Citrus Sinensis ID: 045687


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MNLAEFLTEPPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSKANIVKNEAHPSKNQKPNKKFFKNKKTTFKKKKGNCYVCGKPGHFANKCRYRKGDHKPPKANLVDGEDIIVAVVVTQENMVAAKGKKNG
ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccEEEEEEEEEccEEccccccc
ccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHEEEHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEEccEEEEEEEEEEEEcccccccccc
mnlaefltepppdsdseNYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDagaqnfkmaedkevtsQIHGFHMLINDlkneniilpesfmTIDQLEKAKEITSkanivkneahpsknqkpnkkffknkkttfkkkkgncyvcgkpghfankcryrkgdhkppkanlvdgeDIIVAVVVTQENMVAAKGKKNG
mnlaefltepppdsdseNYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSKanivkneahpsknqkpnkkffknkkttfkkkkgncyvcgkpghfANKCRYRKGDhkppkanlvdgeDIIVAVVVTQEnmvaakgkkng
MNLAEFLTEPPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSKANIVKNEAHPSknqkpnkkffknkkttfkkkkGNCYVCGKPGHFANKCRYRKGDHKPPKANLVDGEDIIVAVVVTQENMVAAKGKKNG
******************YEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQL************************************FKKKKGNCYVCGKPGHFANKCRYRKG*****KANLVDGEDIIVAVVVTQE***********
*NLAEFLTEP**********VLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFH******************************************************************CYVCGKPGHFAN*********************IIVAVVVTQENMV*AK*****
***************SENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSKANIVKNEAHPSKNQKPNKKFFKNKKTTFKKKKGNCYVCGKPGHFANKCRYRKGDHKPPKANLVDGEDIIVAVVVTQENMVAAKGKKNG
MNLAEFLTEPPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSK******************************KKGNCYVCGKPGHFANKCRYRKGDHKPPKANLVDGEDIIVAVVVTQENMVA*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLAEFLTEPPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNFKMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTIDQLEKAKEITSKANIVKNEAHPSKNQKPNKKFFKNKKTTFKKKKGNCYVCGKPGHFANKCRYRKGDHKPPKANLVDGEDIIVAVVVTQENMVAAKGKKNG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
38194910 1290 gag-pol polyprotein [Phaseolus vulgaris] 0.943 0.155 0.380 1e-32
147781792 1096 hypothetical protein VITISV_036207 [Viti 0.636 0.123 0.391 6e-25
147838590 1046 hypothetical protein VITISV_025642 [Viti 0.867 0.175 0.346 4e-24
147805294 565 hypothetical protein VITISV_006704 [Viti 0.603 0.226 0.457 2e-23
147800584 1209 hypothetical protein VITISV_002698 [Viti 0.820 0.143 0.348 6e-20
147767180 1234 hypothetical protein VITISV_013138 [Viti 0.825 0.141 0.298 1e-18
147804859 1473 hypothetical protein VITISV_021427 [Viti 0.825 0.118 0.298 2e-18
147857754 804 hypothetical protein VITISV_032507 [Viti 0.825 0.217 0.298 5e-18
359493505 1182 PREDICTED: wall-associated receptor kina 0.825 0.148 0.306 6e-18
147782562 791 hypothetical protein VITISV_025981 [Viti 0.811 0.217 0.306 6e-18
>gi|38194910|gb|AAR13298.1| gag-pol polyprotein [Phaseolus vulgaris] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 139/263 (52%), Gaps = 63/263 (23%)

Query: 2   NLAEFLTEPPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQ 61
            +A  LT   PDS +   +V   +WI ANKVCR T+LS LSN+L+DVY+ +K A +IW  
Sbjct: 59  GVAHALTTAKPDSTTAAKQV--DDWIHANKVCRHTLLSVLSNDLFDVYASYKNAKDIWDS 116

Query: 62  LRKKYIIEDAGAQNF--------KMAEDKEVTSQIHGFHMLINDLKNENIILPESFMTID 113
           L  KY  ED   Q F        +M + K++  QI+ +H LI D+K E+I LP+ F++  
Sbjct: 117 LILKYTAEDIVRQRFVIAKYYRWEMIKGKDIKIQINEYHKLIEDIKTESIKLPDEFVSEL 176

Query: 114 QLEKAKE---------------------IT---------------------SKANIVKNE 131
            +EK  +                     IT                     +KAN+++++
Sbjct: 177 LIEKLPQSWTDYKQQLKHRQKQMSLSDLITHIIIEDTNRKECAAAKAKALSAKANVIEDK 236

Query: 132 AHPSK-------NQKPNKKFFKNKKT--TFKKKKGNCYVCGKPGHFANKCRYRKGDHKPP 182
             P +        +KPN KF +   T  TF KKKGNC+VCGKPGH A +CR+R  +  PP
Sbjct: 237 PAPKRYEKKFDHKKKPNNKFSRPSGTNPTF-KKKGNCFVCGKPGHHAPQCRHRAKNDYPP 295

Query: 183 KANLVDGEDIIVAVVVTQENMVA 205
           KANL +GED IVA VV+Q N+V 
Sbjct: 296 KANLAEGEDTIVA-VVSQVNLVT 317




Source: Phaseolus vulgaris

Species: Phaseolus vulgaris

Genus: Phaseolus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147781792|emb|CAN72171.1| hypothetical protein VITISV_036207 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147838590|emb|CAN76580.1| hypothetical protein VITISV_025642 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147805294|emb|CAN78262.1| hypothetical protein VITISV_006704 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147800584|emb|CAN72993.1| hypothetical protein VITISV_002698 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767180|emb|CAN66959.1| hypothetical protein VITISV_013138 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147804859|emb|CAN66873.1| hypothetical protein VITISV_021427 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147857754|emb|CAN78666.1| hypothetical protein VITISV_032507 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493505|ref|XP_002263348.2| PREDICTED: wall-associated receptor kinase 2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147782562|emb|CAN68340.1| hypothetical protein VITISV_025981 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
TAIR|locus:2134618488 AT4G00980 [Arabidopsis thalian 0.405 0.176 0.242 6.7e-06
TAIR|locus:2134618 AT4G00980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 6.7e-06, Sum P(2) = 6.7e-06
 Identities = 23/95 (24%), Positives = 54/95 (56%)

Query:    24 QNWIKANKVCRSTILSTLSNELYDVYSQH-KFAYEIWAQLRKKYIIEDAGAQN------- 75
             + W++ + +C + ++++LS+ LY  YSQ  K A E+W +L+  Y  +++ ++        
Sbjct:   251 KKWLRDDYLCYTHLMNSLSDHLYRRYSQKFKHAKELWDELKWVYQCDESKSKRSQVRKYI 310

Query:    76 -FKMAEDKEVTSQIHGFHMLINDLKNENIILPESF 109
              F+M E++ +  Q+  F+ + + + +  + L E+F
Sbjct:   311 EFRMVEERPILEQVQVFNKIADSIVSAGMFLDEAF 345


GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
pfam14227115 pfam14227, UBN2_2, gag-polypeptide of LTR copia-ty 1e-05
smart0034317 smart00343, ZnF_C2HC, zinc finger 7e-04
pfam0009818 pfam00098, zf-CCHC, Zinc knuckle 0.001
>gnl|CDD|222609 pfam14227, UBN2_2, gag-polypeptide of LTR copia-type Back     alignment and domain information
 Score = 43.0 bits (102), Expect = 1e-05
 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 8/66 (12%)

Query: 52  HKFAYEIWAQLRKKYIIEDAGAQ--------NFKMAEDKEVTSQIHGFHMLINDLKNENI 103
            K A E+W +L K Y+ +    +          KM+E K V   +  F+ L+N+L++  +
Sbjct: 1   EKTAKELWDKLEKLYMTKSLTNKLYLKKKLYTLKMSEGKSVEEHLDEFNKLVNELESLGV 60

Query: 104 ILPESF 109
            + +  
Sbjct: 61  KIDDED 66


This family is found in Plants and fungi, and contains LTR-polyproteins, or retrotransposons of the copia-type. Length = 115

>gnl|CDD|197667 smart00343, ZnF_C2HC, zinc finger Back     alignment and domain information
>gnl|CDD|189387 pfam00098, zf-CCHC, Zinc knuckle Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
PF14244152 UBN2_3: gag-polypeptide of LTR copia-type 99.57
PF14227119 UBN2_2: gag-polypeptide of LTR copia-type 98.97
PF14223119 UBN2: gag-polypeptide of LTR copia-type 98.92
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.67
PF1369632 zf-CCHC_2: Zinc knuckle 97.88
smart0034326 ZnF_C2HC zinc finger. 96.95
PF1391742 zf-CCHC_3: Zinc knuckle 96.87
PF1528840 zf-CCHC_6: Zinc knuckle 96.6
PF1439249 zf-CCHC_4: Zinc knuckle 96.49
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 96.43
COG5082190 AIR1 Arginine methyltransferase-interacting protei 95.81
COG5082190 AIR1 Arginine methyltransferase-interacting protei 95.55
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 95.29
PTZ00368148 universal minicircle sequence binding protein (UMS 95.26
COG5222 427 Uncharacterized conserved protein, contains RING Z 94.53
PF03564145 DUF1759: Protein of unknown function (DUF1759); In 92.73
PTZ00368148 universal minicircle sequence binding protein (UMS 91.72
KOG4400261 consensus E3 ubiquitin ligase interacting with arg 91.46
KOG2560 529 consensus RNA splicing factor - Slu7p [RNA process 87.95
PF12353128 eIF3g: Eukaryotic translation initiation factor 3 85.78
KOG2044 931 consensus 5'-3' exonuclease HKE1/RAT1 [Replication 84.03
PF0373296 Retrotrans_gag: Retrotransposon gag protein ; Inte 83.61
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 83.54
KOG0119 554 consensus Splicing factor 1/branch point binding p 83.5
COG5179968 TAF1 Transcription initiation factor TFIID, subuni 81.57
>PF14244 UBN2_3: gag-polypeptide of LTR copia-type Back     alignment and domain information
Probab=99.57  E-value=7.2e-15  Score=111.03  Aligned_cols=95  Identities=19%  Similarity=0.348  Sum_probs=77.2

Q ss_pred             cccccc-CCCCCCCcchHHHHHHHHHHHHHHHHHHHhhccHHHHHhhcccccHHHHHHHHHHHHhhcccccccc------
Q 045687            4 AEFLTE-PPPDSDSENYEVLLQNWIKANKVCRSTILSTLSNELYDVYSQHKFAYEIWAQLRKKYIIEDAGAQNF------   76 (212)
Q Consensus         4 ~~vl~e-~~P~~~~~~~~~~~~~W~~~d~~a~~~I~~sl~~~i~~~i~~~~tA~~lW~~L~~~y~~~~~~~~~~------   76 (212)
                      +||.++ ++|.+.++    +++.|.+.|.++++||+++|+++++..|..++||+++|++|+++|+..++..+.+      
T Consensus        36 ~~i~g~~~~P~~~~~----~~~~W~~~d~~v~swl~~sis~~i~~~i~~~~tak~~W~~L~~~f~~~~~~~r~~~L~~~l  111 (152)
T PF14244_consen   36 GFIDGTIPKPPETDP----AYEKWERKDQLVLSWLLNSISPDILSTIIFCETAKEIWDALKERFSQKSNASRVFQLRNEL  111 (152)
T ss_pred             ccccCccccccccch----hhhhHHHhhhHHHHHHHHhhcHHHHhhhHhhhhHHHHHHHHHHHhhcccHHHHHHHHHHHH
Confidence            344443 45544444    7999999999999999999999999999999999999999999999777455521      


Q ss_pred             --eecCCccHHHHHHHHHHHH--HHHHhCC
Q 045687           77 --KMAEDKEVTSQIHGFHMLI--NDLKNEN  102 (212)
Q Consensus        77 --~~~~~~sv~~~i~~~~~l~--~~L~~~~  102 (212)
                        ..+++++|.+|+.+|+.|+  .+|....
T Consensus       112 ~~~kq~~~sv~ey~~~lk~l~~~~el~~~~  141 (152)
T PF14244_consen  112 HSLKQGDKSVTEYFNKLKSLWQEDELDEYR  141 (152)
T ss_pred             HHHhhCCCcHHHHHHHHHHHhHHHHHhCcC
Confidence              1278999999999999999  5565543



>PF14227 UBN2_2: gag-polypeptide of LTR copia-type Back     alignment and domain information
>PF14223 UBN2: gag-polypeptide of LTR copia-type Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF03564 DUF1759: Protein of unknown function (DUF1759); InterPro: IPR005312 This is a small family of proteins of unknown function Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2560 consensus RNA splicing factor - Slu7p [RNA processing and modification] Back     alignment and domain information
>PF12353 eIF3g: Eukaryotic translation initiation factor 3 subunit G ; InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes Back     alignment and domain information
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification] Back     alignment and domain information
>PF03732 Retrotrans_gag: Retrotransposon gag protein ; InterPro: IPR005162 Transposable elements (TEs) promote various chromosomal rearrangements more efficiently, and often more specifically, than other cellular processes Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5179 TAF1 Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 6e-05
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 2e-04
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 2e-04
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 6e-04
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 8e-04
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 9e-04
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 Back     alignment and structure
 Score = 38.8 bits (90), Expect = 6e-05
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 157 GNCYVCGKPGHFANKCRYRKGDHKPPKA 184
           G+C+ CGK GHFA  C     ++  PK 
Sbjct: 2   GSCFKCGKKGHFAKNCHEHAHNNAEPKV 29


>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Length = 37 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.77
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.74
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 98.55
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.46
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 97.92
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 97.5
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 97.49
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 97.47
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 97.45
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 97.4
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 97.38
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 97.37
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 97.36
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 97.34
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 97.34
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 97.3
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 97.23
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 97.23
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 97.15
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 97.04
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 97.01
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 97.01
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 96.75
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 96.55
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 96.5
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 96.19
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 95.16
2hqh_E26 Restin; beta/BETA structure, zinc finger motif, st 91.82
3alr_A106 Nanos protein; zinc-finger, translational repressi 81.09
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
Probab=98.77  E-value=9.2e-09  Score=62.89  Aligned_cols=26  Identities=23%  Similarity=0.698  Sum_probs=22.2

Q ss_pred             CCcceeecCCCccccccCcCccCCCC
Q 045687          155 KKGNCYVCGKPGHFANKCRYRKGDHK  180 (212)
Q Consensus       155 ~~~~C~~Cgk~GH~~~~C~~~~~~~k  180 (212)
                      ....||+||+.|||+++||++..+..
T Consensus        22 ~~~~C~~Cge~GH~ardCp~~~~~~~   47 (56)
T 1u6p_A           22 DRDQCAYCKEKGHWAKDCPKKPRGPR   47 (56)
T ss_dssp             CTTBCSSSCCBSSCGGGCTTCCCSSC
T ss_pred             CCCcceeCCCCCcccccCcCCccccC
Confidence            34789999999999999999887544



>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hqh_E Restin; beta/BETA structure, zinc finger motif, structural protein, binding; 1.80A {Homo sapiens} Back     alignment and structure
>3alr_A Nanos protein; zinc-finger, translational repression, RNA, 3'-UTR, metal BI protein; 2.10A {Danio rerio} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.84
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 98.4
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 98.33
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 97.89
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 97.8
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 95.2
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 94.63
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
class: Small proteins
fold: Retrovirus zinc finger-like domains
superfamily: Retrovirus zinc finger-like domains
family: Retrovirus zinc finger-like domains
domain: HIV nucleocapsid
species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=98.84  E-value=3.9e-10  Score=55.95  Aligned_cols=23  Identities=43%  Similarity=0.873  Sum_probs=20.7

Q ss_pred             CCcceeecCCCccccccCcCccC
Q 045687          155 KKGNCYVCGKPGHFANKCRYRKG  177 (212)
Q Consensus       155 ~~~~C~~Cgk~GH~~~~C~~~~~  177 (212)
                      ..++||+|||.||++++|..+.+
T Consensus         5 ~~ikCfNCGkeGH~ar~CrAPRk   27 (29)
T d1nc8a_           5 KVIRCWNCGKEGHSARQCRAPRR   27 (29)
T ss_dssp             CCCBCTTTSCBSSCGGGCCSSSS
T ss_pred             ceeEeecCCccchhhhhccCccc
Confidence            46889999999999999998876



>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure