Citrus Sinensis ID: 045564


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
MSNCLDSSSTALLPFKVTVQYKLRTCTFQQRKLGAATDTHREAQISNAKRGGRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
ccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHEEEEEEEcccccHHcHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccccccccccccccccccccc
ccccccccHHHHcHcccEEEEcccccccccccccccEEccccccccccccccHEEEEHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHccccHHcccccccccccc
msncldssstallpfkVTVQYKLRTCTFqqrklgaatdtHREAQIsnakrggrtALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTIlldstatfdslrpqrcdiglslckapskVQFAVLYSGIALACLGLGGLRFTLATmganqfeipqhqgiffNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
msncldssstallpfkVTVQYKLRTCTFQqrklgaatdthreaqisnakrggrtallSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
MSNCLDSSSTALLPFKVTVQYKLRTCTFQQRKLGAATDTHREAQISNAKRGGRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSgialaclglgglRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
**********ALLPFKVTVQYKLRTCTFQQRKLGAA***************GRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLS*************************
***************************************************GRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQR************KVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSED*************AT***KF
********STALLPFKVTVQYKLRTCTFQQRK****************KRGGRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
*****DSSSTALLPFKVTVQYKLRTCTFQQRKLGAATDTHREAQISNAKRGGRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVT***********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNCLDSSSTALLPFKVTVQYKLRTCTFQQRKLGAATDTHREAQISNAKRGGRTALLSRTVTCLTLGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFPVIVASVKKWKPVLSSRSEDYYQEQNAVTSLMTATLEQKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query296 2.2.26 [Sep-21-2011]
Q9M1E1 557 Probable nitrate excretio yes no 0.817 0.434 0.480 9e-62
Q9M175 558 Probable nitrate excretio no no 0.807 0.428 0.461 6e-58
Q9M1E2 558 Nitrate excretion transpo no no 0.820 0.435 0.457 1e-57
Q9M174 516 Putative nitrate excretio no no 0.787 0.451 0.457 1e-56
Q9M173 548 Probable nitrate excretio no no 0.834 0.450 0.437 6e-56
Q9M172 560 Probable nitrate excretio no no 0.834 0.441 0.446 6e-56
Q9M171 555 Putative nitrate excretio no no 0.834 0.445 0.443 2e-55
Q8RX77 620 Nitrate transporter 1.7 O no no 0.790 0.377 0.328 4e-29
Q9FNL8 586 Peptide transporter PTR3- no no 0.706 0.356 0.318 7e-25
Q8VZR7 583 Probable peptide/nitrate no no 0.621 0.315 0.343 2e-22
>sp|Q9M1E1|PTR38_ARATH Probable nitrate excretion transporter 2 OS=Arabidopsis thaliana GN=At3g45660 PE=2 SV=1 Back     alignment and function desciption
 Score =  237 bits (604), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 165/258 (63%), Gaps = 16/258 (6%)

Query: 41  REAQISNAKRGGRTALLSRTVTC--LTLGE-GWVANLMVYMIQEFHITSINSALISNIVN 97
           + A  S  + GGR       VT   LTL   GW+ NL+VY+I+E+++ SI +A I NI +
Sbjct: 13  KSADSSTRRSGGRITFPFMIVTLFGLTLATLGWLQNLIVYLIEEYNMKSIAAAKILNIFS 72

Query: 98  GFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCK 157
           GF  +FP +GAI ADSF G+  VI +SSFISL+G +LL  T  FDSLRPQ C+    LC+
Sbjct: 73  GFTFMFPAIGAIAADSFFGTIPVILVSSFISLVGVVLLALTTLFDSLRPQACETASKLCQ 132

Query: 158 APSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVIS 217
           AP+ +Q  VLY+ I L C+G GGLRFTLAT GANQ+E  + QG FFNWFF   Y +  IS
Sbjct: 133 APTNIQLGVLYTAITLGCVGAGGLRFTLATAGANQYEKTKDQGSFFNWFFFTWYLAASIS 192

Query: 218 SAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFY-------------FPVIVASVK 264
           + A VY E+N+SW  G GL +AANL G+++F+SGK FY               VI A+++
Sbjct: 193 ATAIVYAEENISWSFGFGLCVAANLLGLIVFISGKKFYKHDKPLGSPFTSLLRVIFAAIR 252

Query: 265 KWKPVLSSRSEDYYQEQN 282
           K K V+S+  +DY+ E  
Sbjct: 253 KRKAVVSTNEKDYHSESK 270




Transporter involved in a passive nitrate efflux.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M175|PTR39_ARATH Probable nitrate excretion transporter 3 OS=Arabidopsis thaliana GN=At3g45680 PE=2 SV=1 Back     alignment and function description
>sp|Q9M1E2|PTR37_ARATH Nitrate excretion transporter 1 OS=Arabidopsis thaliana GN=NAXT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M174|PTR40_ARATH Putative nitrate excretion transporter 4 OS=Arabidopsis thaliana GN=At3g45690 PE=5 SV=1 Back     alignment and function description
>sp|Q9M173|PTR41_ARATH Probable nitrate excretion transporter 5 OS=Arabidopsis thaliana GN=At3g45700 PE=2 SV=1 Back     alignment and function description
>sp|Q9M172|PTR42_ARATH Probable nitrate excretion transporter 6 OS=Arabidopsis thaliana GN=At3g45710 PE=2 SV=2 Back     alignment and function description
>sp|Q9M171|PTR43_ARATH Putative nitrate excretion transporter 7 OS=Arabidopsis thaliana GN=At3g45720 PE=2 SV=1 Back     alignment and function description
>sp|Q8RX77|PTR21_ARATH Nitrate transporter 1.7 OS=Arabidopsis thaliana GN=NRT1.7 PE=1 SV=1 Back     alignment and function description
>sp|Q9FNL8|PTR4_ARATH Peptide transporter PTR3-B OS=Arabidopsis thaliana GN=PTR3-B PE=2 SV=1 Back     alignment and function description
>sp|Q8VZR7|PTR30_ARATH Probable peptide/nitrate transporter At2g40460 OS=Arabidopsis thaliana GN=At2g40460 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
297746190 547 unnamed protein product [Vitis vinifera] 0.858 0.464 0.512 1e-65
225435185 577 PREDICTED: nitrate excretion transporter 0.858 0.440 0.512 2e-65
297746189 545 unnamed protein product [Vitis vinifera] 0.858 0.466 0.501 4e-64
225435181 577 PREDICTED: nitrate excretion transporter 0.858 0.440 0.501 4e-64
15231202 557 major facilitator protein [Arabidopsis t 0.817 0.434 0.480 6e-60
255582989 566 Peptide transporter, putative [Ricinus c 0.881 0.461 0.471 7e-58
297815710 558 proton-dependent oligopeptide transport 0.716 0.379 0.506 2e-57
113205242 531 POT family protein [Solanum demissum] 0.722 0.403 0.482 4e-57
15231215 558 major facilitator protein [Arabidopsis t 0.807 0.428 0.461 3e-56
26450397 558 putative transporter protein [Arabidopsi 0.807 0.428 0.461 5e-56
>gi|297746190|emb|CBI16246.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/275 (51%), Positives = 185/275 (67%), Gaps = 21/275 (7%)

Query: 41  REAQISNA--KRGGRTALL--SRTVTCLTLGEG-WVANLMVYMIQEFHITSINSALISNI 95
           RE+QIS++   +GG    L  +  +T LTL  G W ANL+VY+I+EF++  I++A ISN+
Sbjct: 21  RESQISDSGSTKGGWITFLFIAGALTGLTLAAGGWGANLIVYLIEEFNVKRIDAAQISNV 80

Query: 96  VNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSL 155
           V+G  +LFP++GAI AD F GSF +I + S ISLLG +LL  T T D LRPQ+C+ G +L
Sbjct: 81  VSGSTSLFPIVGAIAADCFFGSFSIIALCSCISLLGVVLLALT-TLDFLRPQQCEHGSTL 139

Query: 156 CKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTV 215
           CK PSK+QFAVLYSGIALA +GLGG RFTLATMGA+QF+ P+HQG FFNW+F + Y S V
Sbjct: 140 CKNPSKIQFAVLYSGIALAVIGLGGTRFTLATMGADQFDKPKHQGTFFNWYFFVFYVSAV 199

Query: 216 ISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYFP-------------VIVAS 262
           IS+ A VY+EDN+SW  G GL +  NL G+VIFL G  FY               V VA+
Sbjct: 200 ISNTAIVYVEDNVSWTWGFGLTVVCNLIGLVIFLLGSRFYRHVKPQGSPFVDLARVFVAA 259

Query: 263 VKKWKPVLSSRSEDYY--QEQNAVTSLMTATLEQK 295
           ++K K +LS  S+DYY   +      ++T T   K
Sbjct: 260 LRKRKVLLSLNSDDYYYCHKHQGSVKMVTGTTPTK 294




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435185|ref|XP_002281925.1| PREDICTED: nitrate excretion transporter 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746189|emb|CBI16245.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225435181|ref|XP_002281906.1| PREDICTED: nitrate excretion transporter 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15231202|ref|NP_190152.1| major facilitator protein [Arabidopsis thaliana] gi|75181814|sp|Q9M1E1.1|PTR38_ARATH RecName: Full=Probable nitrate excretion transporter 2; AltName: Full=Protein NAXT1-like 1 gi|6996269|emb|CAB75495.1| putative protein [Arabidopsis thaliana] gi|332644535|gb|AEE78056.1| major facilitator protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255582989|ref|XP_002532264.1| Peptide transporter, putative [Ricinus communis] gi|223528052|gb|EEF30130.1| Peptide transporter, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297815710|ref|XP_002875738.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297321576|gb|EFH51997.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|113205242|gb|AAT39311.2| POT family protein [Solanum demissum] Back     alignment and taxonomy information
>gi|15231215|ref|NP_190154.1| major facilitator protein [Arabidopsis thaliana] gi|75311772|sp|Q9M175.1|PTR39_ARATH RecName: Full=Probable nitrate excretion transporter 3; AltName: Full=Protein NAXT1-like 2 gi|7019634|emb|CAB75781.1| putative transporter protein [Arabidopsis thaliana] gi|332644538|gb|AEE78059.1| major facilitator protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|26450397|dbj|BAC42313.1| putative transporter protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
TAIR|locus:2085662 557 AT3G45660 [Arabidopsis thalian 0.810 0.430 0.460 3e-53
TAIR|locus:2102659 558 AT3G45680 [Arabidopsis thalian 0.804 0.426 0.447 4e-51
TAIR|locus:2085647 558 NAXT1 "nitrate excretion trans 0.820 0.435 0.438 8.3e-51
TAIR|locus:2102669 516 AT3G45690 [Arabidopsis thalian 0.783 0.449 0.447 1.7e-50
TAIR|locus:2102694 555 AT3G45720 [Arabidopsis thalian 0.834 0.445 0.431 3.6e-50
TAIR|locus:2102689 560 AT3G45710 [Arabidopsis thalian 0.834 0.441 0.435 5.8e-50
TAIR|locus:2102679 548 AT3G45700 [Arabidopsis thalian 0.810 0.437 0.439 2.5e-49
TAIR|locus:2196800 620 NRT1.7 "nitrate transporter 1. 0.722 0.345 0.322 1.6e-25
TAIR|locus:2161428 586 AT5G46040 [Arabidopsis thalian 0.706 0.356 0.306 9.2e-23
TAIR|locus:2061843 583 AT2G40460 [Arabidopsis thalian 0.621 0.315 0.328 1.1e-21
TAIR|locus:2085662 AT3G45660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 3.0e-53, P = 3.0e-53
 Identities = 118/256 (46%), Positives = 158/256 (61%)

Query:    41 REAQISNAKRGGRTALLSRTVTC--LTLGE-GWVANLMVYMIQEFHITSINSALISNIVN 97
             + A  S  + GGR       VT   LTL   GW+ NL+VY+I+E+++ SI +A I NI +
Sbjct:    13 KSADSSTRRSGGRITFPFMIVTLFGLTLATLGWLQNLIVYLIEEYNMKSIAAAKILNIFS 72

Query:    98 GFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCK 157
             GF  +FP +GAI ADSF G+  VI +SSFISL+G +LL  T  FDSLRPQ C+    LC+
Sbjct:    73 GFTFMFPAIGAIAADSFFGTIPVILVSSFISLVGVVLLALTTLFDSLRPQACETASKLCQ 132

Query:   158 APSKVQFAVLYSXXXXXXXXXXXXRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVIS 217
             AP+ +Q  VLY+            RFTLAT GANQ+E  + QG FFNWFF   Y +  IS
Sbjct:   133 APTNIQLGVLYTAITLGCVGAGGLRFTLATAGANQYEKTKDQGSFFNWFFFTWYLAASIS 192

Query:   218 SAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFY-------FP------VIVASVK 264
             + A VY E+N+SW  G GL +AANL G+++F+SGK FY        P      VI A+++
Sbjct:   193 ATAIVYAEENISWSFGFGLCVAANLLGLIVFISGKKFYKHDKPLGSPFTSLLRVIFAAIR 252

Query:   265 KWKPVLSSRSEDYYQE 280
             K K V+S+  +DY+ E
Sbjct:   253 KRKAVVSTNEKDYHSE 268




GO:0005215 "transporter activity" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006857 "oligopeptide transport" evidence=IEA;ISS
GO:0016020 "membrane" evidence=IEA;ISS
TAIR|locus:2102659 AT3G45680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085647 NAXT1 "nitrate excretion transporter1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102669 AT3G45690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102694 AT3G45720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102689 AT3G45710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102679 AT3G45700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2196800 NRT1.7 "nitrate transporter 1.7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161428 AT5G46040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061843 AT2G40460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024460001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (577 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
pfam00854 372 pfam00854, PTR2, POT family 6e-09
TIGR00926 641 TIGR00926, 2A1704, Peptide:H+ symporter (also tran 2e-06
COG3104 498 COG3104, PTR2, Dipeptide/tripeptide permease [Amin 1e-05
PRK15462 493 PRK15462, PRK15462, dipeptide/tripeptide permease 1e-04
>gnl|CDD|216153 pfam00854, PTR2, POT family Back     alignment and domain information
 Score = 56.2 bits (136), Expect = 6e-09
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 17/141 (12%)

Query: 118 FQVIWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLG 177
           F+ I + S I  +G +LL   A   SL P               VQ A+ Y G+ L  LG
Sbjct: 1   FKTILLGSIIYAIGHVLLTLGAIPPSLSP---------------VQVALFYIGLYLIALG 45

Query: 178 LGGLRFTLATMGANQF-EIPQHQ-GIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSG 235
            GG++  ++  GA+QF E    +   FF+WF+    A ++I++    Y++ N+ + LG G
Sbjct: 46  TGGIKPNVSAFGADQFDETQDPRRDGFFSWFYFSINAGSLIATIITPYLQQNVGYPLGFG 105

Query: 236 LNIAANLAGVVIFLSGKHFYF 256
           L     L  +++FL G   Y 
Sbjct: 106 LPAVGMLLALLVFLLGSRRYK 126


The POT (proton-dependent oligopeptide transport) family all appear to be proton dependent transporters. Length = 372

>gnl|CDD|233190 TIGR00926, 2A1704, Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>gnl|CDD|225646 COG3104, PTR2, Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237971 PRK15462, PRK15462, dipeptide/tripeptide permease D; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 296
KOG1237 571 consensus H+/oligopeptide symporter [Amino acid tr 99.96
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.95
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.93
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.91
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.9
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 99.89
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.89
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.75
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.73
PRK03545 390 putative arabinose transporter; Provisional 99.73
TIGR00891 405 2A0112 putative sialic acid transporter. 99.72
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.72
PRK10054 395 putative transporter; Provisional 99.71
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 99.7
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.69
PRK10504 471 putative transporter; Provisional 99.69
KOG1330 493 consensus Sugar transporter/spinster transmembrane 99.69
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.69
PRK05122 399 major facilitator superfamily transporter; Provisi 99.69
PRK12307 426 putative sialic acid transporter; Provisional 99.69
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.68
PRK12382 392 putative transporter; Provisional 99.68
PRK03893 496 putative sialic acid transporter; Provisional 99.68
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.68
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.68
TIGR00895 398 2A0115 benzoate transport. 99.68
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.67
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.67
PRK10091 382 MFS transport protein AraJ; Provisional 99.67
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.67
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.66
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.66
TIGR00900 365 2A0121 H+ Antiporter protein. 99.66
TIGR00893 399 2A0114 d-galactonate transporter. 99.66
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.65
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.65
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.65
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.65
PRK11663 434 regulatory protein UhpC; Provisional 99.64
PRK03699 394 putative transporter; Provisional 99.64
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.63
PRK11043 401 putative transporter; Provisional 99.63
PRK09705 393 cynX putative cyanate transporter; Provisional 99.63
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.63
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.61
PRK10642 490 proline/glycine betaine transporter; Provisional 99.61
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.61
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.61
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.6
PRK09874 408 drug efflux system protein MdtG; Provisional 99.6
PLN00028 476 nitrate transmembrane transporter; Provisional 99.6
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.59
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.58
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.58
PRK03633 381 putative MFS family transporter protein; Provision 99.57
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.57
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.57
PRK15011393 sugar efflux transporter B; Provisional 99.56
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.55
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.55
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.55
PRK10133 438 L-fucose transporter; Provisional 99.55
PRK15075 434 citrate-proton symporter; Provisional 99.55
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.55
PRK10642490 proline/glycine betaine transporter; Provisional 99.54
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.53
PRK15011 393 sugar efflux transporter B; Provisional 99.53
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.53
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.53
TIGR00805 633 oat sodium-independent organic anion transporter. 99.52
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.52
PRK10489 417 enterobactin exporter EntS; Provisional 99.51
PRK09952438 shikimate transporter; Provisional 99.51
PRK09952 438 shikimate transporter; Provisional 99.5
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.5
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.5
TIGR00898 505 2A0119 cation transport protein. 99.5
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.5
KOG0254 513 consensus Predicted transporter (major facilitator 99.49
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.49
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.48
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.48
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 99.47
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.46
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.46
PRK09705393 cynX putative cyanate transporter; Provisional 99.45
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.45
PRK03699394 putative transporter; Provisional 99.45
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.44
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.44
PRK03893496 putative sialic acid transporter; Provisional 99.43
TIGR00893399 2A0114 d-galactonate transporter. 99.41
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.41
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.41
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.4
PRK15075434 citrate-proton symporter; Provisional 99.4
PRK09528 420 lacY galactoside permease; Reviewed 99.4
PRK10489417 enterobactin exporter EntS; Provisional 99.4
PTZ00207 591 hypothetical protein; Provisional 99.39
TIGR00891405 2A0112 putative sialic acid transporter. 99.39
PRK11010 491 ampG muropeptide transporter; Validated 99.38
PRK05122399 major facilitator superfamily transporter; Provisi 99.38
PRK03633381 putative MFS family transporter protein; Provision 99.38
PRK03545390 putative arabinose transporter; Provisional 99.38
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.37
TIGR00901 356 2A0125 AmpG-related permease. 99.37
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.37
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.37
PRK12382392 putative transporter; Provisional 99.37
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.36
PRK09874408 drug efflux system protein MdtG; Provisional 99.36
TIGR00897402 2A0118 polyol permease family. This family of prot 99.35
PRK09528420 lacY galactoside permease; Reviewed 99.35
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.34
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.34
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.34
KOG3764 464 consensus Vesicular amine transporter [Intracellul 99.32
PRK11663434 regulatory protein UhpC; Provisional 99.32
PRK11010491 ampG muropeptide transporter; Validated 99.32
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.32
KOG2532 466 consensus Permease of the major facilitator superf 99.31
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.31
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.31
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.3
PRK11902 402 ampG muropeptide transporter; Reviewed 99.3
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.29
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.28
KOG0569 485 consensus Permease of the major facilitator superf 99.28
PLN00028476 nitrate transmembrane transporter; Provisional 99.26
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.25
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.24
PRK10091382 MFS transport protein AraJ; Provisional 99.24
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.22
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.22
TIGR00900365 2A0121 H+ Antiporter protein. 99.21
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.21
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.2
PRK12307426 putative sialic acid transporter; Provisional 99.2
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.19
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.19
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.17
TIGR00896355 CynX cyanate transporter. This family of proteins 99.17
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.16
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.16
PRK10504471 putative transporter; Provisional 99.16
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.15
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.15
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.14
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.14
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.13
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.13
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.13
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.12
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 99.12
TIGR00895398 2A0115 benzoate transport. 99.12
KOG2533 495 consensus Permease of the major facilitator superf 99.11
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.11
KOG0252 538 consensus Inorganic phosphate transporter [Inorgan 99.11
PRK10133438 L-fucose transporter; Provisional 99.1
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.08
KOG2615 451 consensus Permease of the major facilitator superf 99.07
PRK11902402 ampG muropeptide transporter; Reviewed 99.06
PRK09848448 glucuronide transporter; Provisional 99.05
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.05
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 99.04
PRK09669 444 putative symporter YagG; Provisional 99.03
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.03
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 99.03
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.02
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.01
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.98
COG2270438 Permeases of the major facilitator superfamily [Ge 98.98
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 98.97
PRK10429 473 melibiose:sodium symporter; Provisional 98.96
PRK11646400 multidrug resistance protein MdtH; Provisional 98.96
PRK10054395 putative transporter; Provisional 98.95
PRK10429473 melibiose:sodium symporter; Provisional 98.93
PRK09669444 putative symporter YagG; Provisional 98.93
PF13347428 MFS_2: MFS/sugar transport protein 98.92
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 98.91
TIGR00901356 2A0125 AmpG-related permease. 98.9
TIGR00898505 2A0119 cation transport protein. 98.9
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.9
KOG0569485 consensus Permease of the major facilitator superf 98.9
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 98.87
COG2807395 CynX Cyanate permease [Inorganic ion transport and 98.86
PRK11195393 lysophospholipid transporter LplT; Provisional 98.86
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 98.85
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.84
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.83
PRK11462 460 putative transporter; Provisional 98.83
PRK11043401 putative transporter; Provisional 98.82
PF05631354 DUF791: Protein of unknown function (DUF791); Inte 98.82
PF13347 428 MFS_2: MFS/sugar transport protein 98.81
KOG2532466 consensus Permease of the major facilitator superf 98.81
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.79
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 98.69
PRK11462460 putative transporter; Provisional 98.68
KOG2325 488 consensus Predicted transporter/transmembrane prot 98.68
PRK09848 448 glucuronide transporter; Provisional 98.68
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.67
COG2211467 MelB Na+/melibiose symporter and related transport 98.66
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 98.57
KOG0253 528 consensus Synaptic vesicle transporter SV2 (major 98.55
PRK11652394 emrD multidrug resistance protein D; Provisional 98.54
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.49
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.48
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.46
COG0477 338 ProP Permeases of the major facilitator superfamil 98.45
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.42
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.41
COG2211 467 MelB Na+/melibiose symporter and related transport 98.32
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.32
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.29
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.26
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.25
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.22
KOG3626 735 consensus Organic anion transporter [Secondary met 98.16
KOG3764464 consensus Vesicular amine transporter [Intracellul 98.12
KOG2533495 consensus Permease of the major facilitator superf 98.12
KOG2563 480 consensus Permease of the major facilitator superf 98.11
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.11
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.09
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.98
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 97.97
KOG2816 463 consensus Predicted transporter ADD1 (major facili 97.9
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 97.89
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.86
PF1283277 MFS_1_like: MFS_1 like family 97.81
KOG0254513 consensus Predicted transporter (major facilitator 97.77
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.76
PTZ00207591 hypothetical protein; Provisional 97.72
KOG4686 459 consensus Predicted sugar transporter [Carbohydrat 97.7
KOG3762618 consensus Predicted transporter [General function 97.57
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.55
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 97.53
TIGR00805633 oat sodium-independent organic anion transporter. 97.41
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.32
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.17
KOG0637 498 consensus Sucrose transporter and related proteins 97.08
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 97.01
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 96.87
PRK03612 521 spermidine synthase; Provisional 96.82
PRK15462493 dipeptide/tripeptide permease D; Provisional 96.78
KOG2563480 consensus Permease of the major facilitator superf 96.67
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 96.63
KOG2615451 consensus Permease of the major facilitator superf 96.49
COG2270 438 Permeases of the major facilitator superfamily [Ge 96.39
KOG2816463 consensus Predicted transporter ADD1 (major facili 96.3
KOG4332 454 consensus Predicted sugar transporter [Carbohydrat 96.02
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 95.53
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 95.51
KOG1330493 consensus Sugar transporter/spinster transmembrane 95.45
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 94.41
KOG3762 618 consensus Predicted transporter [General function 94.35
KOG3098461 consensus Uncharacterized conserved protein [Funct 94.32
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 94.23
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 94.0
KOG3574 510 consensus Acetyl-CoA transporter [Inorganic ion tr 92.96
KOG2325488 consensus Predicted transporter/transmembrane prot 91.18
KOG3098 461 consensus Uncharacterized conserved protein [Funct 91.12
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 90.44
KOG4332454 consensus Predicted sugar transporter [Carbohydrat 87.1
KOG3626735 consensus Organic anion transporter [Secondary met 86.01
TIGR00769472 AAA ADP/ATP carrier protein family. These proteins 83.37
KOG3097 390 consensus Predicted membrane protein [Function unk 80.66
>KOG1237 consensus H+/oligopeptide symporter [Amino acid transport and metabolism] Back     alignment and domain information
Probab=99.96  E-value=1.2e-27  Score=236.48  Aligned_cols=243  Identities=37%  Similarity=0.566  Sum_probs=216.9

Q ss_pred             cccccCCccccccc--ccCCchhHHHHHHHHH--H-hHHHhHHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHHHHHHHH
Q 045564           35 AATDTHREAQISNA--KRGGRTALLSRTVTCL--T-LGEGWVANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAI  109 (296)
Q Consensus        35 ~~v~~~~~p~~~~~--~~~~~~~~~~l~~~~~--~-~~y~~~~~l~~yl~~~lg~s~~~a~~i~~~~~~~~~~~~l~~G~  109 (296)
                      ..+|++++|..+..  +.+.|+++..+++.+.  + ++||+..++..|+++++|.+...+...++.|.+...+.++++++
T Consensus        16 ~~~d~~~~~~~~~~~~~~g~~~s~~~il~~e~~e~~a~~g~~~nlv~ylt~~~~~~~~~aa~~v~~f~G~~~~~~l~g~~   95 (571)
T KOG1237|consen   16 TSVDYRGPLLGSSIAFKTGGWLSAPFILGNEVLERLAFFGLVSNLVTYLTLELHASGGGAANNVNAFGGTQFLLPLLGAF   95 (571)
T ss_pred             ceeeccCCcccccccceechhHhHHHHHHHHHHHHHhHhcchhHHHHHHHHHhccchHHHHHHHHHHhhHHHHHHHHHHH
Confidence            35788887655421  5688999999999998  8 99999999999999999999999999999999999999999999


Q ss_pred             HhhhhcchHHHHHHHHHHHHHHHHHHHhhccccCCCCCcc--CCCCcCcCCCCchhhHHHHHHHHHHHHhhchhhhhhhh
Q 045564          110 IADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRC--DIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLAT  187 (296)
Q Consensus       110 laDr~iGR~~~i~i~~~l~~ig~~~la~~~~~p~~~~~~c--~~~~~~~~~~~~~~~~~l~~~~~l~gig~g~~~~~~~~  187 (296)
                      ++|.++||++++.++.+++.+|..++++++..|.+.++.|  ...+..|..++..+...++.++.++++|.|+.+|+..+
T Consensus        96 laD~f~gry~tI~~~s~i~~~G~~~lt~~a~~~~l~p~~~~~~~~~~~c~~~s~~q~~~~~~~l~lia~G~gg~r~~~~~  175 (571)
T KOG1237|consen   96 LADSFLGRYFTINIGSLISLLGLFGLTLSAMIPALLPFMCKFKPGGNVCESPSKLQLAVLYGALYLIALGAGGIRPCLLA  175 (571)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCccccCCCCCCcccCcchHHHHHHHHHHHHheeccCCCCCcchh
Confidence            9999999999999999999999999999988888888776  22234677777778889999999999999999999999


Q ss_pred             hhhccCC---Cc--cchhhHHHHHHHHHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHHHhCCCchh------
Q 045564          188 MGANQFE---IP--QHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSGKHFYF------  256 (296)
Q Consensus       188 ~~ad~f~---~~--~~r~~~f~~~y~~~~iG~~i~p~v~~~l~~~~gw~~~F~i~~~~~~~~~~~~~~~~~~~~------  256 (296)
                      +.+|||+   ++  ..+.++|+|+|+..|+|.+++-.+..|++++.||.++|.++.+.+++++++|+.+.+.|+      
T Consensus       176 fGadQfd~~~~~~~~~~~~fFnW~yf~~~~g~l~a~t~~vyiq~~~~w~lgf~i~~~~~~lai~iF~~g~~~y~~~~p~g  255 (571)
T KOG1237|consen  176 FGADQFDELDPVEVKGIPSFFNWFYFSQNGGALLAQTVLVYIQDNVGWKLGFGIPTVLNALAILIFLPGFPFYRYKKPRG  255 (571)
T ss_pred             hcccccCccCcchhhCcccchhHHHHHHHHHHHHHHHHHHhhhhcccceeeccHHHHHHHHHHHHHHcCceeEEeeCCCC
Confidence            9999998   22  234589999999999999999999999999999999999999999999999999998776      


Q ss_pred             -------HHHHHHHhcCCCcCCCCchhh
Q 045564          257 -------PVIVASVKKWKPVLSSRSEDY  277 (296)
Q Consensus       257 -------~v~~~~~~~~~~~~~~~~~~~  277 (296)
                             +|++|+.|||+...+++++++
T Consensus       256 sp~t~i~~Vlvaa~~k~~~~~~~~~~~~  283 (571)
T KOG1237|consen  256 SPKTRIGQVLVAAAFKRKAVVSLDPEEL  283 (571)
T ss_pred             CchhHHHHHHHHHHHHHhccCCCcchhc
Confidence                   999999999999888875554



>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG0637 consensus Sucrose transporter and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG2563 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG3574 consensus Acetyl-CoA transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>KOG3098 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>KOG4332 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>KOG3097 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
2xut_A 524 Proton/peptide symporter family protein; transport 3e-20
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 4e-04
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Length = 524 Back     alignment and structure
 Score = 89.3 bits (222), Expect = 3e-20
 Identities = 38/228 (16%), Positives = 71/228 (31%), Gaps = 43/228 (18%)

Query: 72  ANLMVYMIQEFH------ITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISS 125
             L  +++          +    +  + +     V  FP+LG  IAD F G +  I   S
Sbjct: 33  NILTPFLMTALLLSIPEELRGAVAKDVFHSFVIGVYFFPLLGGWIADRFFGKYNTILWLS 92

Query: 126 FISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTL 185
            I  +G   L                      A  +      Y+G+ L  LG GG++  +
Sbjct: 93  LIYCVGHAFL----------------------AIFEHSVQGFYTGLFLIALGSGGIKPLV 130

Query: 186 ATMGANQFEI--PQHQGIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLA 243
           ++   +QF+          F+ F+      +  +S +   +  N    +  G+       
Sbjct: 131 SSFMGDQFDQSNKSLAQKAFDMFYFTINFGSFFASLSMPLLLKNFGAAVAFGIPGVLMFV 190

Query: 244 GVVIFLSGKHFY-------------FPVIVASVKKWKPVLSSRSEDYY 278
             V F  G+  Y              PVI +++        +      
Sbjct: 191 ATVFFWLGRKRYIHMPPEPKDPHGFLPVIRSALLTKVEGKGNIGLVLA 238


>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Length = 491 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.85
2xut_A 524 Proton/peptide symporter family protein; transport 99.78
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.77
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.74
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.66
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.59
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.54
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.51
2cfq_A417 Lactose permease; transport, transport mechanism, 99.38
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.26
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.25
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.2
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.84
2xut_A524 Proton/peptide symporter family protein; transport 98.17
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
Probab=99.85  E-value=2.2e-20  Score=178.55  Aligned_cols=180  Identities=21%  Similarity=0.283  Sum_probs=153.7

Q ss_pred             ccCCchhHHHHHHHHH--H-hHHHhHHHHHHHHHHH-----hCCChhHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHH
Q 045564           49 KRGGRTALLSRTVTCL--T-LGEGWVANLMVYMIQE-----FHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQV  120 (296)
Q Consensus        49 ~~~~~~~~~~l~~~~~--~-~~y~~~~~l~~yl~~~-----lg~s~~~a~~i~~~~~~~~~~~~l~~G~laDr~iGR~~~  120 (296)
                      .++++|.++.+++..+  . .+|++..+++.|+++.     +|++..+.+++.+++.++..++.+++|+++||++|||++
T Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~g~l~dr~~g~r~~   87 (491)
T 4aps_A            8 FFGQPLGLSTLFMTEMWERFSYYGMRAILLYYMWFLISTGDLHITRATAASIMAIYASMVYLSGTIGGFVADRIIGARPA   87 (491)
T ss_dssp             ---CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCHHHH
T ss_pred             hhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccchhhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhccccchHH
Confidence            4567777777777666  6 8899999999999998     999999999999999999999999999999994499999


Q ss_pred             HHHHHHHHHHHHHHHHhhccccCCCCCccCCCCcCcCCCCchhhHHHHHHHHHHHHhhchhhhhhhhhhhccCCCc-cch
Q 045564          121 IWISSFISLLGTILLDSTATFDSLRPQRCDIGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIP-QHQ  199 (296)
Q Consensus       121 i~i~~~l~~ig~~~la~~~~~p~~~~~~c~~~~~~~~~~~~~~~~~l~~~~~l~gig~g~~~~~~~~~~ad~f~~~-~~r  199 (296)
                      +.++.++..++.++++++.                       +...++++|++.|++.|...+...++++|.+|++ +.|
T Consensus        88 ~~~~~~~~~~~~~~~~~~~-----------------------~~~~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~r  144 (491)
T 4aps_A           88 VFWGGVLIMLGHIVLALPF-----------------------GASALFGSIILIIIGTGFLKPNVSTLVGTLYDEHDRRR  144 (491)
T ss_dssp             HHHHHHHHHHHHHHHHSCC-----------------------STTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSCTTHH
T ss_pred             HHHHHHHHHHHHHHHHHhh-----------------------hHHHHHHHHHHHHHHHHhccchHHHHHHHHcCcccccc
Confidence            9999999999888776542                       2457888999999999999999999999999843 237


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHHHhC
Q 045564          200 GIFFNWFFILTYASTVISSAAFVYIEDNLSWRLGSGLNIAANLAGVVIFLSG  251 (296)
Q Consensus       200 ~~~f~~~y~~~~iG~~i~p~v~~~l~~~~gw~~~F~i~~~~~~~~~~~~~~~  251 (296)
                      +.++++++.+.++|..++|.+++++.+..||++.|++.++..++++++++..
T Consensus       145 ~~~~~~~~~~~~~g~~~~~~~~~~l~~~~g~~~~f~~~~~~~~~~~~~~~~~  196 (491)
T 4aps_A          145 DAGFSIFVFGINLGAFIAPLIVGAAQEAAGYHVAFSLAAIGMFIGLLVYYFG  196 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             eeeehHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHh
Confidence            7889989999999999999999999998999999999888776666655433



>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.74
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.47
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.45
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.39
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.74  E-value=9.6e-18  Score=154.31  Aligned_cols=155  Identities=8%  Similarity=-0.015  Sum_probs=129.0

Q ss_pred             HHHHHHHHHHHhCCChhHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHHHHHHHHHHHHHHHHHHhhccccCCCCCccC
Q 045564           71 VANLMVYMIQEFHITSINSALISNIVNGFVNLFPVLGAIIADSFLGSFQVIWISSFISLLGTILLDSTATFDSLRPQRCD  150 (296)
Q Consensus        71 ~~~l~~yl~~~lg~s~~~a~~i~~~~~~~~~~~~l~~G~laDr~iGR~~~i~i~~~l~~ig~~~la~~~~~p~~~~~~c~  150 (296)
                      ...+.+++. ++|+|.++.+++.+++.++..++.+++|+++|| +|||+++.++.++..++.++.++.....        
T Consensus        44 ~~~~~p~~~-~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr-~g~r~~~~~~~~~~~~~~~~~~~~~~~~--------  113 (447)
T d1pw4a_          44 FALAMPYLV-EQGFSRGDLGFALSGISIAYGFSKFIMGSVSDR-SNPRVFLPAGLILAAAVMLFMGFVPWAT--------  113 (447)
T ss_dssp             HHHHHHHTT-SSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHH-SCHHHHHHHHHHHHHHHHHHHHHCHHHH--------
T ss_pred             HHHHHHHHH-HhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-cCchHHHHHHHHHHHHHHhhccccchhh--------
Confidence            344556765 589999999999999999999999999999999 7999999999999998888776543111        


Q ss_pred             CCCcCcCCCCchhhHHHHHHHHHHHHhhchhhhhhhhhhhccCCCccchhhHHHHHHHHHHHHHHHHHHHHHhhhcc-cc
Q 045564          151 IGLSLCKAPSKVQFAVLYSGIALACLGLGGLRFTLATMGANQFEIPQHQGIFFNWFFILTYASTVISSAAFVYIEDN-LS  229 (296)
Q Consensus       151 ~~~~~~~~~~~~~~~~l~~~~~l~gig~g~~~~~~~~~~ad~f~~~~~r~~~f~~~y~~~~iG~~i~p~v~~~l~~~-~g  229 (296)
                                 .+...+++.|++.|++.|...+...++++|.+|++ +|+..+++++.+.++|..++|.+.+.+... .+
T Consensus       114 -----------~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~-~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~  181 (447)
T d1pw4a_         114 -----------SSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQK-ERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFND  181 (447)
T ss_dssp             -----------SSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTT-HHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCC
T ss_pred             -----------hhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhh-cccccccccccccchhhhhhhhhhhhHhhhhhc
Confidence                       12457888999999999999999999999999844 789999999999999999999988877654 48


Q ss_pred             chhhHHHHHHHHHHHHHH
Q 045564          230 WRLGSGLNIAANLAGVVI  247 (296)
Q Consensus       230 w~~~F~i~~~~~~~~~~~  247 (296)
                      |++.|++..++.++..++
T Consensus       182 w~~~~~~~~~~~~~~~~~  199 (447)
T d1pw4a_         182 WHAALYMPAFCAILVALF  199 (447)
T ss_dssp             STTCTHHHHHHHHHHHHH
T ss_pred             ccccchhhhhhHHHHHHH
Confidence            999999887755544433



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure