Citrus Sinensis ID: 045675


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380--
MTTNDTTTVSSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
cccccccccccccHHHHHHHHHcccHHHHHHcccccccHHHHcccHHHHHHHHHHccccccEEEEEEccccccccccccccccccccEEEcccccccccccEEEEEEccEEEEEEEcccccEEEEEccccccEEEccccccccccccccEEEEEEEEEccccccEEEEEEEEEccccccEEEEEEcccccEEEEcccccccEEEccccEEEEcccEEEEEEccccccccEEEEEEEccccEEEEEcccccccccccEEEEcccEEEEEEcccccEEcccccEEEEEEEcccccEEEEEEEcccccccEEEEEEccEEEEEEccEEEEEEcccccEEEEEEEccccccEEEEEEEccEEcccccccHHHHHHHHccccccccc
cccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEEEEcccEEEEccccccccccccccccccccccccccEEEEEEcccEEEEEEEEccccccEEEEccccccEEEEccccccccccccEEEEEEEEccccccccEEEEEEEEcccccccEEEEEEcccccEEEEEccccccccccccccEEEEEEEEEEEEEcccccccEEEEEEEcccccccccccccccccccEEEEEEccEEEEEEEcccccccccccEEEEEEEcccccHHEEEEEcccccccEEEEEEccEEEEEEccEEEEEEccccEEEEEEEEcccccccEEEEEcccHEEccccccHHHHHHHHHcccccccc
mttndtttvssvPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLkqhqvelppleglstfpkivgscngllcLDVSSAFGMAFVLwnpatnefkglptpsltesrLKTFWMVSLgfgfnqdtnDYVLVRIVNFQARYDAIAEVYStstgkwkevaagtgscviyggQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWrtampelptdcYVKALSYDQSLALAvypglgfrsrlSNRFELWVmnegkgwtrTFNTAFEriawpvgsfrdskIIMKSVDqfflfnpktkrnfilpidsgmgysyKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
mttndtttvssvplvIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVyststgkwkeVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
MTTNDTTTVSSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
*********SSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVN*********************
*************LVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIV************************
*********SSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
*********SSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGEND*KEVEAQ**G*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTNDTTTVSSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHAFGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVDQFFLFNPKTKRNFILPIDSGMGYSYKVFTYVDSIVAVNGENDEKEVEAQIEGMVHDGSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query382 2.2.26 [Sep-21-2011]
Q8GXC7427 F-box/kelch-repeat protei yes no 0.869 0.777 0.274 3e-20
Q9SU30413 F-box protein CPR30 OS=Ar no no 0.662 0.612 0.230 3e-15
Q9SSQ2423 F-box protein At1g52490 O no no 0.740 0.669 0.248 9e-14
Q9LIR8364 F-box/kelch-repeat protei no no 0.531 0.557 0.266 2e-13
Q9LUU3386 Putative F-box/kelch-repe no no 0.591 0.585 0.239 6e-13
A8MS20401 F-box protein At2g43440 O no no 0.667 0.635 0.237 3e-12
Q9LU24360 Putative F-box protein At no no 0.557 0.591 0.231 6e-12
Q9FHP3392 F-box protein At5g65850 O no no 0.845 0.823 0.250 8e-12
Q0WRU9405 F-box/kelch-repeat protei no no 0.662 0.624 0.253 9e-12
Q9C800441 Putative F-box protein At no no 0.5 0.433 0.264 3e-11
>sp|Q8GXC7|FBK50_ARATH F-box/kelch-repeat protein At3g06240 OS=Arabidopsis thaliana GN=At3g06240 PE=2 SV=1 Back     alignment and function desciption
 Score =  100 bits (248), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 111/404 (27%), Positives = 176/404 (43%), Gaps = 72/404 (17%)

Query: 12  VPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHS-------LIV 64
           +P  IIT+ILL+LP KSI RF+CVSK +  L     F   HL+  +RN S       LIV
Sbjct: 36  LPPEIITEILLRLPAKSIGRFRCVSKLFCTLSSDPGFAKIHLDLILRNESVRSLHRKLIV 95

Query: 65  R----------------------YYNHAFGNDSGLM--LLRSDLKQH-------QVELPP 93
                                   +N+   +D  +   ++R+ +  H        ++L  
Sbjct: 96  SSHNLYSLDFNSIGDGIRDLAAVEHNYPLKDDPSIFSEMIRNYVGDHLYDDRRVMLKLNA 155

Query: 94  LEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPT---PSLTESRLKTFW 150
                 + +IVGS NGL+C  +S   G  F L+NP T + K LP    P   E     F 
Sbjct: 156 KSYRRNWVEIVGSSNGLVC--ISPGEGAVF-LYNPTTGDSKRLPENFRPKSVEYERDNFQ 212

Query: 151 MVSLGFGFNQDTNDYVLVRIVNFQARYDAI--AEVYSTSTGKWKEVAAGTGSCVIYGGQD 208
             + GFGF+  T+DY LV++V   A  + I  A VYS     W+ +              
Sbjct: 213 --TYGFGFDGLTDDYKLVKLV---ATSEDILDASVYSLKADSWRRICNLNYEHNDGSYTS 267

Query: 209 AVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALA 268
            V   G +HW+        N++ VV++D+  E F    +P+   DC  +  ++       
Sbjct: 268 GVHFNGAIHWVF--TESRHNQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNF------- 318

Query: 269 VYPGLGFRSRLSN-----RFELWVMN---EGKGWTRTFNTAFERIAWPVGSFRDSKIIMK 320
           V   L  R  + N       ++WVM+   E K W+R       R   P+ S ++ + ++ 
Sbjct: 319 VVGSLNGRLCVVNSCYDVHDDIWVMSEYGEAKSWSRIRINLLYRSMKPLCSTKNDEEVLL 378

Query: 321 SVD-QFFLFNPKTKRNFILPIDSGMGYS--YKVFTYVDSIVAVN 361
            +D    L+N +T  +  L I  G+  S  ++  TYV+S+++ N
Sbjct: 379 ELDGDLVLYNFETNASSNLGI-CGVKLSDGFEANTYVESLISPN 421





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SU30|CPR30_ARATH F-box protein CPR30 OS=Arabidopsis thaliana GN=CPR30 PE=1 SV=2 Back     alignment and function description
>sp|Q9SSQ2|FB55_ARATH F-box protein At1g52490 OS=Arabidopsis thaliana GN=At1g52490 PE=4 SV=1 Back     alignment and function description
>sp|Q9LIR8|FBK67_ARATH F-box/kelch-repeat protein At3g23880 OS=Arabidopsis thaliana GN=At3g23880 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUU3|FBK58_ARATH Putative F-box/kelch-repeat protein At3g17280 OS=Arabidopsis thaliana GN=At3g17280 PE=4 SV=1 Back     alignment and function description
>sp|A8MS20|FB350_ARATH F-box protein At2g43440 OS=Arabidopsis thaliana GN=At2g43440 PE=2 SV=1 Back     alignment and function description
>sp|Q9LU24|FB145_ARATH Putative F-box protein At3g16210 OS=Arabidopsis thaliana GN=At3g16210 PE=4 SV=1 Back     alignment and function description
>sp|Q9FHP3|FB300_ARATH F-box protein At5g65850 OS=Arabidopsis thaliana GN=At5g65850 PE=2 SV=1 Back     alignment and function description
>sp|Q0WRU9|FBK44_ARATH F-box/kelch-repeat protein At2g43445 OS=Arabidopsis thaliana GN=At2g43445 PE=2 SV=1 Back     alignment and function description
>sp|Q9C800|FB34_ARATH Putative F-box protein At1g33530 OS=Arabidopsis thaliana GN=At1g33530 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
224118272387 predicted protein [Populus trichocarpa] 0.937 0.925 0.381 2e-64
224135169392 predicted protein [Populus trichocarpa] 0.942 0.918 0.372 8e-63
224132792379 predicted protein [Populus trichocarpa] 0.856 0.862 0.311 2e-35
296090345423 unnamed protein product [Vitis vinifera] 0.884 0.799 0.314 3e-34
224119696367 predicted protein [Populus trichocarpa] 0.850 0.885 0.295 4e-28
316996547393 hypothetical protein [Pyrus pyrifolia] 0.887 0.862 0.295 8e-28
147785389 485 hypothetical protein VITISV_041940 [Viti 0.709 0.558 0.314 4e-26
224120796409 predicted protein [Populus trichocarpa] 0.908 0.848 0.288 1e-25
316996536393 hypothetical protein [Pyrus pyrifolia] 0.890 0.865 0.290 1e-25
125995264393 MdSFBB3-beta [Malus x domestica] 0.793 0.770 0.291 1e-25
>gi|224118272|ref|XP_002317776.1| predicted protein [Populus trichocarpa] gi|222858449|gb|EEE95996.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  252 bits (643), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/383 (38%), Positives = 219/383 (57%), Gaps = 25/383 (6%)

Query: 11  SVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEFVTAHLNCSIRNHSLIVRYYNHA 70
           ++P   +TDIL +LPIKS+ RF+ VSK +  LI S  F++AHL  S R+ S   R++N+ 
Sbjct: 6   TLPQETLTDILSRLPIKSLTRFQSVSKPFSALINSPAFISAHLRRSSRHSSFFFRHFNNP 65

Query: 71  FGNDSGLMLLRSDLKQHQVELPPLEGLSTFPKIVGSCNGLLCLDVSSAFGMAFVLWNPAT 130
            G++    L  + +    VE+P L  L  FPKIVGSCNGL+CLD+SS +   FVLWN A 
Sbjct: 66  SGSNFSFFLNNNLISD--VEVPLLGCLIRFPKIVGSCNGLVCLDISSCYARGFVLWNIAR 123

Query: 131 NEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQARYD----AIAEVYST 186
            ++  LP+P +++SR + FWMVS GFGF+   NDY +VRIV+F    D     +AEV+S 
Sbjct: 124 KQYSCLPSPRISDSR-RPFWMVSTGFGFDLKKNDYKVVRIVSFSCEKDESPVVMAEVFSW 182

Query: 187 STGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRTA 246
            T  W+ + A  G+C I+ GQ+ V V G LHW+ N  G    +KF+VS+D++ E F +  
Sbjct: 183 RTFCWRVIEASIGACAIHEGQNGVVVNGGLHWLGNSAGKSGIQKFIVSFDLDTEEFRKIP 242

Query: 247 MPELPTDCYVKALSYDQSLALAVYPGLGF-------RSRLSNRFELWVMNE-----GKGW 294
           +P+ P    VK + +  SLALA YP           R  +++  E  V +E     GK W
Sbjct: 243 IPDFPAGICVKIMGFKGSLALAFYPAKEVDVHSRHGRPGVADWIEFCVWDECDGADGKCW 302

Query: 295 TRTFNTAFERIAWPVGSFRDSKIIMKSV-----DQFFLFNPKTKRNFILPIDSGMGYSYK 349
           T+  +     + +PVG   ++ +I+K +      QF LF+P  +    + I     YS  
Sbjct: 303 TKLNSIQLTTVGYPVGVANETGLIIKKLMEGQGAQFILFDPSNQYYRGMHI-CDASYSCD 361

Query: 350 VFTYVDSIVAVNGENDEKEVEAQ 372
           V +YV+S+V V+G   ++ +E +
Sbjct: 362 VHSYVESLVPVSGGGHDQVIEEE 384




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224135169|ref|XP_002322000.1| predicted protein [Populus trichocarpa] gi|222868996|gb|EEF06127.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224132792|ref|XP_002321411.1| predicted protein [Populus trichocarpa] gi|222868407|gb|EEF05538.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296090345|emb|CBI40164.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224119696|ref|XP_002318137.1| predicted protein [Populus trichocarpa] gi|222858810|gb|EEE96357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|316996547|dbj|BAJ52237.1| hypothetical protein [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|147785389|emb|CAN68677.1| hypothetical protein VITISV_041940 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224120796|ref|XP_002318419.1| predicted protein [Populus trichocarpa] gi|222859092|gb|EEE96639.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|316996536|dbj|BAJ52227.1| hypothetical protein [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|125995264|dbj|BAF47180.1| MdSFBB3-beta [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query382
TAIR|locus:2082410427 AT3G06240 "AT3G06240" [Arabido 0.641 0.573 0.285 7.7e-21
TAIR|locus:2076196364 AT3G23880 "AT3G23880" [Arabido 0.882 0.925 0.238 4.5e-17
TAIR|locus:2135615413 CPR1 "AT4G12560" [Arabidopsis 0.719 0.665 0.259 1.8e-12
TAIR|locus:2088985386 AT3G17280 "AT3G17280" [Arabido 0.604 0.598 0.252 3.3e-12
TAIR|locus:2152064392 AT5G65850 "AT5G65850" [Arabido 0.871 0.849 0.259 6e-12
TAIR|locus:2135079378 AT4G04690 "AT4G04690" [Arabido 0.701 0.708 0.255 1.5e-11
TAIR|locus:2018017383 AT1G62270 "AT1G62270" [Arabido 0.717 0.715 0.242 2.1e-11
TAIR|locus:2041016420 AT2G43260 [Arabidopsis thalian 0.696 0.633 0.240 2.7e-11
TAIR|locus:2058136401 AT2G43440 "AT2G43440" [Arabido 0.534 0.508 0.275 4.5e-11
TAIR|locus:2076309389 AT3G10240 "AT3G10240" [Arabido 0.688 0.676 0.262 4.8e-11
TAIR|locus:2082410 AT3G06240 "AT3G06240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 7.7e-21, Sum P(2) = 7.7e-21
 Identities = 78/273 (28%), Positives = 124/273 (45%)

Query:   102 KIVGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPT---PSLTESRLKTFWMVSLGFGF 158
             +IVGS NGL+C  +S   G  F L+NP T + K LP    P   E     F   + GFGF
Sbjct:   164 EIVGSSNGLVC--ISPGEGAVF-LYNPTTGDSKRLPENFRPKSVEYERDNFQ--TYGFGF 218

Query:   159 NQDTNDYVLVRIVNFQARYDAI-AEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLH 217
             +  T+DY LV++V      D + A VYS     W+ +               V   G +H
Sbjct:   219 DGLTDDYKLVKLV--ATSEDILDASVYSLKADSWRRICNLNYEHNDGSYTSGVHFNGAIH 276

Query:   218 WIANGIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQ-SL--ALAVYPGLG 274
             W+        N++ VV++D+  E F    +P+   DC  +  ++   SL   L V     
Sbjct:   277 WVFTESRH--NQRVVVAFDIQTEEFREMPVPDEAEDCSHRFSNFVVGSLNGRLCVV---- 330

Query:   275 FRSRLSNRFELWVMNE---GKGWTRTFNTAFERIAWPVGSFRDSKIIMKSVD-QFFLFNP 330
               S      ++WVM+E    K W+R       R   P+ S ++ + ++  +D    L+N 
Sbjct:   331 -NSCYDVHDDIWVMSEYGEAKSWSRIRINLLYRSMKPLCSTKNDEEVLLELDGDLVLYNF 389

Query:   331 KTKRNFILPIDSGMGYS--YKVFTYVDSIVAVN 361
             +T  +  L I  G+  S  ++  TYV+S+++ N
Sbjct:   390 ETNASSNLGI-CGVKLSDGFEANTYVESLISPN 421


GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2076196 AT3G23880 "AT3G23880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135615 CPR1 "AT4G12560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088985 AT3G17280 "AT3G17280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152064 AT5G65850 "AT5G65850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135079 AT4G04690 "AT4G04690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018017 AT1G62270 "AT1G62270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041016 AT2G43260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058136 AT2G43440 "AT2G43440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076309 AT3G10240 "AT3G10240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query382
TIGR01640230 TIGR01640, F_box_assoc_1, F-box protein interactio 5e-16
pfam0064648 pfam00646, F-box, F-box domain 9e-06
smart0025641 smart00256, FBOX, A Receptor for Ubiquitination Ta 2e-05
>gnl|CDD|233502 TIGR01640, F_box_assoc_1, F-box protein interaction domain Back     alignment and domain information
 Score = 76.2 bits (188), Expect = 5e-16
 Identities = 47/202 (23%), Positives = 89/202 (44%), Gaps = 24/202 (11%)

Query: 104 VGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTN 163
           V  C+GL+C           V+WNP+T + + LPTP    S  ++    +   G++    
Sbjct: 1   VVPCDGLICFSYGKRL----VVWNPSTGQSRWLPTPKSRRSNKES---DTYFLGYDPIEK 53

Query: 164 DYVLVRIVNFQARYDAIA-EVYSTSTGKWKEVAAGTGSCVIYGGQ-DAVAVKGVLHWIAN 221
            Y ++   +     +    +VY+  +  W+ +     S   +  +   V + GVL+++A 
Sbjct: 54  QYKVLCFSDRSGNRNQSEHQVYTLGSNSWRTI---ECSPPHHPLKSRGVCINGVLYYLAY 110

Query: 222 GIGVLVNEKFVVSYDMNLELFWRTAMPELPTDCYVKALSYDQSLALAVYPG-LG--FRSR 278
            +    +  F+VS+D++ E F       +P  C          L+L  Y G L    + +
Sbjct: 111 TLKTNPDY-FIVSFDVSSERF----KEFIPLPC--GNSDSVDYLSLINYKGKLAVLKQKK 163

Query: 279 LSNRFELWVMNEGKG--WTRTF 298
            +N F+LWV+N+     W++ F
Sbjct: 164 DTNNFDLWVLNDAGKQEWSKLF 185


This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain. Length = 230

>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information
>gnl|CDD|197608 smart00256, FBOX, A Receptor for Ubiquitination Targets Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 382
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 100.0
PF07734164 FBA_1: F-box associated; InterPro: IPR006527 This 99.66
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 99.64
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.61
PHA02713557 hypothetical protein; Provisional 99.58
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.53
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 99.51
PHA02713557 hypothetical protein; Provisional 99.5
PHA03098534 kelch-like protein; Provisional 99.44
PHA02790480 Kelch-like protein; Provisional 99.41
PLN02153341 epithiospecifier protein 99.28
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.25
PHA03098534 kelch-like protein; Provisional 99.21
PLN02193470 nitrile-specifier protein 99.15
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.15
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.14
PHA02790480 Kelch-like protein; Provisional 99.12
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.97
PLN02153341 epithiospecifier protein 98.96
PLN02193470 nitrile-specifier protein 98.94
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 98.83
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.82
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 98.78
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.77
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 98.73
KOG4693392 consensus Uncharacterized conserved protein, conta 98.41
KOG4693392 consensus Uncharacterized conserved protein, conta 98.41
KOG1230 521 consensus Protein containing repeated kelch motifs 98.18
KOG0379 482 consensus Kelch repeat-containing proteins [Genera 97.64
KOG0281499 consensus Beta-TrCP (transducin repeats containing 97.6
KOG0379482 consensus Kelch repeat-containing proteins [Genera 97.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.48
KOG1230 521 consensus Protein containing repeated kelch motifs 97.29
PF1396450 Kelch_6: Kelch motif 97.03
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 96.58
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.51
KOG2997366 consensus F-box protein FBX9 [General function pre 96.45
COG3055381 Uncharacterized protein conserved in bacteria [Fun 95.76
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 95.72
smart00284255 OLF Olfactomedin-like domains. 95.69
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 95.49
PF07762131 DUF1618: Protein of unknown function (DUF1618); In 94.8
PF1396450 Kelch_6: Kelch motif 94.6
KOG4152 830 consensus Host cell transcription factor HCFC1 [Ce 94.56
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 94.35
KOG2055514 consensus WD40 repeat protein [General function pr 94.32
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 94.3
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 94.3
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 93.86
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.73
COG4946 668 Uncharacterized protein related to the periplasmic 93.22
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 92.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 92.94
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.94
smart0061247 Kelch Kelch domain. 92.8
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 92.12
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 92.09
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 92.03
smart0061247 Kelch Kelch domain. 91.99
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.72
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 91.61
KOG4341483 consensus F-box protein containing LRR [General fu 90.53
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 90.43
PF1341549 Kelch_3: Galactose oxidase, central domain 89.67
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 89.33
KOG3545249 consensus Olfactomedin and related extracellular m 89.22
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 88.95
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 88.52
PLN02772 398 guanylate kinase 88.47
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 88.41
PRK04043419 tolB translocation protein TolB; Provisional 87.51
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 87.01
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 86.63
TIGR03300 377 assembly_YfgL outer membrane assembly lipoprotein 85.89
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 85.65
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 85.25
PRK11028330 6-phosphogluconolactonase; Provisional 84.74
COG1520 370 FOG: WD40-like repeat [Function unknown] 84.55
KOG2437 723 consensus Muskelin [Signal transduction mechanisms 84.21
KOG0310 487 consensus Conserved WD40 repeat-containing protein 83.58
cd01207111 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. 83.47
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 81.88
PF1341549 Kelch_3: Galactose oxidase, central domain 81.79
cd01206111 Homer Homer type EVH1 domain. Homer type EVH1 doma 80.91
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 80.36
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
Probab=100.00  E-value=7.8e-33  Score=243.37  Aligned_cols=214  Identities=24%  Similarity=0.484  Sum_probs=163.0

Q ss_pred             eeccCceEEEeeCCCCceeEEEEcccccceeccCCCCCccccccceeEEEEEEEeeCCCCCeEEEEEEeecC-CCCCEEE
Q 045675          104 VGSCNGLLCLDVSSAFGMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNFQA-RYDAIAE  182 (382)
Q Consensus       104 ~~s~~Gll~~~~~~~~~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~~g~d~~~~~ykvv~~~~~~~-~~~~~~~  182 (382)
                      ++|||||||+...    ..++||||+||+++.||+++.....  ... ..++||||+.+++||||++..... .....++
T Consensus         1 ~~sCnGLlc~~~~----~~~~V~NP~T~~~~~LP~~~~~~~~--~~~-~~~~~G~d~~~~~YKVv~~~~~~~~~~~~~~~   73 (230)
T TIGR01640         1 VVPCDGLICFSYG----KRLVVWNPSTGQSRWLPTPKSRRSN--KES-DTYFLGYDPIEKQYKVLCFSDRSGNRNQSEHQ   73 (230)
T ss_pred             CcccceEEEEecC----CcEEEECCCCCCEEecCCCCCcccc--ccc-ceEEEeecccCCcEEEEEEEeecCCCCCccEE
Confidence            4799999998765    3799999999999999977642111  111 257999999999999999987421 2346899


Q ss_pred             EEECCCCCeeeecCCCCeeEEeCCcceEEECceEEEEeecccccccccEEEEEECCCceee-EeCCCCCCCC--CeeeEE
Q 045675          183 VYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFW-RTAMPELPTD--CYVKAL  259 (382)
Q Consensus       183 vyss~t~~W~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~~~~~~~i~~fD~~~~~~~-~i~~P~~~~~--~~~~l~  259 (382)
                      ||++++++||.++..+..... . +.+|++||.+||+....... ....|++||+.+|+|+ .+++|.....  ....|+
T Consensus        74 Vys~~~~~Wr~~~~~~~~~~~-~-~~~v~~~G~lyw~~~~~~~~-~~~~IvsFDl~~E~f~~~i~~P~~~~~~~~~~~L~  150 (230)
T TIGR01640        74 VYTLGSNSWRTIECSPPHHPL-K-SRGVCINGVLYYLAYTLKTN-PDYFIVSFDVSSERFKEFIPLPCGNSDSVDYLSLI  150 (230)
T ss_pred             EEEeCCCCccccccCCCCccc-c-CCeEEECCEEEEEEEECCCC-CcEEEEEEEcccceEeeeeecCccccccccceEEE
Confidence            999999999998854332222 2 35999999999999764221 1138999999999999 5898876432  356799


Q ss_pred             EeCCeEEEEEecCCCccCCCCCeEEEEEECCCCC--eeEEEEeecCCc------ccceEEeeCCcEEEEEcC---e-EEE
Q 045675          260 SYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKG--WTRTFNTAFERI------AWPVGSFRDSKIIMKSVD---Q-FFL  327 (382)
Q Consensus       260 ~~~g~L~~~~~~~~~~~~~~~~~~~iW~l~~~~~--W~~~~~i~~~~~------~~~~~~~~~g~l~l~~~~---~-~~~  327 (382)
                      +++|+||++...  .    ....++||+|++++.  |+++++|++...      ..|+++.++|+|++...+   . ++.
T Consensus       151 ~~~G~L~~v~~~--~----~~~~~~IWvl~d~~~~~W~k~~~i~~~~~~~~~~~~~~~~~~~~g~I~~~~~~~~~~~~~~  224 (230)
T TIGR01640       151 NYKGKLAVLKQK--K----DTNNFDLWVLNDAGKQEWSKLFTVPIPPLPDLVDDNFLSGFTDKGEIVLCCEDENPFYIFY  224 (230)
T ss_pred             EECCEEEEEEec--C----CCCcEEEEEECCCCCCceeEEEEEcCcchhhhhhheeEeEEeeCCEEEEEeCCCCceEEEE
Confidence            999999999986  3    235699999998743  999999975322      347888889998888774   3 999


Q ss_pred             EeCCCC
Q 045675          328 FNPKTK  333 (382)
Q Consensus       328 yd~~t~  333 (382)
                      ||++++
T Consensus       225 y~~~~~  230 (230)
T TIGR01640       225 YNVGEN  230 (230)
T ss_pred             EeccCC
Confidence            999875



This model describes a large family of plant domains, with several hundred members in Arabidopsis thaliana. Most examples are found C-terminal to an F-box (pfam00646), a 60 amino acid motif involved in ubiquitination of target proteins to mark them for degradation. Two-hybid experiments support the idea that most members are interchangeable F-box subunits of SCF E3 complexes. Some members have two copies of this domain.

>PF07734 FBA_1: F-box associated; InterPro: IPR006527 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07762 DUF1618: Protein of unknown function (DUF1618); InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>KOG3545 consensus Olfactomedin and related extracellular matrix glycoproteins [Extracellular structures] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG2437 consensus Muskelin [Signal transduction mechanisms] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>cd01206 Homer Homer type EVH1 domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.54
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.53
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.53
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.53
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 99.53
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.49
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.49
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 99.46
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 99.46
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 99.45
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 99.44
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 99.4
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.37
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.18
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.18
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.14
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 99.08
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.97
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.85
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.83
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.71
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 98.64
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.54
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.01
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.61
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.02
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.61
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.58
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.24
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.1
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.82
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 95.72
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.47
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 95.35
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 95.2
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 95.08
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 95.02
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 94.88
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 94.84
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.82
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.63
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 94.5
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 94.41
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 94.2
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 93.8
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 93.73
3v65_B386 Low-density lipoprotein receptor-related protein; 93.69
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.64
3jrp_A379 Fusion protein of protein transport protein SEC13 93.63
3jro_A 753 Fusion protein of protein transport protein SEC13 93.46
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.4
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 93.36
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.28
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 93.18
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.14
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 93.12
3v65_B386 Low-density lipoprotein receptor-related protein; 92.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.87
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 92.75
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.71
3p5b_L400 Low density lipoprotein receptor variant; B-propel 92.48
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 92.44
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 92.43
3jrp_A379 Fusion protein of protein transport protein SEC13 92.34
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 92.31
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 92.26
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.14
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 92.0
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 91.92
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 91.78
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 91.69
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 91.62
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 91.6
4e54_B435 DNA damage-binding protein 2; beta barrel, double 91.39
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 91.33
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 91.31
4g56_B357 MGC81050 protein; protein arginine methyltransfera 91.26
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 90.74
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 90.74
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 90.39
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.36
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 90.09
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 89.78
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 89.61
4g56_B357 MGC81050 protein; protein arginine methyltransfera 89.45
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 89.45
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 89.19
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 89.08
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 88.99
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 88.74
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 88.7
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 87.62
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 87.5
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 87.16
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 86.67
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 86.6
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 86.16
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 86.1
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 85.89
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 85.86
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 85.79
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 85.58
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 85.22
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.49
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 84.43
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 84.32
2p4o_A 306 Hypothetical protein; putative lactonase, structur 84.29
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 84.09
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 84.05
4e54_B435 DNA damage-binding protein 2; beta barrel, double 83.99
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 83.91
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 83.26
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 83.04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 83.02
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 82.8
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 82.65
3v9f_A 781 Two-component system sensor histidine kinase/RESP 82.23
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 81.84
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 81.51
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 81.36
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 81.3
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 81.13
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 81.03
2fp8_A322 Strictosidine synthase; six bladed beta propeller 80.92
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 80.77
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
Probab=99.54  E-value=1.9e-12  Score=117.97  Aligned_cols=214  Identities=13%  Similarity=0.031  Sum_probs=142.7

Q ss_pred             eeccCceEEEeeCC-----C--C--ceeEEEEcccccceeccCCCCCccccccceeEEEEEEEeeCCCCCeEEEEEEee-
Q 045675          104 VGSCNGLLCLDVSS-----A--F--GMAFVLWNPATNEFKGLPTPSLTESRLKTFWMVSLGFGFNQDTNDYVLVRIVNF-  173 (382)
Q Consensus       104 ~~s~~Gll~~~~~~-----~--~--~~~~~V~NP~T~~~~~LP~~~~~~~~~~~~~~~~~~~g~d~~~~~ykvv~~~~~-  173 (382)
                      ....+|.|++..+.     .  .  ...++++||.|++|..+|++|..+..        ++....  .+...|++.... 
T Consensus        41 ~~~~~~~iyv~GG~~~~~~~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~--------~~~~~~--~~~lyv~GG~~~~  110 (315)
T 4asc_A           41 LVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCL--------FGLGEA--LNSIYVVGGREIK  110 (315)
T ss_dssp             EECTTCCEEEEEEEEECSSCSSSCEEEEEEEEETTTTEEEECCCBSSCEES--------CEEEEE--TTEEEEECCEESS
T ss_pred             EEEECCEEEEEcCcccCCCCCccccccceEEecCCCCeEEECCCCCcchhc--------eeEEEE--CCEEEEEeCCcCC
Confidence            44457777655441     1  0  23489999999999999988764321        111111  233333333221 


Q ss_pred             -cCCCCCEEEEEECCCCCeeeecCCCCeeEEeCCcceEEECceEEEEeecccccccccEEEEEECCCceeeEe-CCCCCC
Q 045675          174 -QARYDAIAEVYSTSTGKWKEVAAGTGSCVIYGGQDAVAVKGVLHWIANGIGVLVNEKFVVSYDMNLELFWRT-AMPELP  251 (382)
Q Consensus       174 -~~~~~~~~~vyss~t~~W~~~~~~~~~~~~~~~~~~v~~~G~lywl~~~~~~~~~~~~i~~fD~~~~~~~~i-~~P~~~  251 (382)
                       .......+++|+..+++|+.++.++.++..   +.++.++|++|.+++..........+.+||+.+++|+.+ ++|..+
T Consensus       111 ~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~---~~~~~~~~~iyv~GG~~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r  187 (315)
T 4asc_A          111 DGERCLDSVMCYDRLSFKWGESDPLPYVVYG---HTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEWKELAPMQTAR  187 (315)
T ss_dssp             TTCCBCCCEEEEETTTTEEEECCCCSSCCBS---CEEEEETTEEEEECCBCTTSCBCCCEEEEETTTTEEEECCCCSSCC
T ss_pred             CCCcccceEEEECCCCCcEeECCCCCCcccc---eeEEEECCEEEEEeCCCCCCcccceEEEEeCCCCeEEECCCCCCch
Confidence             122345899999999999999887655443   678889999999998733323456899999999999998 566554


Q ss_pred             CCCeeeEEEeCCeEEEEEecCCCccCCCCCeEEEEEECCCCC-eeEEEEeecCCcccceEEeeCCcEEEEEc--------
Q 045675          252 TDCYVKALSYDQSLALAVYPGLGFRSRLSNRFELWVMNEGKG-WTRTFNTAFERIAWPVGSFRDSKIIMKSV--------  322 (382)
Q Consensus       252 ~~~~~~l~~~~g~L~~~~~~~~~~~~~~~~~~~iW~l~~~~~-W~~~~~i~~~~~~~~~~~~~~g~l~l~~~--------  322 (382)
                        .....+..+|+|++++..  ..   ....-.+|.++-... |+.+..++.........+ -++.|++...        
T Consensus       188 --~~~~~~~~~~~iyv~GG~--~~---~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~-~~~~l~v~GG~~~~~~~~  259 (315)
T 4asc_A          188 --SLFGATVHDGRIIVAAGV--TD---TGLTSSAEVYSITDNKWAPFEAFPQERSSLSLVS-LVGTLYAIGGFATLETES  259 (315)
T ss_dssp             --BSCEEEEETTEEEEEEEE--CS---SSEEEEEEEEETTTTEEEEECCCSSCCBSCEEEE-ETTEEEEEEEEEEEECTT
T ss_pred             --hceEEEEECCEEEEEecc--CC---CCccceEEEEECCCCeEEECCCCCCcccceeEEE-ECCEEEEECCccccCcCC
Confidence              456677889999999987  31   122346777765534 999876654443333333 3566766543        


Q ss_pred             --------CeEEEEeCCCCcEEEE
Q 045675          323 --------DQFFLFNPKTKRNFIL  338 (382)
Q Consensus       323 --------~~~~~yd~~t~~~~~v  338 (382)
                              +.+..||+++++|+.+
T Consensus       260 ~~~~~~~~~~v~~yd~~~~~W~~~  283 (315)
T 4asc_A          260 GELVPTELNDIWRYNEEEKKWEGV  283 (315)
T ss_dssp             SCEEEEEEEEEEEEETTTTEEEEE
T ss_pred             ccccccccCcEEEecCCCChhhhh
Confidence                    1588999999999999



>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 382
d1fs1a141 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ 1e-04
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 37.0 bits (86), Expect = 1e-04
 Identities = 8/39 (20%), Positives = 15/39 (38%)

Query: 10 SSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEF 48
           S+P  ++  I   L +  +++   V K W  L      
Sbjct: 2  DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL 40


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query382
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.98
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 98.92
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.7
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.53
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.53
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 98.48
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.3
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.05
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.89
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 91.75
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 91.27
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 88.72
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 87.96
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 87.87
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 87.57
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 86.7
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 86.27
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 85.63
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 82.51
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 82.21
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: Skp2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.29  E-value=1e-12  Score=78.73  Aligned_cols=40  Identities=20%  Similarity=0.360  Sum_probs=37.5

Q ss_pred             CCCCCHHHHHHHHhcCChhhhhhhhccchhhHhhcCCHHH
Q 045675            9 VSSVPLVIITDILLQLPIKSIVRFKCVSKSWLLLIKSSEF   48 (382)
Q Consensus         9 ~~~LP~dll~~IL~rLp~~sl~r~r~VcK~W~~li~sp~F   48 (382)
                      +..||+|++.+||++||++++.|+++|||+|+.+++++.+
T Consensus         1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~~~~l   40 (41)
T d1fs1a1           1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESL   40 (41)
T ss_dssp             CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHTCGGG
T ss_pred             CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCccc
Confidence            4689999999999999999999999999999999998864



>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure