Citrus Sinensis ID: 045571

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
ccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHccccccEEEccccccEEEcccccccccccccEEEccccEEcccccHHHHcccccccEEcccccccccccHHHcccccccccccccccccccccHHHHccccccccccccccccccccHHHHccccccccccccccccccccHHccccccccEEEccccEEccccccccccccHHHHHHcccccccccccc
ccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccHHHHHHccccccccccccc
HRVTVLNisrlnltgtipsqlgnlsslqSLNLSFnrlsgsipsaIFTMYTLKYVSFrenqlsgafpsfifnksslqhldfsqntlsgeipanicsnlpflEYISLSknmfhggipsalskcTYLQILSLSfndfsgaipkdiGNLTKLMELYLGrnrlqgeiprefgsLAELELMSLREsnlqggipqelGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYsssacfcnlYSFACSLIML
hrvtvlnisrlnltgtipsqlgNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
HRVTVLNISRLNLTGTIPsqlgnlsslqslnlsfnrlsGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
****VLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLR**NLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLI**
HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSF*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSSACFCNLYSFACSLIML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query260 2.2.26 [Sep-21-2011]
Q9SHI2 1101 Leucine-rich repeat recep yes no 0.896 0.211 0.414 4e-39
C0LGQ5 1249 LRR receptor-like serine/ no no 0.880 0.183 0.4 1e-38
Q9ZPS9 1143 Serine/threonine-protein no no 0.880 0.200 0.4 7e-38
Q9FL28 1173 LRR receptor-like serine/ no no 0.915 0.202 0.389 7e-37
Q9SCT4 836 Probably inactive leucine no no 0.915 0.284 0.380 2e-36
P93194 1109 Receptor-like protein kin N/A no 0.85 0.199 0.365 4e-36
Q9LVP0 1102 Probable leucine-rich rep no no 0.85 0.200 0.432 6e-36
Q9FRS6 1029 Leucine-rich repeat recep no no 0.888 0.224 0.370 8e-36
Q8VZG8 1045 Probable LRR receptor-lik no no 0.911 0.226 0.382 8e-36
O49318 1124 Probable leucine-rich rep no no 0.876 0.202 0.393 1e-35
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 134/234 (57%), Gaps = 1/234 (0%)

Query: 1   HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQ 60
           H +  LN+S   ++G IP  L    SL+ L+L  NR  G IP  +  + TLK +   EN 
Sbjct: 91  HGLRKLNVSTNFISGPIPQDLSLCRSLEVLDLCTNRFHGVIPIQLTMIITLKKLYLCENY 150

Query: 61  LSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSK 120
           L G+ P  I N SSLQ L    N L+G IP ++ + L  L  I   +N F G IPS +S 
Sbjct: 151 LFGSIPRQIGNLSSLQELVIYSNNLTGVIPPSM-AKLRQLRIIRAGRNGFSGVIPSEISG 209

Query: 121 CTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRES 180
           C  L++L L+ N   G++PK +  L  L +L L +NRL GEIP   G+++ LE+++L E+
Sbjct: 210 CESLKVLGLAENLLEGSLPKQLEKLQNLTDLILWQNRLSGEIPPSVGNISRLEVLALHEN 269

Query: 181 NLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVI 234
              G IP+E+G L K++ L L+ N LTGEIPRE  NL     +  SEN L G I
Sbjct: 270 YFTGSIPREIGKLTKMKRLYLYTNQLTGEIPREIGNLIDAAEIDFSENQLTGFI 323

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
359485449 1583 PREDICTED: LRR receptor-like serine/thre 0.892 0.146 0.446 1e-45
359485451 1454 PREDICTED: LRR receptor-like serine/thre 0.842 0.150 0.452 7e-44
359483677 1229 PREDICTED: LRR receptor-like serine/thre 0.9 0.190 0.429 8e-44
359485176 1160 PREDICTED: probable LRR receptor-like se 0.842 0.188 0.427 1e-43
147769371 1241 hypothetical protein VITISV_010511 [Viti 0.876 0.183 0.454 2e-43
359483198 1087 PREDICTED: probable LRR receptor-like se 0.85 0.203 0.461 8e-42
296085726 932 unnamed protein product [Vitis vinifera] 0.9 0.251 0.413 9e-42
302788536 402 hypothetical protein SELMODRAFT_54187 [S 0.834 0.539 0.445 1e-41
359497186 1140 PREDICTED: LRR receptor-like serine/thre 0.892 0.203 0.417 2e-41
302143440 929 unnamed protein product [Vitis vinifera] 0.876 0.245 0.441 4e-41
>gi|359485449|ref|XP_002276919.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 104/233 (44%), Positives = 150/233 (64%), Gaps = 1/233 (0%)

Query: 1   HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQ 60
             + ++++S     G IP  +G+LS L+ L L  N L+G IP  +  +  LK +S   N+
Sbjct: 622 QELQIISLSFNQFVGGIPQAIGSLSKLEELYLGVNNLAGGIPRGMGNLLNLKMLSLVSNR 681

Query: 61  LSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSK 120
           L G  P  IFN SSLQ +DF+ N+LSG +P  IC++LP L+ + LS N     +P  LS 
Sbjct: 682 LQGPIPEEIFNISSLQMIDFTNNSLSGNLPIAICNHLPKLQQLILSSNQLSAQLPPNLSL 741

Query: 121 CTYLQILS-LSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRE 179
           C  LQ+LS LS N F+G+IP +IGNL  L E+YLGRN L G IP  FG+L+ L+++ L+E
Sbjct: 742 CGQLQVLSSLSKNKFTGSIPIEIGNLPMLEEIYLGRNSLTGTIPPSFGNLSALKVLDLQE 801

Query: 180 SNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQG 232
           +N+QG IP+ELG L  L+ L L  N+L G +P    N++KL+ +SL++N+L G
Sbjct: 802 NNIQGNIPKELGCLLSLQNLSLISNDLRGIVPEAIFNISKLQSISLADNHLSG 854

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483677|ref|XP_003633000.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485176|ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147769371|emb|CAN72496.1| hypothetical protein VITISV_010511 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483198|ref|XP_002271405.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085726|emb|CBI29526.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302788536|ref|XP_002976037.1| hypothetical protein SELMODRAFT_54187 [Selaginella moellendorffii] gi|300156313|gb|EFJ22942.1| hypothetical protein SELMODRAFT_54187 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|359497186|ref|XP_003635448.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143440|emb|CBI22001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query260
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.876 0.200 0.366 2.2e-34
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.896 0.211 0.384 5.5e-34
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.884 0.184 0.352 1.7e-32
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.880 0.200 0.356 2.3e-32
TAIR|locus:2098267 836 IMK2 "inflorescence meristem r 0.915 0.284 0.338 4.3e-32
TAIR|locus:2120412 992 BAM3 "BARELY ANY MERISTEM 3" [ 0.888 0.232 0.361 4.8e-32
TAIR|locus:2025545 1029 AT1G08590 [Arabidopsis thalian 0.888 0.224 0.336 8.5e-32
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.876 0.206 0.378 1.2e-31
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.915 0.202 0.359 1.4e-31
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.888 0.206 0.366 1.6e-31
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 385 (140.6 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 84/229 (36%), Positives = 122/229 (53%)

Query:     6 LNISRLNLTGTIPXXXXXXXXXXXXXXXXXXXXGSIPSAIFTMYTLKYVSFRENQLSGAF 65
             LN+   NL G+ P                    G++P +I  +  L +++   N  SG  
Sbjct:   433 LNLGENNLNGSFPVELMALTSLSELDLSGNRFSGAVPVSISNLSNLSFLNLSGNGFSGEI 492

Query:    66 PSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQ 125
             P+ + N   L  LD S+  +SGE+P  + S LP ++ I+L  N F G +P   S    L+
Sbjct:   493 PASVGNLFKLTALDLSKQNMSGEVPVEL-SGLPNVQVIALQGNNFSGVVPEGFSSLVSLR 551

Query:   126 ILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQGG 185
              ++LS N FSG IP+  G L  L+ L L  N + G IP E G+ + LE++ LR + L G 
Sbjct:   552 YVNLSSNSFSGEIPQTFGFLRLLVSLSLSDNHISGSIPPEIGNCSALEVLELRSNRLMGH 611

Query:   186 IPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVI 234
             IP +L  L +L++L L QNNL+GEIP E S  + L  +SL  N+L GVI
Sbjct:   612 IPADLSRLPRLKVLDLGQNNLSGEIPPEISQSSSLNSLSLDHNHLSGVI 660
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0002237 "response to molecule of bacterial origin" evidence=RCA
GO:0006260 "DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0008283 "cell proliferation" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0010075 "regulation of meristem growth" evidence=RCA
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
GO:0030244 "cellulose biosynthetic process" evidence=RCA
GO:0048443 "stamen development" evidence=RCA
GO:0051567 "histone H3-K9 methylation" evidence=RCA
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098267 IMK2 "inflorescence meristem receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120412 BAM3 "BARELY ANY MERISTEM 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025545 AT1G08590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018756001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (1089 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-45
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-40
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-38
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-35
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-26
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-18
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  162 bits (411), Expect = 3e-45
 Identities = 100/237 (42%), Positives = 141/237 (59%), Gaps = 10/237 (4%)

Query: 2   RVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTM-YTLKYVSFRENQ 60
           RV  +++S  N++G I S +  L  +Q++NLS N+LSG IP  IFT   +L+Y++   N 
Sbjct: 70  RVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNN 129

Query: 61  LSGAFPS-FIFNKSSLQHLDFSQNTLSGEIPANI--CSNLPFLEYISLSKNMFHGGIPSA 117
            +G+ P   I N   L+ LD S N LSGEIP +I   S+L  L+   L  N+  G IP++
Sbjct: 130 FTGSIPRGSIPN---LETLDLSNNMLSGEIPNDIGSFSSLKVLD---LGGNVLVGKIPNS 183

Query: 118 LSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSL 177
           L+  T L+ L+L+ N   G IP+++G +  L  +YLG N L GEIP E G L  L  + L
Sbjct: 184 LTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDL 243

Query: 178 RESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVI 234
             +NL G IP  LGNL  L+ L L+QN L+G IP    +L KL  + LS+N+L G I
Sbjct: 244 VYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEI 300

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 260
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.96
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.96
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.93
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.78
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.78
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.75
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.73
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG0617264 consensus Ras suppressor protein (contains leucine 99.66
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.61
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.43
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.29
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.28
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.28
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.27
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.17
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.14
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.1
PLN03150623 hypothetical protein; Provisional 99.08
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.0
PLN03150623 hypothetical protein; Provisional 98.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.86
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.74
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.73
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.7
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.68
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.68
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.63
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.25
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.18
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.12
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.1
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.08
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.06
KOG4341483 consensus F-box protein containing LRR [General fu 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.94
PRK15386 426 type III secretion protein GogB; Provisional 97.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.86
PRK15386 426 type III secretion protein GogB; Provisional 97.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.4
KOG4341483 consensus F-box protein containing LRR [General fu 97.31
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.15
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.14
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.78
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.65
KOG4308 478 consensus LRR-containing protein [Function unknown 95.45
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.84
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.29
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.92
smart0037026 LRR Leucine-rich repeats, outliers. 92.92
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.5
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.5
KOG0473 326 consensus Leucine-rich repeat protein [Function un 86.0
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 82.86
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.65
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.96  E-value=2.1e-28  Score=222.21  Aligned_cols=238  Identities=38%  Similarity=0.575  Sum_probs=146.7

Q ss_pred             cccEEEecCCccCCCccccccCCCCccEEEccCCcCccccchhhhcCCCCcEEEccCcccCCCCchhhccCCCccEEecc
Q 045571            2 RVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFS   81 (260)
Q Consensus         2 ~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~   81 (260)
                      +|++|++++|.+.+..|..++.+++|++|++++|.+.+..|..+.++++|++|++++|.+.+..|..+.++.+|++|+++
T Consensus       141 ~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~  220 (968)
T PLN00113        141 NLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLG  220 (968)
T ss_pred             CCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECc
Confidence            45555666665555566666666666666666666665566666666666666666666665556666666666666666


Q ss_pred             CCCCCCccchhhhcCCCcceEEecCCCcccCCCCccccCCCCCcEEEccCccCCCCCcccccCCCcccEEEcCCcccccc
Q 045571           82 QNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGE  161 (260)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~  161 (260)
                      +|.+...++..+ ..+++|++|++++|.+....+..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.
T Consensus       221 ~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~  299 (968)
T PLN00113        221 YNNLSGEIPYEI-GGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGE  299 (968)
T ss_pred             CCccCCcCChhH-hcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccC
Confidence            666654444433 3566666666666666555555666666666666666666555555566666666666666666555


Q ss_pred             ccccccCCccccEEEccCCcCcCCCcccccCcCCCcEEEcccCCCCCCcchhccCCCcccEEEcCCCccccchhHhhhc
Q 045571          162 IPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQF  240 (260)
Q Consensus       162 ~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~  240 (260)
                      .|..+..+++|+.|++.+|.+.+..|..+..+++|+.|++++|.+.+..|..++.+++|+.|++++|.+.+.+|+++..
T Consensus       300 ~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~  378 (968)
T PLN00113        300 IPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCS  378 (968)
T ss_pred             CChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhC
Confidence            5555666666666666666665555555666666666666666666555555666666666666666555555544443

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-27
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-27
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-18
1ogq_A 313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-06
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 1e-05
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 3e-06
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-06
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 2e-05
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 4e-05
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 4e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 7e-05
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 9e-05
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-04
3vq1_A 606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 2e-04
2z64_A 599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 2e-04
3zyo_A 411 Crystal Structure Of The N-Terminal Leucine Rich Re 2e-04
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 2e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 8e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  119 bits (299), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 105/199 (52%), Gaps = 3/199 (1%)
Query: 39  GSIP-SAIFTMYTLKYVSFRENQLSGAFPSFIFN-KSSLQHLDFSQNTLSGEIPANICSN 96
           G +P   +  M  LK +    N+ SG  P  + N  +SL  LD S N  SG I  N+C N
Sbjct: 332 GELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQN 391
Query: 97  LP-FLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGR 155
               L+ + L  N F G IP  LS C+ L  L LSFN  SG IP  +G+L+KL +L L  
Sbjct: 392 PKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL 451
Query: 156 NRLQGEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFS 215
           N L+GEIP+E   +  LE + L  ++L G IP  L N   L  + L  N LTGEIP+   
Sbjct: 452 NMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIG 511
Query: 216 NLAKLEMMSLSENNLQGVI 234
            L  L ++ LS N+  G I
Sbjct: 512 RLENLAILKLSNNSFSGNI 530
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query260
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-62
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-54
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-67
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-64
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-61
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-59
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-46
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-24
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-38
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-37
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-31
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-36
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-30
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-27
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-34
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-33
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-33
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-32
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-20
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-31
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-26
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-28
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-25
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-23
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-25
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-19
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-22
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-20
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-11
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-23
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-20
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-23
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-22
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-16
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-21
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-18
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-16
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-21
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-20
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-16
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-19
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-18
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-15
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-13
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-16
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-10
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 8e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 7e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 9e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score =  214 bits (548), Expect = 4e-69
 Identities = 83/238 (34%), Positives = 120/238 (50%), Gaps = 7/238 (2%)

Query: 1   HRVTVLNISRLNLTGT--IPSQLGNLSSLQSLNLS-FNRLSGSIPSAIFTMYTLKYVSFR 57
           +RV  L++S LNL     IPS L NL  L  L +   N L G IP AI  +  L Y+   
Sbjct: 50  YRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT 109

Query: 58  ENQLSGAFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSA 117
              +SGA P F+    +L  LDFS N LSG +P +I S+LP L  I+   N   G IP +
Sbjct: 110 HTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSI-SSLPNLVGITFDGNRISGAIPDS 168

Query: 118 LSKCTYL-QILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMS 176
               + L   +++S N  +G IP    NL  L  + L RN L+G+    FGS    + + 
Sbjct: 169 YGSFSKLFTSMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEGDASVLFGSDKNTQKIH 227

Query: 177 LRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVI 234
           L +++L   +  ++G    L  L L  N + G +P+  + L  L  +++S NNL G I
Sbjct: 228 LAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEI 284
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.96
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.95
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.9
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.87
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.85
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.81
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.8
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.72
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.7
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.26
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.25
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.2
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.63
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.6
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.54
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.53
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.14
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 87.9
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 82.46
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=4.8e-32  Score=225.21  Aligned_cols=239  Identities=24%  Similarity=0.281  Sum_probs=209.5

Q ss_pred             CcccEEEecCCccCCCccccccCCCCccEEEccCCcCccccchhhhcCCCCcEEEccCcccCCCCchhhccCCCccEEec
Q 045571            1 HRVTVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDF   80 (260)
Q Consensus         1 ~~L~~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l   80 (260)
                      ++++.|++++|.+++..+..|..+++|++|++++|.+....+.+|.++++|++|++++|.++...+..+..+++|++|++
T Consensus        64 ~~l~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L  143 (440)
T 3zyj_A           64 TNTRLLNLHENQIQIIKVNSFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWL  143 (440)
T ss_dssp             TTCSEEECCSCCCCEECTTTTSSCSSCCEEECCSSCCCEECGGGGTTCSSCCEEECCSSCCSSCCTTTSCSCSSCCEEEC
T ss_pred             CCCcEEEccCCcCCeeCHHHhhCCCCCCEEECCCCcCCccChhhccCCccCCEEECCCCcCCeeCHhHhhccccCceeeC
Confidence            36889999999999888889999999999999999999777888999999999999999998777778889999999999


Q ss_pred             cCCCCCCccchhhhcCCCcceEEecCCCc-ccCCCCccccCCCCCcEEEccCccCCCCCcccccCCCcccEEEcCCcccc
Q 045571           81 SQNTLSGEIPANICSNLPFLEYISLSKNM-FHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQ  159 (260)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~L~~L~l~~~~-~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~  159 (260)
                      ++|.+. .++...+..+++|++|+++++. +.......+..+++|+.|++++|.+. ..| .+..+++|+.|++++|.+.
T Consensus       144 ~~N~i~-~~~~~~~~~l~~L~~L~l~~~~~l~~i~~~~~~~l~~L~~L~L~~n~l~-~~~-~~~~l~~L~~L~Ls~N~l~  220 (440)
T 3zyj_A          144 RNNPIE-SIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLR-EIP-NLTPLIKLDELDLSGNHLS  220 (440)
T ss_dssp             CSCCCC-EECTTTTTTCTTCCEEECCCCTTCCEECTTTTTTCSSCCEEECTTSCCS-SCC-CCTTCSSCCEEECTTSCCC
T ss_pred             CCCccc-ccCHHHhhhCcccCEeCCCCCCCcceeCcchhhcccccCeecCCCCcCc-ccc-ccCCCcccCEEECCCCccC
Confidence            999998 7777777789999999999854 44344457888999999999999988 444 4778889999999999998


Q ss_pred             ccccccccCCccccEEEccCCcCcCCCcccccCcCCCcEEEcccCCCCCCcchhccCCCcccEEEcCCCccccchhHhhh
Q 045571          160 GEIPREFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQ  239 (260)
Q Consensus       160 ~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~  239 (260)
                      +..+..+..+++|++|++.+|.+.+..+..+..+++|++|++++|.++...+..+..+++|+.|+|++|++.        
T Consensus       221 ~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~Np~~--------  292 (440)
T 3zyj_A          221 AIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWN--------  292 (440)
T ss_dssp             EECTTTTTTCTTCCEEECTTCCCCEECTTSSTTCTTCCEEECTTSCCCCCCTTTTSSCTTCCEEECCSSCEE--------
T ss_pred             ccChhhhccCccCCEEECCCCceeEEChhhhcCCCCCCEEECCCCCCCccChhHhccccCCCEEEcCCCCcc--------
Confidence            777888999999999999999998888888999999999999999999888888899999999999999998        


Q ss_pred             cccccccccccccceee
Q 045571          240 FYSSSACFCNLYSFACS  256 (260)
Q Consensus       240 ~l~~l~~~~~~~~~~~~  256 (260)
                            |+|++.|+..|
T Consensus       293 ------CdC~l~~l~~~  303 (440)
T 3zyj_A          293 ------CNCDILWLSWW  303 (440)
T ss_dssp             ------CSSTTHHHHHH
T ss_pred             ------CCCCchHHHHH
Confidence                  99998887543
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 260
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-13
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-08
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 77.2 bits (188), Expect = 3e-17
 Identities = 48/229 (20%), Positives = 82/229 (35%), Gaps = 3/229 (1%)

Query: 4   TVLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSG 63
              +  +  L   +P  +   ++ Q + L  NR+S    ++      L  +    N L+ 
Sbjct: 14  VTTSCPQQGLQ-AVPVGIP--AASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLAR 70

Query: 64  AFPSFIFNKSSLQHLDFSQNTLSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTY 123
              +     + L+ LD S N     +       L  L  + L +       P        
Sbjct: 71  IDAAAFTGLALLEQLDLSDNAQLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAA 130

Query: 124 LQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPREFGSLAELELMSLRESNLQ 183
           LQ L L  N           +L  L  L+L  NR+     R F  L  L+ + L ++ + 
Sbjct: 131 LQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVA 190

Query: 184 GGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQG 232
              P    +L +L  L LF NNL+       + L  L+ + L++N    
Sbjct: 191 HVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWVC 239
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query260
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.79
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.71
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.5
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.28
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.99
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.51
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.36
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Reticulon 4 receptor (Nogo-66 receptor, Ngr)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=2.9e-28  Score=189.24  Aligned_cols=233  Identities=21%  Similarity=0.268  Sum_probs=202.7

Q ss_pred             EEEecCCccCCCccccccCCCCccEEEccCCcCccccchhhhcCCCCcEEEccCcccCCCCchhhccCCCccEEeccCCC
Q 045571            5 VLNISRLNLTGTIPSQLGNLSSLQSLNLSFNRLSGSIPSAIFTMYTLKYVSFRENQLSGAFPSFIFNKSSLQHLDFSQNT   84 (260)
Q Consensus         5 ~l~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~l~~~~~~~~~~l~~L~~L~l~~~~   84 (260)
                      .++.++.+++ .+|..+.  +++++|++++|.+++..+.+|.++++|++|+++++.+....+..+.....++++......
T Consensus        15 ~v~c~~~~L~-~iP~~ip--~~~~~L~Ls~N~i~~i~~~~f~~l~~L~~L~ls~n~l~~i~~~~~~~~~~~~~l~~~~~~   91 (284)
T d1ozna_          15 TTSCPQQGLQ-AVPVGIP--AASQRIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNA   91 (284)
T ss_dssp             EEECCSSCCS-SCCTTCC--TTCSEEECTTSCCCEECTTTTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSCT
T ss_pred             EEEcCCCCCC-ccCCCCC--CCCCEEECcCCcCCCCCHHHhhcccccccccccccccccccccccccccccccccccccc
Confidence            4567777777 5676654  679999999999997777789999999999999999987777788888899998876544


Q ss_pred             CCCccchhhhcCCCcceEEecCCCcccCCCCccccCCCCCcEEEccCccCCCCCcccccCCCcccEEEcCCccccccccc
Q 045571           85 LSGEIPANICSNLPFLEYISLSKNMFHGGIPSALSKCTYLQILSLSFNDFSGAIPKDIGNLTKLMELYLGRNRLQGEIPR  164 (260)
Q Consensus        85 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~  164 (260)
                      ....++...+..+++|++|+++++.........+....+|+.+++.+|.++++.+..+..+++|+.|++++|.+....+.
T Consensus        92 ~~~~l~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~L~~l~l~~N~l~~i~~~~f~~~~~L~~L~l~~N~l~~l~~~  171 (284)
T d1ozna_          92 QLRSVDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNLTHLFLHGNRISSVPER  171 (284)
T ss_dssp             TCCCCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCCEECTT
T ss_pred             ccccccchhhcccccCCEEecCCcccccccccccchhcccchhhhccccccccChhHhccccchhhcccccCcccccchh
Confidence            33377777778999999999999998766667778889999999999999977677888899999999999999877788


Q ss_pred             cccCCccccEEEccCCcCcCCCcccccCcCCCcEEEcccCCCCCCcchhccCCCcccEEEcCCCccccchhHhhhccccc
Q 045571          165 EFGSLAELELMSLRESNLQGGIPQELGNLAKLEMLQLFQNNLTGEIPREFSNLAKLEMMSLSENNLQGVIINFLQFYSSS  244 (260)
Q Consensus       165 ~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~l  244 (260)
                      ++..+++|+.+++++|.+.+..|..|..+++|++|++++|.+.+..+..++.+++|++|++++|++.             
T Consensus       172 ~f~~l~~L~~l~l~~N~l~~i~~~~f~~l~~L~~L~l~~N~i~~~~~~~~~~~~~L~~L~l~~N~l~-------------  238 (284)
T d1ozna_         172 AFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSALPTEALAPLRALQYLRLNDNPWV-------------  238 (284)
T ss_dssp             TTTTCTTCCEEECCSSCCCEECTTTTTTCTTCCEEECCSSCCSCCCHHHHTTCTTCCEEECCSSCEE-------------
T ss_pred             hhccccccchhhhhhccccccChhHhhhhhhcccccccccccccccccccccccccCEEEecCCCCC-------------
Confidence            8999999999999999999888899999999999999999999888899999999999999999999             


Q ss_pred             ccccccccce
Q 045571          245 ACFCNLYSFA  254 (260)
Q Consensus       245 ~~~~~~~~~~  254 (260)
                       |+|++.|+.
T Consensus       239 -C~C~~~~l~  247 (284)
T d1ozna_         239 -CDCRARPLW  247 (284)
T ss_dssp             -CSGGGHHHH
T ss_pred             -CCccchHHH
Confidence             888877643
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure