Citrus Sinensis ID: 045822

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-

MLKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKVLSLSSNNIVGEIPLGHGKFSSLIQLILTNNELSRQLSPELGSLIMAIPDLNQDHLE

cccEEEccccccEEcccHHHHccccccEEEccccccEEcccHHHHccccccEEEcccccccccccHHHHccccccEEEccccEEEEcccccccccccccEEEcccccccccccccccccHHccccccccEEEccccccEEEcccccccccccccEEccccccEEEccHHHHccccccEEEccccccEEcccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHcccccEEcccccccccccHHHHccccccEEEcccccccccccHHHHHcccccccccccccc

cccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEEcccccccEccEEccccccccccccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEccccccccccHHHHcccccccEEEccccEEEccccHHHHHcccHccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccEEEEEccccccc

mlkflglsfnqfygsippeighltHLKLLSFSknqlsglipheigrlsslnglsLYSNFLkcsiplslgnltSLIYIGISnnllfglipnevgslkslSDLRLYNNTLKNmnalsgsipDEIRNLKSLLNLqldnntlngsiplslgnltnlttlYFSTnalsgsisneitnlrsisdlqlsentldgsiplALGNLIKLVVLDLSInklsgsiplsfasltsLTTLYLYENSLCDSIQKEIGDMKSLSILdlssnklngsiplslTNLTNSLKVLSlssnnivgeiplghgkfSSLIQLILTNNelsrqlspelgslimaipdlnqdhle

MLKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRlsslnglslysnflKCSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSllnlqldnntlnGSIPLSLGnltnlttlYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFAsltslttlylyENSLCDSIQKEIGDMKSLSILDLSSNKLNGSIPlsltnltnslkvlslssnnIVGEIPLGHGKFSSLIQLILTNNELSRQLSPELGSLIMAIPDLNQDHLE

**KFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKVLSLSSNNIVGEIPLGHGKFSSLIQLILTNNELS********SLIM***********

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		331	2.2.26 [Sep-21-2011]
Q9LP24		1120	Probable leucine-rich rep	yes	no	0.918	0.271	0.402	1e-49
Q8VZG8		1045	Probable LRR receptor-lik	no	no	0.906	0.287	0.420	2e-47
Q9FL28		1173	LRR receptor-like serine/	no	no	0.897	0.253	0.408	3e-46
O49318		1124	Probable leucine-rich rep	no	no	0.921	0.271	0.403	3e-46
Q9LVP0		1102	Probable leucine-rich rep	no	no	0.921	0.276	0.387	1e-45
Q9SHI2		1101	Leucine-rich repeat recep	no	no	0.987	0.297	0.375	2e-43
Q9LYN8		1192	Leucine-rich repeat recep	no	no	0.845	0.234	0.367	4e-43
Q9LHP4		1141	Receptor-like protein kin	no	no	0.909	0.263	0.400	5e-43
C0LGQ5		1249	LRR receptor-like serine/	no	no	0.948	0.251	0.354	8e-42
C0LGF5		1072	Probable LRR receptor-lik	no	no	0.909	0.280	0.414	4e-41

>sp\|Q9LP24\|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1	Back alignment and function desciption

 Score =  197 bits (500), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 134/333 (40%), Positives = 192/333 (57%), Gaps = 29/333 (8%)

Query: 4   FLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCS 63
           +  LS N   G I P +G+L +L +L   +N L+ +IP E+G + S+  L+L  N L  S
Sbjct: 130 YFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGS 189

Query: 64  IPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIR 123
           IP SLGNL +L+ + +  N L G+IP E+G+++S++DL L      + N L+GSIP  + 
Sbjct: 190 IPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLAL------SQNKLTGSIPSTLG 243

Query: 124 NLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSE 183
           NLK+L+ L L  N L G IP  +GN+ ++T L  S N L+GSI + + NL++++ L L +
Sbjct: 244 NLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQ 303

Query: 184 NTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKEIG 243
           N L G IP  LGN+  ++ L+LS NKL+GSIP S  +L +LT LYLYEN L   I  E+G
Sbjct: 304 NYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELG 363

Query: 244 DMKSLSILDLSSNKLNGSIPLSLTNLT-----------------------NSLKVLSLSS 280
           +M+S+  L L++NKL GSIP S  NL                         S+  L LS 
Sbjct: 364 NMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQ 423

Query: 281 NNIVGEIPLGHGKFSSLIQLILTNNELSRQLSP 313
           N + G +P   G F+ L  L L  N LS  + P
Sbjct: 424 NKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPP 456

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1

>sp\|Q8VZG8\|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3	Back alignment and function description

>sp\|Q9FL28\|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1	Back alignment and function description

>sp\|O49318\|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1	Back alignment and function description

>sp\|Q9LVP0\|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1	Back alignment and function description

>sp\|Q9SHI2\|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2	Back alignment and function description

>sp\|Q9LYN8\|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1	Back alignment and function description

>sp\|Q9LHP4\|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1	Back alignment and function description

>sp\|C0LGQ5\|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1	Back alignment and function description

>sp\|C0LGF5\|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		331
1184077		1112	Cf-2.2 [Solanum pimpinellifolium] gi\|603	0.957	0.285	0.463	1e-58
60327196		1112	Cf-2.3 [Solanum pimpinellifolium]	0.957	0.285	0.463	1e-58
1184075		1112	Cf-2.1 [Solanum pimpinellifolium] gi\|603	0.957	0.285	0.463	2e-58
3894387		944	Hcr2-0B [Solanum lycopersicum]	0.954	0.334	0.489	2e-58
60327216		487	Hcr2-p7.2 [Solanum pimpinellifolium]	0.972	0.661	0.481	4e-57
60327228		487	Hcr2-p7.8 [Solanum pimpinellifolium]	0.972	0.661	0.481	4e-57
60327230		487	Hcr2-p7.9 [Solanum pimpinellifolium]	0.972	0.661	0.481	4e-57
60327220		487	Hcr2-p7.4 [Solanum pimpinellifolium] gi\|	0.972	0.661	0.481	4e-57
60327214		487	Hcr2-p7.1 [Solanum pimpinellifolium]	0.972	0.661	0.481	4e-57
60327226		487	Hcr2-p7.7 [Solanum pimpinellifolium]	0.972	0.661	0.478	1e-56

>gi\|1184077\|gb\|AAC15780.1\| Cf-2.2 [Solanum pimpinellifolium] gi\|60327194\|gb\|AAX19020.1\| Cf-2.2 [Solanum pimpinellifolium]	Back alignment and taxonomy information

 Score =  233 bits (593), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 166/358 (46%), Positives = 212/358 (59%), Gaps = 41/358 (11%)

Query: 2   LKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLK 61
           L +L L+ NQ  G+IPP+IG L  L+++    NQL+G IP EIG L SL  LSL  NFL 
Sbjct: 121 LVYLDLNNNQISGTIPPQIGLLAKLQIIRIFHNQLNGFIPKEIGYLRSLTKLSLGINFLS 180

Query: 62  CSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLK--------NMN- 112
            SIP S+GNL +L ++ + NN L G IP E+  L+SL++L L +N L         NMN 
Sbjct: 181 GSIPASVGNLNNLSFLYLYNNQLSGSIPEEISYLRSLTELDLSDNALNGSIPASLGNMNN 240

Query: 113 ---------ALSGSIPDEIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALS 163
                     LSGSIP+EI  L+SL  L L  N LNGSIP SLGNL NL+ L+   N LS
Sbjct: 241 LSFLFLYGNQLSGSIPEEICYLRSLTYLDLSENALNGSIPASLGNLNNLSFLFLYGNQLS 300

Query: 164 GSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTS 223
           GSI  EI  LRS++ L LSEN L+GSIP +LGNL  L  L+L  N+LSGSIP S  +L +
Sbjct: 301 GSIPEEIGYLRSLNVLGLSENALNGSIPASLGNLKNLSRLNLVNNQLSGSIPASLGNLNN 360

Query: 224 LTTLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSIPLSLTNLTN------------ 271
           L+ LYLY N L  SI   +G++ +LS+L L +N+L+GSIP SL NL N            
Sbjct: 361 LSMLYLYNNQLSGSIPASLGNLNNLSMLYLYNNQLSGSIPASLGNLNNLSRLYLYNNQLS 420

Query: 272 -----------SLKVLSLSSNNIVGEIPLGHGKFSSLIQLILTNNELSRQLSPELGSL 318
                      SL  L LS+N+I G IP   G  S+L  L L  N+L+  +  E+G L
Sbjct: 421 GSIPEEIGYLSSLTYLDLSNNSINGFIPASFGNMSNLAFLFLYENQLASSVPEEIGYL 478

Source: Solanum pimpinellifolium

Species: Solanum pimpinellifolium

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|60327196\|gb\|AAX19021.1\| Cf-2.3 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|1184075\|gb\|AAC15779.1\| Cf-2.1 [Solanum pimpinellifolium] gi\|60327192\|gb\|AAX19019.1\| Cf-2.1 [Solanum pimpinellifolium] gi\|1587673\|prf\|\|2207203A Cf-2 gene	Back alignment and taxonomy information

>gi\|3894387\|gb\|AAC78593.1\| Hcr2-0B [Solanum lycopersicum]	Back alignment and taxonomy information

>gi\|60327216\|gb\|AAX19031.1\| Hcr2-p7.2 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|60327228\|gb\|AAX19037.1\| Hcr2-p7.8 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|60327230\|gb\|AAX19038.1\| Hcr2-p7.9 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|60327220\|gb\|AAX19033.1\| Hcr2-p7.4 [Solanum pimpinellifolium] gi\|60327222\|gb\|AAX19034.1\| Hcr2-p7.5 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|60327214\|gb\|AAX19030.1\| Hcr2-p7.1 [Solanum pimpinellifolium]	Back alignment and taxonomy information

>gi\|60327226\|gb\|AAX19036.1\| Hcr2-p7.7 [Solanum pimpinellifolium]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		331
TAIR\|locus:2011339		1120	AT1G35710 [Arabidopsis thalian	0.960	0.283	0.351	4.1e-39
TAIR\|locus:2160791		1102	AT5G63930 [Arabidopsis thalian	0.972	0.292	0.318	1.2e-34
TAIR\|locus:2085949		1141	AT3G24240 [Arabidopsis thalian	0.909	0.263	0.325	1.6e-33
TAIR\|locus:2138268		1045	AT4G08850 [Arabidopsis thalian	0.930	0.294	0.311	1.7e-33
TAIR\|locus:4515102753		598	AT1G73066 [Arabidopsis thalian	0.936	0.518	0.305	4.8e-33
TAIR\|locus:2074633		943	RLP35 "AT3G11080" [Arabidopsis	0.966	0.339	0.276	3.7e-27
TAIR\|locus:2161825		1090	AT5G56040 [Arabidopsis thalian	0.972	0.295	0.326	4.5e-32
TAIR\|locus:2154344		1135	AT5G48940 [Arabidopsis thalian	0.972	0.283	0.305	6.2e-32
TAIR\|locus:2168907		966	XIP1 "XYLEM INTERMIXED WITH PH	0.975	0.334	0.304	7.5e-32
TAIR\|locus:2156349		1252	GSO2 "GASSHO 2" [Arabidopsis t	0.969	0.256	0.308	2e-31

TAIR\|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 429 (156.1 bits), Expect = 4.1e-39, P = 4.1e-39
 Identities = 116/330 (35%), Positives = 165/330 (50%)

Query:     5 LGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRXXXXXXXXXXXXXXKCSI 64
             L LS N+  GSIP  +G+L +L +L   +N L+G+IP E+G                 SI
Sbjct:   179 LALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSI 238

Query:    65 PLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRN 124
             P +LGNL +L+ + +  N L G+IP E+G+++S+++L L      + N L+GSIP  + N
Sbjct:   239 PSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLAL------SQNKLTGSIPSSLGN 292

Query:   125 LKSXXXXXXXXXXXXGSIPLSLGXXXXXXXXYFSTNALSGSISNEITNLRSISDLQLSEN 184
             LK+            G IP  LG          S N L+GSI + + NL++++ L L EN
Sbjct:   293 LKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYEN 352

Query:   185 TLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFAXXXXXXXXXXXENSLCDSIQKEIGD 244
              L G IP  LGN+  ++ L L+ NKL+GSIP SF             N L   I +E+G+
Sbjct:   353 YLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGN 412

Query:   245 MKSLSILDLSSNKLNGSIPXXXXXXXXXXXXXXXXXXXIVGEIPLGHGKFSSLIQLILTN 304
             M+S+  LDLS NKL GS+P                   + G IP G    S L  LIL  
Sbjct:   413 MESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNH-LSGAIPPGVANSSHLTTLILDT 471

Query:   305 NELSRQLSPEL---GSLIMAIPDLNQDHLE 331
             N  +    PE    G  +  I  L+ +HLE
Sbjct:   472 NNFTG-FFPETVCKGRKLQNI-SLDYNHLE 499

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=ISS

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA;ISS

GO:0005886 "plasma membrane" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA;ISS

GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0000165 "MAPK cascade" evidence=RCA

GO:0009814 "defense response, incompatible interaction" evidence=RCA

TAIR\|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2168907 XIP1 "XYLEM INTERMIXED WITH PHLOEM 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00017148001	SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (1154 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		331
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-55
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-50
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	2e-48
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-47
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-40
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	3e-40
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-32
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	5e-22
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-20
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-15
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	6e-14
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	9e-14
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-11
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	3e-11
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	4e-11
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	4e-11
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	1e-09
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	8e-08
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	3e-04
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	7e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.004

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

 Score =  193 bits (493), Expect = 2e-55
 Identities = 139/318 (43%), Positives = 179/318 (56%), Gaps = 11/318 (3%)

Query: 2   LKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLK 61
           L++L LS N F GSIP   G + +L+ L  S N LSG IP++IG  SSL  L L  N L 
Sbjct: 120 LRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV 177

Query: 62  CSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRL-YNNTLKNMNALSGSIPD 120
             IP SL NLTSL ++ +++N L G IP E+G +KSL  + L YNN       LSG IP 
Sbjct: 178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNN-------LSGEIPY 230

Query: 121 EIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQ 180
           EI  L SL +L L  N L G IP SLGNL NL  L+   N LSG I   I +L+ +  L 
Sbjct: 231 EIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLD 290

Query: 181 LSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQK 240
           LS+N+L G IP  +  L  L +L L  N  +G IP++  SL  L  L L+ N     I K
Sbjct: 291 LSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK 350

Query: 241 EIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKVLSLSSNNIVGEIPLGHGKFSSLIQL 300
            +G   +L++LDLS+N L G IP  L +  N  K L L SN++ GEIP   G   SL ++
Sbjct: 351 NLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFK-LILFSNSLEGEIPKSLGACRSLRRV 409

Query: 301 ILTNNELSRQLSPELGSL 318
            L +N  S +L  E   L
Sbjct: 410 RLQDNSFSGELPSEFTKL 427

Length = 968

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		331
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.97
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.97
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.93
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.9
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.89
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.88
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.86
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.85
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.83
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.81
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.81
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.8
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.79
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.79
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.75
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.72
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.69
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.69
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.57
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.55
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.38
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	99.36
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.28
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.23
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.21
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.16
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.13
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	99.12
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.12
KOG2982		418	consensus Uncharacterized conserved protein [Funct	99.0
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.98
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.97
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.96
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.95
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.91
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.91
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.9
PLN03150		623	hypothetical protein; Provisional	98.83
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.82
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.81
PLN03150		623	hypothetical protein; Provisional	98.8
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.73
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.69
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.65
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.62
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.59
KOG4341		483	consensus F-box protein containing LRR [General fu	98.55
KOG4341		483	consensus F-box protein containing LRR [General fu	98.36
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.31
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.18
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.1
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	98.09
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	98.08
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	98.06
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	98.05
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	98.0
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.99
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.99
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.87
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	97.86
PRK15386		426	type III secretion protein GogB; Provisional	97.78
PRK15386		426	type III secretion protein GogB; Provisional	97.77
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.63
KOG1947		482	consensus Leucine rich repeat proteins, some prote	97.53
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.44
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.08
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.02
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.99
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	96.83
KOG3864		221	consensus Uncharacterized conserved protein [Funct	96.5
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.73
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	95.28
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	95.22
KOG3864		221	consensus Uncharacterized conserved protein [Funct	95.17
KOG4308		478	consensus LRR-containing protein [Function unknown	94.46
smart00370		26	LRR Leucine-rich repeats, outliers.	89.78
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	89.78
KOG4308		478	consensus LRR-containing protein [Function unknown	89.25
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	85.62
KOG0473		326	consensus Leucine-rich repeat protein [Function un	83.25
smart00368		28	LRR_RI Leucine rich repeat, ribonuclease inhibitor	82.88

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

Probab=100.00  E-value=8e-35  Score=282.53  Aligned_cols=254  Identities=45%  Similarity=0.677  Sum_probs=122.1

Q ss_pred             ccEEecccccccCCCCcccCCCCCccEEEeccCcccCCChhhhccCcCCCeeeccCCcccccccccccCCCcccEEEeec
Q 045822            2 LKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCSIPLSLGNLTSLIYIGISN   81 (331)
Q Consensus         2 L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~   81 (331)
                      |++|++++|.+++..+.  ..+++|++|++++|.+....+..++++++|++|++++|.+....|..+.++++|++|++++
T Consensus       120 L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~  197 (968)
T PLN00113        120 LRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLAS  197 (968)
T ss_pred             CCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccC
Confidence            55566665555543332  3345555555555555444455555555555555555555444455555555555555555


Q ss_pred             ceeeecCcccccCCCCCCeEEeecCcccCCCCccCCchhhhhCCcCCcEEEccccccCCcccccccCCCCCcEEEeeccc
Q 045822           82 NLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNA  161 (331)
Q Consensus        82 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~  161 (331)
                      |.+....|..+.++++|++|++++|.+..      .+|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.
T Consensus       198 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  271 (968)
T PLN00113        198 NQLVGQIPRELGQMKSLKWIYLGYNNLSG------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNK  271 (968)
T ss_pred             CCCcCcCChHHcCcCCccEEECcCCccCC------cCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCe
Confidence            55444444455555555555555544331      233444455555555555554444444444444455555554444


Q ss_pred             CCCcccccccCCCCCCEEEccCCcCCCCcchhhhCCCCccEEEeecCcCCCCCCccccccCCccEEEccCCccCcccccc
Q 045822          162 LSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKE  241 (331)
Q Consensus       162 ~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~  241 (331)
                      +.+..+..+..+++|++|++++|.+....+..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+..+..
T Consensus       272 l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~  351 (968)
T PLN00113        272 LSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKN  351 (968)
T ss_pred             eeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChH
Confidence            44444444444444444444444444334444444444444444444444444444444444444444444444333333


Q ss_pred             ccCCCcccEEEccCCccccccc
Q 045822          242 IGDMKSLSILDLSSNKLNGSIP  263 (331)
Q Consensus       242 ~~~~~~L~~L~ls~~~~~~~~~  263 (331)
                      +..+++|+.|++++|.+.+.++
T Consensus       352 l~~~~~L~~L~Ls~n~l~~~~p  373 (968)
T PLN00113        352 LGKHNNLTVLDLSTNNLTGEIP  373 (968)
T ss_pred             HhCCCCCcEEECCCCeeEeeCC
Confidence            4444444444444444443333

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		331
3riz_A		772	Crystal Structure Of The Plant Steroid Receptor Bri		8e-19
3rgx_A		768	Structural Insight Into Brassinosteroid Perception		1e-18
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		1e-08
1ogq_A		313	The Crystal Structure Of Pgip (Polygalacturonase In		5e-07

>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772

Back alignment and structure

Iteration: 1

Score = 69.7 bits (169), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 91/319 (28%), Positives = 126/319 (39%), Gaps = 36/319 (11%) Query: 2 LKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRXXXXXXXXXXXXXXK 61 LK L +S NQF G IPP L L+ LS ++N+ +G IP + Sbjct: 246 LKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLS---------------- 287 Query: 62 CSIPLSLGNLTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIP-D 120 G +L + +S N +G +P GS L + + N SG +P D Sbjct: 288 -------GACDTLTGLDLSGNHFYGAVPPFFGSCSLLE------SLALSSNNFSGELPMD 334 Query: 121 EIRNLKSXXXXXXXXXXXXGSIPLSLGXXXXXXXXY-FSTNALSGSI-SNEITNLR-SIS 177 + ++ G +P SL S+N SG I N N + ++ Sbjct: 335 TLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQ 394 Query: 178 DLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFAXXXXXXXXXXXENSLCDS 237 +L L N G IP L N +LV L LS N LSG+IP S N L Sbjct: 395 ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGE 454 Query: 238 IQKEIGDMKSLSILDLSSNKLNGSIPXXXXXXXXXXXXXXXXXXXIVGEIPLGHGKFSSL 297 I +E+ +K+L L L N L G IP + GEIP G+ +L Sbjct: 455 IPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNR-LTGEIPKWIGRLENL 513 Query: 298 IQLILTNNELSRQLSPELG 316 L L+NN S + ELG Sbjct: 514 AILKLSNNSFSGNIPAELG 532

PyMOL of 3riz

>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		331
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-68
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-67
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-65
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-63
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-60
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-57
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-53
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	3e-41
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-19
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-65
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-62
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	4e-50
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	9e-39
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	5e-33
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	3e-23
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-44
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-43
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-42
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-41
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-38
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-35
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-29
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-41
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-41
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	9e-40
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-38
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-38
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-37
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-22
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-11
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-37
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-35
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-34
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-32
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-28
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-17
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-35
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-33
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-30
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-28
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-16
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-34
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-33
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-32
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-31
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	6e-28
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-33
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-32
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-26
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-19
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-12
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-31
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-31
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	3e-29
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-29
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-27
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	2e-25
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-17
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	5e-29
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	9e-26
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-21
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-13
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-28
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-19
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-28
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-25
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-24
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-12
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-27
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-27
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-25
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	4e-24
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-27
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-23
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-14
1o6v_A		466	Internalin A; bacterial infection, extracellular r	9e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-26
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-20
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-18
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	8e-26
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-23
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-22
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-21
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-17
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-14
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-26
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	3e-23
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-19
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-18
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	6e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-25
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-17
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	8e-16
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-10
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-24
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-22
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-21
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-20
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	9e-20
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-19
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-19
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	7e-19
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-14
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-23
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-20
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-17
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-16
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-23
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-18
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	6e-05
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	6e-23
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	2e-22
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	8e-20
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-16
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	5e-11
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-22
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	7e-19
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	8e-18
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-15
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-22
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	8e-21
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-17
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	4e-22
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	8e-22
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-19
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	5e-16
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-11
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	4e-21
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	3e-17
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	9e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-04
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-21
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-16
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-18
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-18
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-18
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-18
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	5e-16
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-15
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-13
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-11
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-18
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	4e-18
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	1e-17
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-18
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-16
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-16
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	5e-13
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-17
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	3e-15
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-13
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	5e-05
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-17
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	5e-14
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-12
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-16
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	7e-14
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-10
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-07
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	5e-06
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	2e-16
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	7e-15
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	7e-14
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	8e-16
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-15
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-14
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-13
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-14
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	3e-12
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	4e-10
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-14
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-14
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-13
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-11
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	3e-14
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-10
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-05
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	4e-14
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-11
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	6e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	5e-14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	6e-10
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-08
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-07
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-13
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-12
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-11
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-10
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	2e-09
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	1e-04
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	6e-12
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	5e-08
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-12
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-10
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	7e-10
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	6e-09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	8e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-11
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	2e-08
3m19_A		251	Variable lymphocyte receptor A diversity region; a	3e-11
3m19_A		251	Variable lymphocyte receptor A diversity region; a	3e-10
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-09
3m19_A		251	Variable lymphocyte receptor A diversity region; a	5e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	3e-09
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-08
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-06
3e6j_A		229	Variable lymphocyte receptor diversity region; var	3e-10
3e6j_A		229	Variable lymphocyte receptor diversity region; var	2e-09
3e6j_A		229	Variable lymphocyte receptor diversity region; var	2e-09
3e6j_A		229	Variable lymphocyte receptor diversity region; var	3e-09
3e6j_A		229	Variable lymphocyte receptor diversity region; var	4e-07
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-10
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-10
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	8e-10
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	2e-08
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	6e-10
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	7e-09
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	2e-08
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	8e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	7e-10
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-09
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	9e-09
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	2e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-08
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	7e-08
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-06
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	2e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	7e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-08
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-08
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	4e-08
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	2e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	3e-08
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-06
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	4e-05
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	3e-08
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	6e-08
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	1e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	8e-07
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-06
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	2e-06
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	2e-05
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	4e-05
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	7e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	4e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-05
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-04
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-05
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-05
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	2e-05
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	8e-05
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	2e-05
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	5e-05
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	1e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	8e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	1e-04

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

 Score =  227 bits (581), Expect = 1e-68
 Identities = 103/343 (30%), Positives = 156/343 (45%), Gaps = 31/343 (9%)

Query: 1   MLKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHE-IGRLSSLNGLSLYSNF 59
            L  L LS N FYG++PP  G  + L+ L+ S N  SG +P + + ++  L  L L  N 
Sbjct: 295 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 354

Query: 60  LKCSIPLSLGNLT-SLIYIGISNNLLFGLIPNEVG--SLKSLSDLRLYNNTLKNMNALSG 116
               +P SL NL+ SL+ + +S+N   G I   +      +L +L L NN        +G
Sbjct: 355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGF------TG 408

Query: 117 SIPDEIRNLKSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSI 176
            IP  + N   L++L L  N L+G+IP SLG+L+ L  L    N L G I  E+  ++++
Sbjct: 409 KIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTL 468

Query: 177 SDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCD 236
             L L  N L G IP  L N   L  + LS N+L+G IP     L +L  L L  NS   
Sbjct: 469 ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG 528

Query: 237 SIQKEIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKV--------------------- 275
           +I  E+GD +SL  LDL++N  NG+IP ++   +  +                       
Sbjct: 529 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECH 588

Query: 276 LSLSSNNIVGEIPLGHGKFSSLIQLILTNNELSRQLSPELGSL 318
            + +     G       + S+     +T+       SP   + 
Sbjct: 589 GAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNN 631

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		331
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	100.0
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	100.0
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	100.0
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	100.0
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	100.0
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	100.0
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	100.0
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	100.0
1o6v_A		466	Internalin A; bacterial infection, extracellular r	100.0
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	100.0
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	100.0
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	100.0
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	100.0
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	100.0
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	100.0
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.97
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.97
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.97
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.97
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.97
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.97
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.97
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.97
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.97
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.96
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.96
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.96
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.96
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.96
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.96
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.96
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.95
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.95
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.95
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.95
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.95
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.95
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.95
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.95
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.95
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.95
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.95
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.95
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.93
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.93
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.93
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.93
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.93
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.92
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.92
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.91
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.91
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.91
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.91
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.91
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.9
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.9
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.9
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.9
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.9
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.9
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.9
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.89
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.89
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.89
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.89
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.89
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.88
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.87
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.87
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.87
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.86
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.86
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.85
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.85
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.85
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.81
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.81
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.8
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.79
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.77
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.77
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.77
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.77
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.76
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.75
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.75
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.74
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.74
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.74
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.74
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.73
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.72
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.72
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.72
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.72
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.71
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.71
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.71
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.69
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.69
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.69
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.64
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.61
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.6
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.6
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.6
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.58
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.57
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.56
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.56
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.54
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.53
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	99.52
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.52
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.52
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.51
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.51
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.5
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.49
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.46
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.43
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.39
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.37
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.36
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	99.34
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.33
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.33
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.32
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.28
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	99.27
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	99.12
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	99.08
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.07
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	99.03
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.97
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.95
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.7
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.6
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.58
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.0
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.97
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.64
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.38
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.31
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.02
2lz0_A		100	Uncharacterized protein; hypothetical leucine rich	87.39
2lz0_A		100	Uncharacterized protein; hypothetical leucine rich	86.95

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

Probab=100.00  E-value=1.2e-37  Score=293.98  Aligned_cols=312  Identities=34%  Similarity=0.476  Sum_probs=183.9

Q ss_pred             CccEEecccccccCCCCcccCCCCCccEEEeccCcccCCCh-hhhccCcCCCeeeccCCcccccccccccC---------
Q 045822            1 MLKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIP-HEIGRLSSLNGLSLYSNFLKCSIPLSLGN---------   70 (331)
Q Consensus         1 ~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~-~~~~~l~~L~~L~l~~~~~~~~~~~~~~~---------   70 (331)
                      +|++|++++|.+++..+..+.++++|++|++++|.+....+ ..+..+++|++|++++|.+...+|..+.+         
T Consensus       295 ~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~  374 (768)
T 3rgz_A          295 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLD  374 (768)
T ss_dssp             TCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEE
T ss_pred             cCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEE
Confidence            36777777777776666667777777777777776653333 33666666666666666654444443333         


Q ss_pred             ------------------CCcccEEEeecceeeecCcccccCCCCCCeEEeecCcccCCCCccCCchhhhhCCcCCcEEE
Q 045822           71 ------------------LTSLIYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSLLNLQ  132 (331)
Q Consensus        71 ------------------l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~  132 (331)
                                        +++|++|++++|.+....|..+..+++|++|++++|.+..      .+|..+..+++|+.|+
T Consensus       375 Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~------~~p~~l~~l~~L~~L~  448 (768)
T 3rgz_A          375 LSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG------TIPSSLGSLSKLRDLK  448 (768)
T ss_dssp             CCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEES------CCCGGGGGCTTCCEEE
T ss_pred             ccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccC------cccHHHhcCCCCCEEE
Confidence                              3445555555555554555556666666666666665442      3345566666666666


Q ss_pred             ccccccCCcccccccCCCCCcEEEeecccCCCcccccccCCCCCCEEEccCCcCCCCcchhhhCCCCccEEEeecCcCCC
Q 045822          133 LDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDLSINKLSG  212 (331)
Q Consensus       133 l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  212 (331)
                      +++|.+.+..|..+..+++|+.+++++|.+.+..+..+..+++|++|++++|.+.+..+..+..+++|++|++++|.+.+
T Consensus       449 L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~  528 (768)
T 3rgz_A          449 LWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSG  528 (768)
T ss_dssp             CCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEE
T ss_pred             CCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccC
Confidence            66666655555556666666666666666665555566666666666666666655555566666666666666666655


Q ss_pred             CCCccccccCCccEEEccCCccCccccc----------------------------------------------------
Q 045822          213 SIPLSFASLTSLTTLYLYENSLCDSIQK----------------------------------------------------  240 (331)
Q Consensus       213 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~----------------------------------------------------  240 (331)
                      ..|..+..+++|+.|++++|.+.+..+.                                                    
T Consensus       529 ~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~  608 (768)
T 3rgz_A          529 NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS  608 (768)
T ss_dssp             ECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGG
T ss_pred             cCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccc
Confidence            5555566666666666666554422111                                                    


Q ss_pred             ------------------cccCCCcccEEEccCCccccccchhhhhccccccEEEcccccccccCCCCCCCCCcceEEEe
Q 045822          241 ------------------EIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKVLSLSSNNIVGEIPLGHGKFSSLIQLIL  302 (331)
Q Consensus       241 ------------------~~~~~~~L~~L~ls~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l  302 (331)
                                        .+..+++|+.|++++|.+++.+|..+..+.. |+.|++++|++++.+|..+.++++|+.|++
T Consensus       609 ~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~-L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdL  687 (768)
T 3rgz_A          609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPY-LFILNLGHNDISGSIPDEVGDLRGLNILDL  687 (768)
T ss_dssp             GTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTT-CCEEECCSSCCCSCCCGGGGGCTTCCEEEC
T ss_pred             cccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhcccc-CCEEeCcCCccCCCCChHHhCCCCCCEEEC
Confidence                              1222345556666666666555555555443 666666666666566666666666666666


Q ss_pred             ccceeccccChhhHHhh
Q 045822          303 TNNELSRQLSPELGSLI  319 (331)
Q Consensus       303 ~~~~~~~~~p~~~~~~~  319 (331)
                      ++|++++.+|..++.+.
T Consensus       688 s~N~l~g~ip~~l~~l~  704 (768)
T 3rgz_A          688 SSNKLDGRIPQAMSALT  704 (768)
T ss_dssp             CSSCCEECCCGGGGGCC
T ss_pred             CCCcccCcCChHHhCCC
Confidence            66666666666655544

PyMOL of 3rgz

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus}	Back alignment and structure

>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		331
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	1e-16
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	7e-15
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	3e-09
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-09
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	5e-14
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-13
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-11
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-10
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	2e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	5e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	1e-04
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.002
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	7e-14
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	3e-13
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	5e-12
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	4e-10
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	5e-08
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	5e-13
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	4e-11
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	1e-10
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	6e-08
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	2e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	1e-07
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	2e-06
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	6e-05
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	5e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	7e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	6e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	8e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	0.002
d1w8aa_		192	c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga	8e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-04
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	4e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	2e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	7e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	3e-04
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	0.003
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	0.001

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 52/274 (18%), Positives = 96/274 (35%), Gaps = 18/274 (6%)

Query: 15  SIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCSIPLSLGNLTSL 74
            +P ++       LL    N+++ +   +   L +L+ L L +N +    P +   L  L
Sbjct: 24  KVPKDLP--PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKL 81

Query: 75  IYIGISNNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNALSGSIPDEIRNLKSLLNLQLD 134
             + +S N L  L      +L+ L         ++              N   ++ L  +
Sbjct: 82  ERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRK-------SVFNGLNQMIVVELGTN 134

Query: 135 NNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLAL 194
               +G    +   +  L+ +  +   ++        +L     L L  N +      +L
Sbjct: 135 PLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTE---LHLDGNKITKVDAASL 191

Query: 195 GNLIKLVVLDLSINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKEIGDMKSLSILDLS 254
             L  L  L LS N +S     S A+   L  L+L  N L       + D K + ++ L 
Sbjct: 192 KGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPG-GLADHKYIQVVYLH 250

Query: 255 SNKL-----NGSIPLSLTNLTNSLKVLSLSSNNI 283
           +N +     N   P        S   +SL SN +
Sbjct: 251 NNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPV 284

PyMOL of d1xkua_

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		331
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.95
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.94
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.94
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.93
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.93
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.92
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.91
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.9
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.86
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.85
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.78
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.78
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.77
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.76
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.75
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.71
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.71
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.71
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.69
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	99.68
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.68
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.67
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.66
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.66
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.62
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.61
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.59
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.57
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.57
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.56
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.56
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.46
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.29
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.22
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.15
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.14
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.25
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.14
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.04
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.98
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.77
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.35

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.95  E-value=2.9e-25  Score=191.30  Aligned_cols=293  Identities=28%  Similarity=0.372  Sum_probs=203.1

Q ss_pred             CccEEecccccccCCCCcccCCCCCccEEEeccCcccCCChhhhccCcCCCeeeccCCcccccccccccCCCcccEEEee
Q 045822            1 MLKFLGLSFNQFYGSIPPEIGHLTHLKLLSFSKNQLSGLIPHEIGRLSSLNGLSLYSNFLKCSIPLSLGNLTSLIYIGIS   80 (331)
Q Consensus         1 ~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~   80 (331)
                      +|++|+++++.+++.  +.+..+++|++|++++|++....  .++++++|++|++++|.+...  ..+.++++|+.+++.
T Consensus        45 ~l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l~--~l~~L~~L~~L~L~~n~i~~i--~~l~~l~~L~~L~~~  118 (384)
T d2omza2          45 QVTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIADI--TPLANLTNLTGLTLF  118 (384)
T ss_dssp             TCCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCCG--GGTTCTTCCEEECCSSCCCCC--GGGTTCTTCCEEECC
T ss_pred             CCCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCCc--cccCCcccccccccccccccc--ccccccccccccccc
Confidence            478999999988842  45788999999999999988653  388899999999999998733  247889999999998


Q ss_pred             cceeeecCcccccCCCCCCeEEeecCcccCCCC-----------------------------------ccCCchhhhhCC
Q 045822           81 NNLLFGLIPNEVGSLKSLSDLRLYNNTLKNMNA-----------------------------------LSGSIPDEIRNL  125 (331)
Q Consensus        81 ~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~-----------------------------------~~~~~~~~l~~~  125 (331)
                      ++.+....+  ......+.......+.+.....                                   ...........+
T Consensus       119 ~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  196 (384)
T d2omza2         119 NNQITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKL  196 (384)
T ss_dssp             SSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCCCCCGGGGGC
T ss_pred             ccccccccc--ccccccccccccccccccccccccccccccccccccccchhhhhccccccccccccccccccccccccc
Confidence            877653321  2222333333332221110000                                   000112346667


Q ss_pred             cCCcEEEccccccCCcccccccCCCCCcEEEeecccCCCcccccccCCCCCCEEEccCCcCCCCcchhhhCCCCccEEEe
Q 045822          126 KSLLNLQLDNNTLNGSIPLSLGNLTNLTTLYFSTNALSGSISNEITNLRSISDLQLSENTLDGSIPLALGNLIKLVVLDL  205 (331)
Q Consensus       126 ~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l  205 (331)
                      ++++.+.+.++.+....+  +...++|+.+++++|.+++.  ..+..+++|+.+++.+|.+.+..  .+..+++|+++++
T Consensus       197 ~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~--~~l~~l~~L~~L~l~~n~l~~~~--~~~~~~~L~~L~l  270 (384)
T d2omza2         197 TNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI--GTLASLTNLTDLDLANNQISNLA--PLSGLTKLTELKL  270 (384)
T ss_dssp             TTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC--GGGGGCTTCSEEECCSSCCCCCG--GGTTCTTCSEEEC
T ss_pred             cccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc--chhhcccccchhccccCccCCCC--cccccccCCEeec
Confidence            888888888888775443  34567888999988877642  35677888999999888876433  3677888999999


Q ss_pred             ecCcCCCCCCccccccCCccEEEccCCccCccccccccCCCcccEEEccCCccccccchhhhhccccccEEEcccccccc
Q 045822          206 SINKLSGSIPLSFASLTSLTTLYLYENSLCDSIQKEIGDMKSLSILDLSSNKLNGSIPLSLTNLTNSLKVLSLSSNNIVG  285 (331)
Q Consensus       206 ~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~ls~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~  285 (331)
                      +++++....  .+..++.++.+.+.++.+.+.  ..+..+++++.+++++|.+.+. + .+..++ +|++|++++|++++
T Consensus       271 ~~~~l~~~~--~~~~~~~l~~l~~~~n~l~~~--~~~~~~~~l~~L~ls~n~l~~l-~-~l~~l~-~L~~L~L~~n~l~~  343 (384)
T d2omza2         271 GANQISNIS--PLAGLTALTNLELNENQLEDI--SPISNLKNLTYLTLYFNNISDI-S-PVSSLT-KLQRLFFANNKVSD  343 (384)
T ss_dssp             CSSCCCCCG--GGTTCTTCSEEECCSSCCSCC--GGGGGCTTCSEEECCSSCCSCC-G-GGGGCT-TCCEEECCSSCCCC
T ss_pred             cCcccCCCC--ccccccccccccccccccccc--cccchhcccCeEECCCCCCCCC-c-ccccCC-CCCEEECCCCCCCC
Confidence            888877432  366778888888888887652  3356778888888888888743 2 244444 58888888888873


Q ss_pred             cCCCCCCCCCcceEEEeccceeccccChhhHHh
Q 045822          286 EIPLGHGKFSSLIQLILTNNELSRQLSPELGSL  318 (331)
Q Consensus       286 ~~~~~~~~~~~L~~L~l~~~~~~~~~p~~~~~~  318 (331)
                       ++ .+.++++|++|++++|++++..|  +.++
T Consensus       344 -l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l  372 (384)
T d2omza2         344 -VS-SLANLTNINWLSAGHNQISDLTP--LANL  372 (384)
T ss_dssp             -CG-GGGGCTTCCEEECCSSCCCBCGG--GTTC
T ss_pred             -Ch-hHcCCCCCCEEECCCCcCCCChh--hccC
Confidence             33 57888888888888888885443  4444

PyMOL of d2omza2

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure