Q 045549 125 GNNKIEDILH 134 (134)
Q Consensus 125 ~~n~l~~~~~ 134 (134)
++|+++|.||
T Consensus 712 s~N~l~g~iP 721 (768)
T 3rgz_A 712 SNNNLSGPIP 721 (768)
T ss_dssp CSSEEEEECC
T ss_pred cCCcccccCC
Confidence 8888877776
|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 134 | ||||
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 4e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.003 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 0.004 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Score = 42.4 bits (98), Expect = 4e-06
Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%)
Query: 70 PCLICNLSTIEIPWPIPETLSKGSNLRTLNFNGNELVGSVPRSLLNCENLQVVDLGNNK 128
+L I +P+ L++ L +LN + N L G +P N + V NNK
Sbjct: 245 NLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFDVSAYANNK 302
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 134 | |||
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.76 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.75 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.74 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.71 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.68 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.64 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.63 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.61 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.61 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.56 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.53 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.52 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.52 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.49 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.45 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.42 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.41 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.4 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.38 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.37 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.36 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.35 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.3 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.28 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.19 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.18 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.12 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.03 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.03 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.94 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.65 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.53 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.41 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.27 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.23 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 98.18 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.11 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.09 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 98.02 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.13 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.13 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 94.98 |
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Ngr ectodomain-like domain: Slit species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.76 E-value=7.7e-18 Score=106.85 Aligned_cols=121 Identities=17% Similarity=0.115 Sum_probs=92.9
Q ss_pred cccEEEcCCCccCCCCcccccCCcEEEccCcccCCcCCCC----CCCccEEEcccCccccccCccccCCCCccc------
Q 045549 12 RDIKIQFGKNSFDGIKKLPWKNLEYLDFRSNLLQGLFLDP----SSNMKVFLISNNRFTREIPCLICNLSTIEI------ 81 (134)
Q Consensus 12 ~L~~L~l~~n~l~~~~~~~~~~L~~L~l~~n~l~~~~~~~----l~~l~~L~l~~n~l~~~~~~~~~~l~~L~~------ 81 (134)
..+.++.+++.++.+|+.+..++++|++++|++++..+.. ++.|+.|++++|.+....+..+..+.+|+.
T Consensus 9 ~~~~v~Cs~~~L~~iP~~lp~~l~~L~Ls~N~i~~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls~N 88 (192)
T d1w8aa_ 9 EGTTVDCTGRGLKEIPRDIPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGEN 88 (192)
T ss_dssp ETTEEECTTSCCSSCCSCCCTTCSEEECCSCCCCSBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECCSC
T ss_pred cCCEEEEeCCCcCccCCCCCCCCCEEEeCCCCCcccccccccCCCceEeeeeccccccccccccccccccccceeeeccc
Confidence 3456778888887788777777888888888876543332 677888888888877666677776666665
Q ss_pred --cccCCccCcCCCCCcEEEccCCccccCccccccCCCCCcEEEcCCCccccc
Q 045549 82 --PWPIPETLSKGSNLRTLNFNGNELVGSVPRSLLNCENLQVVDLGNNKIEDI 132 (134)
Q Consensus 82 --~~~~~~~~~~~~~L~~l~l~~n~l~~~~p~~~~~l~~L~~L~l~~n~l~~~ 132 (134)
....+..|.++++|+.|++++|++++..+.+|.++++|+++++++|.+...
T Consensus 89 ~l~~l~~~~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~~ 141 (192)
T d1w8aa_ 89 KIKEISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNCN 141 (192)
T ss_dssp CCCEECSSSSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCCS
T ss_pred cccccCHHHHhCCCcccccccCCccccccCHHHhcCCcccccccccccccccc
Confidence 223355788999999999999999966677899999999999999988653
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|