Citrus Sinensis ID: 045598


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
cEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccEEEccccccccccccccEEEccccccEEEcccccccccccEEEccccccEEEccHHcccccccccEEEcccccccccccHHHHccccccEEEccccccEEcccccccccccccEEEcccccccccccHHHHcccHHHHHcccccEEEEEccEEEEEcccccccccEEEcccccccccccHHHHccccccccccccccccccccHHHcccccccEEEcccccccccccHHHHcccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccEEEEEEEEEEcccccc
ccccccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEEEccccccccccHHHHccccccEEEEEccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEEHcccccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHHccccccEEEcccccccccccccHccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHccccccccc
tlslvndslggpfrlpihshkrlgmldisnnnfrghipvEIADVLPSLYAFnnsmnaldgsipssfgnmkflQFLDlsnnhltgeipehlavgCVNLRFLALSNnnlqghmfsrnfnltnlkwlqlegsrfvgeipqslskcssleglylnnnslsgkiprwlgnltrlqciimpnnhlegpipvefcQLDLLQildisdnnisgslpscfhplsikqvhLSKNmlhgqlkrgtffncsslvtldlsynrlngsisdWVDGLSQLSHLILghnnlegevpiQLCELnqlqlldlsnnnlhgpipscfdnttlhEKKQIREKFEFTTKNIAYIYQGKVLSLLSgldlscnkligpiplqignltrIQTLNlshnnltgsipstfsnlkyvesldlsnnklngkiphqlVELKTLEVFSVAYNNlsgeipewTAQFATfnessyegntflcglplpicrspatmseasignerddnlidmnsFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFvvdnliptrfch
tlslvndslggpfrlpihshkRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCqldllqildiSDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIqlcelnqlqlldlsnnnlHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
***********PFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPA***********DDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFC*
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQI******TTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCG****************************NSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPT*FC*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query536 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.805 0.368 0.344 1e-55
Q9ZPS9 1143 Serine/threonine-protein no no 0.886 0.415 0.330 4e-55
Q9ZWC8 1166 Serine/threonine-protein no no 0.934 0.429 0.309 8e-55
Q9LJF3 1164 Receptor-like protein kin no no 0.949 0.437 0.316 1e-52
Q9LHP4 1141 Receptor-like protein kin no no 0.822 0.386 0.336 3e-52
Q9M0G7 1013 Leucine-rich repeat recep no no 0.826 0.437 0.343 3e-52
Q8LPB4 1021 Phytosulfokine receptor 1 N/A no 0.792 0.416 0.331 2e-51
Q9C9H7 847 Receptor-like protein 12 no no 0.938 0.593 0.318 2e-51
Q9SHI2 1101 Leucine-rich repeat recep no no 0.932 0.454 0.318 4e-51
O82318 960 Probably inactive leucine no no 0.854 0.477 0.320 2e-50
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  217 bits (553), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 169/491 (34%), Positives = 251/491 (51%), Gaps = 59/491 (12%)

Query: 2   LSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGS 61
           L+L +++  G F   I + + L +L +  NN  G +P ++  +L +L   +   N L G 
Sbjct: 341 LTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLG-LLTNLRNLSAHDNLLTGP 399

Query: 62  IPSSFGNMKFLQFLDLSNNHLTGEIPE--------HLAVG--------------CVNLRF 99
           IPSS  N   L+ LDLS+N +TGEIP          +++G              C NL  
Sbjct: 400 IPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTFISIGRNHFTGEIPDDIFNCSNLET 459

Query: 100 LALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKI 159
           L++++NNL G +      L  L+ LQ+  +   G IP+ +     L  LYL++N  +G+I
Sbjct: 460 LSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRI 519

Query: 160 PRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPL-SIKQ 218
           PR + NLT LQ + M +N LEGPIP E   + LL +LD+S+N  SG +P+ F  L S+  
Sbjct: 520 PREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTY 579

Query: 219 VHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSI-SDWVDGLSQLS-HLILGHNNLE 276
           + L  N  +G +   +  + S L T D+S N L G+I  + +  L  +  +L   +N L 
Sbjct: 580 LSLQGNKFNGSIP-ASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLT 638

Query: 277 GEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGK 336
           G +P +L +L  +Q +DLSNN   G IP      +L   K +     FT           
Sbjct: 639 GTIPKELGKLEMVQEIDLSNNLFSGSIPR-----SLQACKNV-----FT----------- 677

Query: 337 VLSLLSGLDLSCNKLIGPIPLQI-GNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLS 395
                  LD S N L G IP ++   +  I +LNLS N+ +G IP +F N+ ++ SLDLS
Sbjct: 678 -------LDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLS 730

Query: 396 NNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPI 455
           +N L G+IP  L  L TL+   +A NNL G +PE +  F   N S   GNT LCG   P+
Sbjct: 731 SNNLTGEIPESLANLSTLKHLKLASNNLKGHVPE-SGVFKNINASDLMGNTDLCGSKKPL 789

Query: 456 CRSPATMSEAS 466
              P T+ + S
Sbjct: 790 --KPCTIKQKS 798




Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query536
255581263 912 serine-threonine protein kinase, plant-t 0.962 0.565 0.529 1e-142
224073452 710 predicted protein [Populus trichocarpa] 0.970 0.732 0.468 1e-123
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.970 0.355 0.462 1e-123
224114135 664 predicted protein [Populus trichocarpa] 0.970 0.783 0.458 1e-122
224073382 1309 predicted protein [Populus trichocarpa] 0.970 0.397 0.463 1e-121
224111804 663 predicted protein [Populus trichocarpa] 0.970 0.784 0.458 1e-120
224142481 781 predicted protein [Populus trichocarpa] 0.949 0.651 0.455 1e-119
224134891 953 predicted protein [Populus trichocarpa] 0.951 0.535 0.452 1e-119
224104257 675 predicted protein [Populus trichocarpa] 0.970 0.770 0.45 1e-118
224073436 1014 predicted protein [Populus trichocarpa] 0.970 0.512 0.45 1e-118
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  512 bits (1318), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 284/536 (52%), Positives = 357/536 (66%), Gaps = 20/536 (3%)

Query: 2   LSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGS 61
           L LVN+SL G  +LP+H H  L  LDISNN+   HIP+EI   LP L   N S N  DGS
Sbjct: 379 LDLVNNSLSGHLQLPLHPHVNLLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGS 438

Query: 62  IPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNL 121
           IPSSFGNM  L+ LDLSNN L+G IPEHLA GC +L  L LSNN+LQG MFS+ FNLTNL
Sbjct: 439 IPSSFGNMNSLRILDLSNNQLSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNL 498

Query: 122 KWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEG 181
            WL+L+ + F G IP+SLSK S+L  + L++N LSG IP W+GNL+ LQ +I+ NN L+G
Sbjct: 499 WWLELDKNHFSGRIPKSLSK-SALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKG 557

Query: 182 PIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSL 241
           PIPVEFCQL  L++LD+++N++SG LPSC  P SI  VHLS+NM+ G      F     L
Sbjct: 558 PIPVEFCQLHYLEVLDLANNSVSGILPSCLSPSSIIHVHLSQNMIEGPWTNA-FSGSHFL 616

Query: 242 VTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHG 301
           VTLDLS NR+ G I   + G++ L  L L  N  +GE+P Q+C L QL L+ L++NNL G
Sbjct: 617 VTLDLSSNRITGRIPTLIGGINALRILNLKSNRFDGEIPAQICGLYQLSLIVLADNNLSG 676

Query: 302 PIPSCFD---NTTLHEKKQ------------IREKFEFTTKNIAYIYQGKVLSLLSGLDL 346
            IPSC     + +L                 +R  + FTTK  +Y YQGK+LS +SG+D 
Sbjct: 677 SIPSCLQLDQSDSLAPDVPPVPNPLNPYYLPVRPMY-FTTKRRSYSYQGKILSYISGIDF 735

Query: 347 SCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQ 406
           SCNKL G IP ++GN + I +LNLS+N  TG IPSTFSNLK +ESLDLS N LNG IP Q
Sbjct: 736 SCNKLTGEIPPEMGNHSAIYSLNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQ 795

Query: 407 LVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEAS 466
           L+ELK L  FSVA+NNL G+ P+ T QFATF  SSYEGN  LCGLPLP   +    S A 
Sbjct: 796 LLELKFLSYFSVAHNNLFGKTPKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAP 855

Query: 467 IGNERDD--NLIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRRWFYFVEMWITS 520
             +  D+  N +DMN+F+ +F  SY  VI    ++LY+N  WRR WF FV++ I+S
Sbjct: 856 RASAMDEESNFLDMNTFYGSFIVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114135|ref|XP_002332433.1| predicted protein [Populus trichocarpa] gi|222832402|gb|EEE70879.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111804|ref|XP_002332879.1| predicted protein [Populus trichocarpa] gi|222834379|gb|EEE72856.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224104257|ref|XP_002333966.1| predicted protein [Populus trichocarpa] gi|222839284|gb|EEE77621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query536
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.932 0.550 0.349 4.1e-65
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.904 0.485 0.335 1.6e-63
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.929 0.558 0.349 7.8e-57
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.940 0.539 0.332 1.5e-56
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.884 0.491 0.283 2.7e-45
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.897 0.492 0.342 3.1e-55
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.861 0.426 0.334 1.2e-53
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.826 0.437 0.325 1.4e-51
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.902 0.412 0.306 4.2e-50
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.936 0.592 0.299 5.3e-49
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 663 (238.4 bits), Expect = 4.1e-65, P = 4.1e-65
 Identities = 193/552 (34%), Positives = 267/552 (48%)

Query:     2 LSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGS 61
             L L N+S    F++P   H  L +LD S NN  G  P     VLP+L   N S N   G+
Sbjct:   372 LQLKNNSFT-IFQMPTSVHN-LQVLDFSENNIGGLFPDNFGRVLPNLVHMNGSNNGFQGN 429

Query:    62 IPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNL 121
              PSS G M  + FLDLS N+L+GE+P+     C +L  L LS+N   GH   R  N T+L
Sbjct:   430 FPSSMGEMYNISFLDLSYNNLSGELPQSFVSSCFSLSILQLSHNKFSGHFLPRQTNFTSL 489

Query:   122 KWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWL------------GNL--- 166
               L++  + F G+I   L     L  L ++NN L G++P  L            GNL   
Sbjct:   490 IVLRINNNLFTGKIGVGLLTLVDLCILDMSNNFLEGELPPLLLVFEYLNFLDLSGNLLSG 549

Query:   167 -----TRLQCII-MPNNHLEGPIPVEFCXXXXXXXXXXSDNNISGSLPSCFHPLSIKQVH 220
                    L  ++ + NN+  GPIP  F            +N +SG++P       I  + 
Sbjct:   550 ALPSHVSLDNVLFLHNNNFTGPIPDTFLGSIQILDLR--NNKLSGNIPQFVDTQDISFLL 607

Query:   221 LSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVP 280
             L  N L G +   T    S +  LDLS N+LNG I    + LS       G    E E+ 
Sbjct:   608 LRGNSLTGYIP-STLCEFSKMRLLDLSDNKLNGFIPSCFNNLS------FGLARKE-EI- 658

Query:   281 IXXXXXXXXXXXXXXXXXXHGPIPSCF--DNTTLHEKKQIREKFEFTTKNI--AYI---- 332
                                 G   S F  +N  L          +F TK    +YI    
Sbjct:   659 ------TNYYVAVALESFYLGFYKSTFVVENFRLDYSNYFEIDVKFATKQRYDSYIGAFQ 712

Query:   333 YQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESL 392
             +    L+ + GLDLS N+L G IP ++G+L +++ LNLSHN L+  IP +FS L+ +ESL
Sbjct:   713 FSEGTLNSMYGLDLSSNELSGVIPAELGDLFKLRALNLSHNFLSSHIPDSFSKLQDIESL 772

Query:   393 DLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLP 452
             DLS N L G IPHQL  L +L +F+V+YNNLSG IP+   QF TF+E+SY GN  LCG P
Sbjct:   773 DLSYNMLQGSIPHQLTNLTSLAIFNVSYNNLSGIIPQGK-QFNTFDENSYLGNPLLCGPP 831

Query:   453 LPI-CRSPATMSEASIGNERDDN--LIDMNSFFITFTTSYVIVIFATVIILYVNSYWRRR 509
                 C +     E + G E DD    IDM  F+ +   +YV  +   ++++ V+  WRR 
Sbjct:   832 TDTSCETKKNSEENANGGEEDDKEVAIDMLVFYWSTAGTYVTALIGILVLMCVDCSWRRA 891

Query:   510 WFYFVEMWITSS 521
             W   V+ +I S+
Sbjct:   892 WLRLVDAFIASA 903


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0067011801
hypothetical protein (710 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query536
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-60
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-56
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-39
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-25
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  215 bits (549), Expect = 1e-60
 Identities = 169/494 (34%), Positives = 236/494 (47%), Gaps = 54/494 (10%)

Query: 1   TLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDG 60
           TL L N+ L G     I S   L +LD+  N   G IP  + + L SL     + N L G
Sbjct: 144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTN-LTSLEFLTLASNQLVG 202

Query: 61  SIPSSFGNMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTN 120
            IP   G MK L+++ L  N+L+GEIP  +  G  +L  L L  NNL G + S   NL N
Sbjct: 203 QIPRELGQMKSLKWIYLGYNNLSGEIPYEIG-GLTSLNHLDLVYNNLTGPIPSSLGNLKN 261

Query: 121 LKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLE 180
           L++L L  ++  G IP S+     L  L L++NSLSG+IP  +  L  L+ + + +N+  
Sbjct: 262 LQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFT 321

Query: 181 GPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLS-IKQVHLSKNMLHGQLKRGTFFNCS 239
           G IPV    L  LQ+L +  N  SG +P      + +  + LS N L G++  G    CS
Sbjct: 322 GKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGL---CS 378

Query: 240 S--LVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNN 297
           S  L  L L  N L G I   +     L  + L  N+  GE+P +  +L  +  LD+SNN
Sbjct: 379 SGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNN 438

Query: 298 NLHGPIPS-CFDNTTLHEKKQIREKF------EFTTKNIAYIYQGKVLSLLSGLDLSCNK 350
           NL G I S  +D  +L      R KF       F +K             L  LDLS N+
Sbjct: 439 NLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKR------------LENLDLSRNQ 486

Query: 351 LIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVEL 410
             G +P ++G+L+ +  L LS N L+G IP   S+ K + SLDLS+N+L+G+IP    E+
Sbjct: 487 FSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM 546

Query: 411 KTLEVFSVAYNNLSGEIPE-----------------------WTAQFATFNESSYEGNTF 447
             L    ++ N LSGEIP+                        T  F   N S+  GN  
Sbjct: 547 PVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNID 606

Query: 448 LCG----LPLPICR 457
           LCG      LP C+
Sbjct: 607 LCGGDTTSGLPPCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 536
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.95
KOG4237498 consensus Extracellular matrix protein slit, conta 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.52
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.21
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
PLN03150623 hypothetical protein; Provisional 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.05
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.04
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.02
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.99
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.88
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.84
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.63
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.47
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.3
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.22
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.19
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.12
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.99
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.98
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.96
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.95
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
PRK15386426 type III secretion protein GogB; Provisional 97.74
PRK15386 426 type III secretion protein GogB; Provisional 97.68
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.65
KOG4341483 consensus F-box protein containing LRR [General fu 97.58
KOG4341483 consensus F-box protein containing LRR [General fu 97.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.58
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.39
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.34
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.18
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.93
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.8
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.65
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.39
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.33
smart0037026 LRR Leucine-rich repeats, outliers. 92.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.71
smart0037026 LRR Leucine-rich repeats, outliers. 91.71
KOG4308478 consensus LRR-containing protein [Function unknown 91.12
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.84
KOG4308478 consensus LRR-containing protein [Function unknown 89.47
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.28
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.12
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.41
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.1e-50  Score=449.76  Aligned_cols=440  Identities=33%  Similarity=0.496  Sum_probs=244.9

Q ss_pred             EEeccccccccCCCCcCCCCCcCEEEccCCcCcccCChhHhhcCCCCcEEEccCCCCcccCCccCCCCCCCCEEEccCCc
Q 045598            2 LSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNH   81 (536)
Q Consensus         2 L~L~~~~~~~~~~~~~~~~~~L~~L~ls~~~~~~~~p~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~   81 (536)
                      |||++|++.+.+|.  ..+++|++|++++|.+.+.+|..+.. +++|++|++++|.+.+..|..+.++++|++|++++|.
T Consensus       123 L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~-l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~  199 (968)
T PLN00113        123 LNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGS-FSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQ  199 (968)
T ss_pred             EECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhc-CCCCCEEECccCcccccCChhhhhCcCCCeeeccCCC
Confidence            55555555554442  23455555555555555445544443 4555555555555555555555555555555555555


Q ss_pred             CccccchhHhhCCCCCCEEEcccCccCccCCccccCCCCCCEEEccCCcCcccCCcCCCCCCccCeeecccCcCCCCCCc
Q 045598           82 LTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPR  161 (536)
Q Consensus        82 l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~  161 (536)
                      +++.+|..+ +.+++|++|++++|.+++..+..+.++++|++|++++|.+.+..|..+.++++|+.|++++|.+.+..|.
T Consensus       200 l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~  278 (968)
T PLN00113        200 LVGQIPREL-GQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPP  278 (968)
T ss_pred             CcCcCChHH-cCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCch
Confidence            544444443 3455555555555555544444455555555555555555444444455555555555555554444444


Q ss_pred             ccCCCCCCCeEEccCCccccCCcccccCCCCCCEE------------------------EccCCcCcccCCCCC-CCCCc
Q 045598          162 WLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQIL------------------------DISDNNISGSLPSCF-HPLSI  216 (536)
Q Consensus       162 ~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L------------------------~l~~n~~~~~~~~~~-~~~~L  216 (536)
                      .+.++++|++|++++|.+.+..|..+..+++|+.|                        ++++|.+.+..|..+ ...+|
T Consensus       279 ~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L  358 (968)
T PLN00113        279 SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNL  358 (968)
T ss_pred             hHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCC
Confidence            44444555555555544444444444444444444                        444444443333322 33445


Q ss_pred             cEEEccCCCCCCcccccccCCCCCccEEEccCCcCCCccchhhhCCCCccEEEcccccccccccccccCCCCCCEEecCC
Q 045598          217 KQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSN  296 (536)
Q Consensus       217 ~~L~l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~  296 (536)
                      +.|++++|.+.+.++.. +..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+++..|..+..+++|+.|++++
T Consensus       359 ~~L~Ls~n~l~~~~p~~-~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~  437 (968)
T PLN00113        359 TVLDLSTNNLTGEIPEG-LCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISN  437 (968)
T ss_pred             cEEECCCCeeEeeCChh-HhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcC
Confidence            55555555444433332 44444555555555555555555555566666666666666655565666666666666666


Q ss_pred             CcCCCCCCccccccchhhhccccceeEEeeccce-eeeccccccccceEEccCCcCcCCCcccccCCCCCCEEeCCCccC
Q 045598          297 NNLHGPIPSCFDNTTLHEKKQIREKFEFTTKNIA-YIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNL  375 (536)
Q Consensus       297 n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l  375 (536)
                      |.+++..+..+........      +.+..+.+. ..+.....++|+.|++++|.+.+..|..+..+++|+.|+|++|++
T Consensus       438 N~l~~~~~~~~~~l~~L~~------L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l  511 (968)
T PLN00113        438 NNLQGRINSRKWDMPSLQM------LSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKL  511 (968)
T ss_pred             CcccCccChhhccCCCCcE------EECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcc
Confidence            6666555544333221111      111111111 111112235677777777777777777777777777777777777


Q ss_pred             CCCCcccccCCCCCCEEeCCCCcccccCchhhhCCCCCCEEEccCCcCcccCCCCccccccCCccccccCcCCCCCC
Q 045598          376 TGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLP  452 (536)
Q Consensus       376 ~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~l~l~~n~~~c~~~  452 (536)
                      .+..|+.+.++++|++|+|++|.+++.+|..+..+++|+.|++++|++++.+|..+..+++++.+++.+|++.+..|
T Consensus       512 ~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        512 SGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             eeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCC
Confidence            77777777777777777777777777777777777777777777777777777777677777777777777666544



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query536
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-29
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-29
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 4e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-17
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 4e-05
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 126 bits (317), Expect = 3e-29, Method: Compositional matrix adjust. Identities = 133/519 (25%), Positives = 199/519 (38%), Gaps = 122/519 (23%) Query: 21 KRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFG------------- 67 K L L ++ N F G IP ++ +L + S N G++P FG Sbjct: 266 KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSN 325 Query: 68 ------------NMKFLQFLDLSNNHLTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRN 115 M+ L+ LDLS N +GE+PE L +L L LS+NN G + Sbjct: 326 NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILP-- 383 Query: 116 FNLTN-----LKWLQLEGSRFVGEIPQSLSKCSSLEGLYLNNNSLSGKIPRWLGNLTRLQ 170 NL L+ L L+ + F G+IP +LS CS L L+L+ N LSG IP LG+L++L+ Sbjct: 384 -NLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLR 442 Query: 171 CIIMPNNHLEGPIPVEFCXXXXXXXXXXSDNNISGSLPSCFHPLSIKQVHLSKNMLHGQL 230 + + N LEG IP E N+++G +PS Sbjct: 443 DLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLS------------------ 484 Query: 231 KRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIXXXXXXXXX 290 NC++L + LS NRL G I W+ L L+ L L +N+ G +P Sbjct: 485 ------NCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLI 538 Query: 291 XXXXXXXXXHGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCN- 349 +G IP+ + +I F K YI G+ C+ Sbjct: 539 WLDLNTNLFNGTIPAAM----FKQSGKIAANF-IAGKRYVYIKN-------DGMKKECHG 586 Query: 350 -----KLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIP 404 + G Q+ L+ N++ G TF N + LD+S N L+G IP Sbjct: 587 AGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIP 646 Query: 405 HQLVELKTLEVFSVAYNNLSGEIPEWT--------------------------------- 431 ++ + L + ++ +N++SG IP+ Sbjct: 647 KEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEI 706 Query: 432 --------------AQFATFNESSYEGNTFLCGLPLPIC 456 QF TF + + N LCG PLP C Sbjct: 707 DLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query536
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-118
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-98
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-82
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-68
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-72
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-65
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-56
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-51
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-49
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-45
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-33
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-60
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-58
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-54
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-50
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-53
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-37
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-57
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-54
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-46
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-54
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-47
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-16
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-48
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-40
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-36
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-36
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-24
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-35
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-40
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-39
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-32
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-33
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-37
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-36
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-22
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-18
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-11
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-37
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-31
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-36
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-34
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-34
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-32
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-20
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-28
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-26
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-25
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-24
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-19
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-15
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-22
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-22
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-19
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-15
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-15
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-14
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-14
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 6e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 9e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  366 bits (941), Expect = e-118
 Identities = 131/437 (29%), Positives = 191/437 (43%), Gaps = 61/437 (13%)

Query: 23  LGMLDISNNNFRGHIPVEIADV-LPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNH 81
           L  LD+S+NNF G I   +      +L       N   G IP +  N   L  L LS N+
Sbjct: 370 LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNY 429

Query: 82  LTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSK 141
           L+G IP  L      LR L L  N L+G +      +  L+ L L+ +   GEIP  LS 
Sbjct: 430 LSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN 488

Query: 142 CSSLEGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDN 201
           C++L  + L+NN L+G+IP+W+G L  L  + + NN   G IP E      L  LD++ N
Sbjct: 489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 548

Query: 202 NISGSLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDG 261
             +G++P+                          F  S      ++ N + G    ++  
Sbjct: 549 LFNGTIPAAM------------------------FKQS----GKIAANFIAGKRYVYIKN 580

Query: 262 LSQLSHLILGHN--NLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIR 319
                      N    +G    QL  L+     ++++    G     FDN          
Sbjct: 581 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDN---------- 630

Query: 320 EKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSI 379
                                +  LD+S N L G IP +IG++  +  LNL HN+++GSI
Sbjct: 631 ------------------NGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSI 672

Query: 380 PSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNE 439
           P    +L+ +  LDLS+NKL+G+IP  +  L  L    ++ NNLSG IPE   QF TF  
Sbjct: 673 PDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE-MGQFETFPP 731

Query: 440 SSYEGNTFLCGLPLPIC 456
           + +  N  LCG PLP C
Sbjct: 732 AKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query536
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.97
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.97
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.76
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.61
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.58
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.58
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.33
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.8
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.26
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.23
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.02
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.82
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-55  Score=472.17  Aligned_cols=465  Identities=32%  Similarity=0.510  Sum_probs=382.0

Q ss_pred             EEeccccccccCCCCcCCCCCcCEEEccCCcCcccCChhHhhcCCCCcEEEccCCCCcccCCccCCCCCCCCEEEccCCc
Q 045598            2 LSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNH   81 (536)
Q Consensus         2 L~L~~~~~~~~~~~~~~~~~~L~~L~ls~~~~~~~~p~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~   81 (536)
                      |+|++|.+.+.+|..  .+++|++|++++|.+++.+|..++..+++|+.|++++|.+++..|..|+++++|++|++++|.
T Consensus       252 L~Ls~n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~  329 (768)
T 3rgz_A          252 LNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNN  329 (768)
T ss_dssp             EECCSSCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSE
T ss_pred             EECCCCcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCc
Confidence            556666665555533  566666666666666667777777656788888888888888888888888888888888888


Q ss_pred             CccccchhHhhCCCCCCEEEcccCccCccCCccccCCC-CCCEEEccCCcCcccCCcCCCC--CCccCeeecccCcCCCC
Q 045598           82 LTGEIPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLT-NLKWLQLEGSRFVGEIPQSLSK--CSSLEGLYLNNNSLSGK  158 (536)
Q Consensus        82 l~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~-~L~~L~L~~n~i~~~~~~~~~~--l~~L~~L~l~~n~~~~~  158 (536)
                      +++.+|...+..+++|++|++++|.+++..+..+..++ +|++|++++|.+.+..+..+..  +++|++|++++|.+.+.
T Consensus       330 l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~  409 (768)
T 3rgz_A          330 FSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGK  409 (768)
T ss_dssp             EEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEE
T ss_pred             ccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccc
Confidence            88788877667888888898888888877777777776 8999999998888777777766  78899999999999888


Q ss_pred             CCcccCCCCCCCeEEccCCccccCCcccccCCCCCCEEEccCCcCcccCCCCC-CCCCccEEEccCCCCCCcccccccCC
Q 045598          159 IPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCF-HPLSIKQVHLSKNMLHGQLKRGTFFN  237 (536)
Q Consensus       159 ~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~-~~~~L~~L~l~~n~~~~~~~~~~~~~  237 (536)
                      .|..+..+++|++|++++|.+.+..|..+..+++|+.|++++|.+.+..+..+ ..++|+.|++++|.+.+.++.. +..
T Consensus       410 ~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~-l~~  488 (768)
T 3rgz_A          410 IPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSG-LSN  488 (768)
T ss_dssp             CCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGG-GGG
T ss_pred             cCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHH-Hhc
Confidence            89999999999999999999998999999999999999999999998877766 6789999999999998777765 899


Q ss_pred             CCCccEEEccCCcCCCccchhhhCCCCccEEEcccccccccccccccCCCCCCEEecCCCcCCCCCCccccccchhhhcc
Q 045598          238 CSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQ  317 (536)
Q Consensus       238 ~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~~~  317 (536)
                      +++|++|++++|++++.+|.++..+++|+.|++++|++++.+|..+..+++|+.|++++|++++.+|..+..........
T Consensus       489 l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~  568 (768)
T 3rgz_A          489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN  568 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCS
T ss_pred             CCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999998888765432111110


Q ss_pred             ccc--eeE-Eee-------------------------------------cccee--eeccccccccceEEccCCcCcCCC
Q 045598          318 IRE--KFE-FTT-------------------------------------KNIAY--IYQGKVLSLLSGLDLSCNKLIGPI  355 (536)
Q Consensus       318 ~~~--~~~-~~~-------------------------------------~~~~~--~~~~~~~~~L~~L~l~~n~l~~~~  355 (536)
                      ...  ... ...                                     +....  ......++.|+.|++++|.+++.+
T Consensus       569 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~i  648 (768)
T 3rgz_A          569 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYI  648 (768)
T ss_dssp             TTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCC
T ss_pred             ccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccC
Confidence            000  000 000                                     00000  001123578999999999999999


Q ss_pred             cccccCCCCCCEEeCCCccCCCCCcccccCCCCCCEEeCCCCcccccCchhhhCCCCCCEEEccCCcCcccCCCCccccc
Q 045598          356 PLQIGNLTRIQTLNLSHNNLTGSIPSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFA  435 (536)
Q Consensus       356 ~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~  435 (536)
                      |..++.+++|+.|+|++|++++.+|+.++++++|++|||++|++++.+|..+..+++|+.|++++|+++|.+|.. ..+.
T Consensus       649 p~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~  727 (768)
T 3rgz_A          649 PKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFE  727 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGG
T ss_pred             CHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999986 4788


Q ss_pred             cCCccccccCcCCCCCCCCCCCCCCCCCcccCCCC
Q 045598          436 TFNESSYEGNTFLCGLPLPICRSPATMSEASIGNE  470 (536)
Q Consensus       436 ~l~~l~l~~n~~~c~~~l~~C~~~~~~~~~~~~~~  470 (536)
                      ++...++.|||.+|+.++..|.......+..+.+.
T Consensus       728 ~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~  762 (768)
T 3rgz_A          728 TFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRS  762 (768)
T ss_dssp             GSCGGGGCSCTEEESTTSCCCCSCC----------
T ss_pred             cCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCc
Confidence            99999999999999999888987776666555443



>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 536
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-21
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-19
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-17
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-08
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-07
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 4e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 8e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 92.8 bits (229), Expect = 5e-21
 Identities = 65/396 (16%), Positives = 129/396 (32%), Gaps = 39/396 (9%)

Query: 26  LDISNNNFRGHIPVEIADVLPSLYAFNNSMNALDGSIPSSFGNMKFLQFLDLSNNHLTGE 85
             +   N    +     D + +L A    + ++DG        +  L  ++ SNN LT  
Sbjct: 27  TVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFSNNQLTDI 81

Query: 86  IPEHLAVGCVNLRFLALSNNNLQGHMFSRNFNLTNLKWLQLEGSRFVGEIPQSLSKCSSL 145
            P         L  + ++NN +       N        L       +  +    +     
Sbjct: 82  TPLK---NLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRL- 137

Query: 146 EGLYLNNNSLSGKIPRWLGNLTRLQCIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISG 205
               L++N++S           +          L+    +   +   +    +SD ++  
Sbjct: 138 ---ELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLA 194

Query: 206 SLPSCFHPLSIKQVHLSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQL 265
            L +         +  + N +            ++L  L L+ N+L       +  L+ L
Sbjct: 195 KLTNLES------LIATNNQISDITP---LGILTNLDELSLNGNQLKDI--GTLASLTNL 243

Query: 266 SHLILGHNNLEGEVPIQLCELNQLQLLDLSNNNLHGPIPSCFDNTTLHEKKQIREKFEFT 325
           + L L +N +    P  L  L +L  L L  N +    P                  E  
Sbjct: 244 TDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLA--------GLTALTNLELN 293

Query: 326 TKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSIPSTFSN 385
              +  I     L  L+ L L  N +    P  + +LT++Q L  ++N ++    S+ +N
Sbjct: 294 ENQLEDISPISNLKNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLAN 349

Query: 386 LKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYN 421
           L  +  L   +N+++   P  L  L  +    +   
Sbjct: 350 LTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query536
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.83
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.81
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.6
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.36
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.3
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.64
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.96
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.92
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.97  E-value=9e-30  Score=242.76  Aligned_cols=259  Identities=35%  Similarity=0.583  Sum_probs=206.5

Q ss_pred             ccCeeecccCcCCC--CCCcccCCCCCCCeEEccC-CccccCCcccccCCCCCCEEEccCCcCcccCCCCCCCCCccEEE
Q 045598          144 SLEGLYLNNNSLSG--KIPRWLGNLTRLQCIIMPN-NHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVH  220 (536)
Q Consensus       144 ~L~~L~l~~n~~~~--~~~~~~~~l~~L~~L~l~~-n~~~~~~~~~~~~l~~L~~L~l~~n~~~~~~~~~~~~~~L~~L~  220 (536)
                      +++.|+++++.+.+  .+|..+.++++|++|++++ |++.+..|..+.++++|++|++++|++.+..+            
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~------------  118 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIP------------  118 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECC------------
T ss_pred             EEEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccccccc------------
Confidence            45666666666554  3556677777777777765 56666667777777777777777777664322            


Q ss_pred             ccCCCCCCcccccccCCCCCccEEEccCCcCCCccchhhhCCCCccEEEcccccccccccccccCCCCC-CEEecCCCcC
Q 045598          221 LSKNMLHGQLKRGTFFNCSSLVTLDLSYNRLNGSISDWVDGLSQLSHLILGHNNLEGEVPIQLCELNQL-QLLDLSNNNL  299 (536)
Q Consensus       221 l~~n~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~l~~n~~  299 (536)
                                  ..+..+++|+.+++++|.+.+.+|..+..++.++.+++++|.+.+.+|..+..+..+ +.+++++|++
T Consensus       119 ------------~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l  186 (313)
T d1ogqa_         119 ------------DFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRL  186 (313)
T ss_dssp             ------------GGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEE
T ss_pred             ------------ccccchhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccc
Confidence                        225566778888888887777778888888888888888888888888877777765 7888888888


Q ss_pred             CCCCCccccccchhhhccccceeEEeeccceeeeccccccccceEEccCCcCcCCCcccccCCCCCCEEeCCCccCCCCC
Q 045598          300 HGPIPSCFDNTTLHEKKQIREKFEFTTKNIAYIYQGKVLSLLSGLDLSCNKLIGPIPLQIGNLTRIQTLNLSHNNLTGSI  379 (536)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~  379 (536)
                      ++..+..+..                             .....++++.+...+..|..+..+++++.+++++|.+.+.+
T Consensus       187 ~~~~~~~~~~-----------------------------l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~  237 (313)
T d1ogqa_         187 TGKIPPTFAN-----------------------------LNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL  237 (313)
T ss_dssp             EEECCGGGGG-----------------------------CCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG
T ss_pred             cccccccccc-----------------------------ccccccccccccccccccccccccccccccccccccccccc
Confidence            8777665543                             23456888888888889999999999999999999998655


Q ss_pred             cccccCCCCCCEEeCCCCcccccCchhhhCCCCCCEEEccCCcCcccCCCCccccccCCccccccCcCCCCCCCCCCC
Q 045598          380 PSTFSNLKYVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICR  457 (536)
Q Consensus       380 ~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~l~~N~l~~~~~~~~~~~~~l~~l~l~~n~~~c~~~l~~C~  457 (536)
                       ..+..+++|+.|+|++|++++.+|..+.++++|+.|++++|+++|.+|+. ..+++++.+++.||+.+|+.|++.|.
T Consensus       238 -~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~-~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         238 -GKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             -GGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCS-TTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             -cccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCc-ccCCCCCHHHhCCCccccCCCCCCCC
Confidence             46888999999999999999999999999999999999999999999974 68899999999999999999998884



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure