Citrus Sinensis ID: 045873

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------87
METERNPIHEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccEEEcccccccccccccccccccccccccccEEcccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccHHHccccccccccccccccEEcccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEccccccccHHHccccccccccccccccccEEEccccccccccccccccccccEEEcccccccEEcccccccccEEEcccccccEEEcccccccccccccccccccEEEEccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEEcccccccHHHccccccccccccccccEEEEcccccccccccccccccccccEEEEEccccEEEccccccccccccc
cccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccEEEEHHHcccccEEEccccccccEEEEccccccccccccccccEEcccccccccccEEEEccccEEEEcHHHccccccEEEcccccEEccccccccEEccccccccccccccccccccccccEEEEccccEEEEHHHcccccEEEccccccccEEEEEccccccEEEEEccccccccEEEEEcccEEEEEHHHccccccEEcccccccEEEcccccccccccccccccccccEEEEEcccEEEEHHHcccccccccccccccccEEEEEcccccccccccccEEEEEcccccccccEEEEEcccccEEEEHHHcccccccccccccccccccccEEEcccccccccEcccccccccccccEEEEEcccEEEEHHHcccccEEEcccccccEEEEccccccEEccccccccccEEEEccccEEEEEEEEcccccccccccccccccEEcccccEEccccccccEEccccccEEccccccccccEEEEEEccEEEEHHHcccccEEEccccccccEEEEcccccccEEEEEcccccccccEEEEccccEEEEEEEccccccEEcccccccEEEccccccccEccccccccccccEEEEEcccEEEEHHHcccccccEEEcccccccEEEEccccccccccccEEEEEEcEEcccccEEEEEccccEEEEEEEEcccccccccccEEcccccccEEEEcccccccccccHccccccccccEEEEEEEEEEEEHHHccccccEEcccccccEEEEEcccccccccEEEEccccccccEEEEEcccEEEEEEEEEccccEEEc
meternpihehpltlceieddnppcpvcdwrycfdgsncddcefhpekcsacdrqpsgsfyfckqcwpkspffhKLCAELPRQIRIALRPHCVLrlrqesvgpdmssflsdkafdcdycdeshkdnpflccdfcnfqigapcaTTLIKYHrgqeehiqhfshrhplILLEMELEaedtkckfccksihgsqsyyccgpcnfyihkscselpqqvrhpfhpchsltlqnndlsewyrcdACRSYidlgmryrcddcdfdmhpecmslkpnikypahqHLLIVVEDmsyesqchgcsldieGTFFARCVECkldfhvqcgpapslpptvvhkshshplslidksetlgtddathlycdackeetnpshpcygcsecdqyYAHVRCVITEIHldnterhkhfsHHHLLVLLenernddiechACENLIIqghsaygcdpcrfylhkscfelpkvmkhisdshyltlqnssfserctacgqqlkgnaiyhcetcdfdldldcaaqhpsiklewkassddhdenrdgirhyshYHYLTVLDvgdaecqlchknihgtsygctpcmfnihescaelpqevrhpfhprhsltvqentfqsryfcdacrfdvkpglryrcdecdfdLHLECLSLKANIRYEDHQHLLILIENMsckskceacrcdiegtffLRCVECKLnfhvqcgpdwlpptvdqqhhdhpltlttgtivkdndgdllrceickeernpnhpsygcvecechahvrcvitevpsdereklnhfshdhclflvgnqrdddgvvCYACeklvrgqptygcdqcrfylhkSCAELPRQIQHALHRHSLIlkshtdegtkedhecGACLKKLSgffyqcdncfvMDIDCalsqfggdkc
meternpihehpltlceieddNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIklewkassddhDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPltlttgtivkdndgDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
METERNPIHEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
************LTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAP**********************TLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWK**********DGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHT****KEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQF*****
****RNPIHEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
********HEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPP**********LSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSH*********ECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
*ETERNPIHEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METERNPIHEHPLTLCEIEDDNPPCPVCDWRYCFDGSNCDDCEFHPEKCSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSFLSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTLIKYHRGQEEHIQHFSHRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPNIKYPAHQHLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHSHPLSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTERHKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDSHYLTLQNSSFSERCTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHYLTVLDVGDAECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECHAHVRCVITEVPSDEREKLNHFSHDHCLFLVGNQRDDDGVVCYACEKLVRGQPTYGCDQCRFYLHKSCAELPRQIQHALHRHSLILKSHTDEGTKEDHECGACLKKLSGFFYQCDNCFVMDIDCALSQFGGDKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query868
224144591838 predicted protein [Populus trichocarpa] 0.760 0.787 0.296 2e-61
224139892675 predicted protein [Populus trichocarpa] 0.664 0.854 0.283 3e-40
356572112567 PREDICTED: uncharacterized protein LOC10 0.563 0.862 0.291 4e-40
449460291 1296 PREDICTED: uncharacterized protein LOC10 0.683 0.457 0.28 7e-40
224137826701 predicted protein [Populus trichocarpa] 0.675 0.835 0.267 9e-40
224080598738 predicted protein [Populus trichocarpa] 0.519 0.611 0.311 1e-39
224144656740 predicted protein [Populus trichocarpa] 0.680 0.798 0.265 2e-38
224139812697 predicted protein [Populus trichocarpa] 0.639 0.796 0.282 3e-37
449460289829 PREDICTED: uncharacterized protein LOC10 0.675 0.706 0.279 5e-36
297825035771 protein binding protein [Arabidopsis lyr 0.669 0.753 0.247 1e-34
>gi|224144591|ref|XP_002325342.1| predicted protein [Populus trichocarpa] gi|222862217|gb|EEE99723.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  244 bits (622), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 230/777 (29%), Positives = 351/777 (45%), Gaps = 117/777 (15%)

Query: 49  CSACDRQPSGSFYFCKQCWPKSPFFHKLCAELPRQIRIALRPHCVLRLRQESVGPDMSSF 108
           C  C     G  YFC+ C     + HK C ELP ++      H +  L      P ++ F
Sbjct: 41  CYGCFETIHGPAYFCEIC--GDFWLHKSCFELPSELP-KHSLHSIHPLTLIVRPPSLAGF 97

Query: 109 LSDKAFDCDYCDESHKDNPFLCCDFCNFQIGAPCATTL----IKYHRG-QEEHIQHFSHR 163
                F CD C +      F C   C F +   CA +     ++  +G +   I +F   
Sbjct: 98  -----FVCDGCRDMSPGFAFHC-KACRFNLDVKCAISTDGEDLRSRKGVKNTEIPYFGDE 151

Query: 164 HPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHS 223
           H L+    + E E T C  C   + G    Y C  C FY+H+SC ++P +++HP+HP H 
Sbjct: 152 HLLVSFNAKQEVEKT-CTGCQLLLSGPA--YGCLDCEFYLHESCKDMPSEIQHPYHPPHP 208

Query: 224 LTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPEC----MSLKPNIKYPAHQHLL 279
           L  Q  +      CDAC   I   + YRC +CDF++H  C    + +  ++K+  H+H L
Sbjct: 209 LRAQVAEYGS--ECDACHMPIR-KVFYRCSECDFNLHILCANKSLQVASSLKHKGHEHNL 265

Query: 280 --IVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVH-KSHSHPL 336
              V    +  S C+ C    +G+++  C+ECK   H+ C P P +     H + HSH L
Sbjct: 266 YYFVASYFNEYSVCNTCRKVCKGSYYL-CLECKYYVHLDCIPLPRVVENDCHSRYHSHYL 324

Query: 337 SLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQ---YYAHVRCVITEIH---- 389
           +L D       DD+   YC+ C+++ +P++P Y C +C     Y AH+ C+++E+     
Sbjct: 325 TLKD---CFVEDDSGQYYCEFCEKKRDPTYPVYYCDQCPDRHPYLAHIECLMSELMEAEL 381

Query: 390 ---------LDNTE------------------------RHKHFSHHHLLVLLENERNDD- 415
                    +D+ +                        + K F H H+LV  +NE +D  
Sbjct: 382 NSARTSAKMVDDGDVKGDTKCLALVKYTTIPPENQIKMQLKGFRHEHILVP-DNEESDAR 440

Query: 416 -IECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHISDS-HYLTLQNSSFSER-- 471
              C  C+  I      Y C  C    H SC + P    H   S H LT+    + +   
Sbjct: 441 RTYCSWCDGKIFG--PGYICQECSGNWHISCAKSPPKKTHFLHSQHTLTMLYPHYFKYFI 498

Query: 472 CTACGQQLKGNAIYHCETCDFDLDLDCAAQHPSIKLEWKASSDDHDENRDGIRHYSHYHY 531
           C  C +     A YHC  C F LD+ CA+  P  + E    ++          ++ H H 
Sbjct: 499 CDGCREFCHDVAGYHCYECRFFLDMKCASL-PDDQCEQLKKTES------KTIYFCHKHK 551

Query: 532 LTVLDVGDA---ECQLCHKNIHGTSYGCTPCMFNIHESCAELPQEVRHPFHPRHSLTVQE 588
           LT  +       +C++C   I G +Y C  C F +HESC E PQE++H +H +H L  ++
Sbjct: 552 LTRANCAKGIKEKCKVCQVRISGATYCCINCNFFLHESCLETPQEIQHQYHLQHPLLGRD 611

Query: 589 NTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLS-LKANIRYEDH------------ 635
                +  C AC   +   + Y CD C+F LH  C + L + +++E H            
Sbjct: 612 FDGNPKN-CRACNLQIW-DIAYYCDICEFALHFTCATYLTSTLKHEFHHEHTLFSFVAWD 669

Query: 636 ---QHLLILIENMSCKSK--CEACRCDIEGTFFLRCVECKLNFHVQCGPDWLPPTVDQQH 690
              Q  +  +E    K    CE C  D   +F+ RCVEC +N H++C P  LP  V  + 
Sbjct: 670 LGDQGFIQSLEPQPSKGNFCCETCGNDCTDSFY-RCVECNINRHLECIP--LPFKVQHED 726

Query: 691 HDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCVECECH---AHVRCVITE 744
           H  PLTL    +V+D+ G+   CEIC+++RNPNHP Y C  C+ +   AH+ CVI E
Sbjct: 727 HSDPLTLME-NVVEDDYGEYY-CEICRDKRNPNHPVYCCKMCKDNWFIAHIGCVIKE 781

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224139892|ref|XP_002323327.1| predicted protein [Populus trichocarpa] gi|222867957|gb|EEF05088.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356572112|ref|XP_003554214.1| PREDICTED: uncharacterized protein LOC100810028 [Glycine max] Back     alignment and taxonomy information
>gi|449460291|ref|XP_004147879.1| PREDICTED: uncharacterized protein LOC101206551 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224137826|ref|XP_002322661.1| predicted protein [Populus trichocarpa] gi|222867291|gb|EEF04422.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224080598|ref|XP_002306174.1| predicted protein [Populus trichocarpa] gi|222849138|gb|EEE86685.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224144656|ref|XP_002336168.1| predicted protein [Populus trichocarpa] gi|222874811|gb|EEF11942.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224139812|ref|XP_002323288.1| predicted protein [Populus trichocarpa] gi|222867918|gb|EEF05049.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449460289|ref|XP_004147878.1| PREDICTED: uncharacterized protein LOC101206314 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297825035|ref|XP_002880400.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297326239|gb|EFH56659.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query868
TAIR|locus:2168108710 ULI3 "UV-B LIGHT INSENSITIVE 3 0.625 0.764 0.302 2.3e-53
TAIR|locus:504955646619 AT3G48400 "AT3G48400" [Arabido 0.614 0.861 0.297 8.8e-52
TAIR|locus:2049244657 AT2G04680 [Arabidopsis thalian 0.632 0.835 0.274 2.9e-51
TAIR|locus:2831854 1610 AT5G03360 "AT5G03360" [Arabido 0.367 0.198 0.288 1.2e-49
TAIR|locus:2132158 989 AT4G02180 [Arabidopsis thalian 0.776 0.681 0.259 3.5e-49
TAIR|locus:504954854664 AT5G22355 [Arabidopsis thalian 0.655 0.856 0.262 4.4e-49
TAIR|locus:2052551 769 AT2G21840 [Arabidopsis thalian 0.344 0.388 0.316 1.9e-48
TAIR|locus:2200415653 AT1G65180 [Arabidopsis thalian 0.656 0.872 0.278 3.5e-48
TAIR|locus:4515103389642 AT4G13992 [Arabidopsis thalian 0.644 0.870 0.266 4.3e-48
TAIR|locus:2095477665 AT3G28650 [Arabidopsis thalian 0.669 0.873 0.269 1.6e-47
TAIR|locus:2168108 ULI3 "UV-B LIGHT INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 2.3e-53, Sum P(2) = 2.3e-53
 Identities = 185/612 (30%), Positives = 269/612 (43%)

Query:   162 HRHPLILLEMELEAEDTKCKFCCKSIHGSQSYYCCGP-CNFYIHKSCSELPQQVRHPFHP 220
             H HPL          D +C  C  +      Y+C  P C  + HK C+E P ++ H  HP
Sbjct:    11 HEHPLF---PSARCIDDECDGCHVNGFMYAGYFCNEPYCYVWFHKDCAEAPGEISHSSHP 67

Query:   221 CHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPN---IKYP-AHQ 276
              H L L N+  S+   CD C   + L   Y C  C+F +   C  +KP+   I++P  H 
Sbjct:    68 EHPLLLTND--SKDGPCDLCGQKL-LTPCYSCPTCEFKVDLTC-GMKPSPPAIEHPLCHD 123

Query:   277 HLLIVVEDMSYESQCHGCSLDIEGTFFARCVECKLDFHVQCGPAPSLPPTVVHKSHS-HP 335
             H ++ ++    +  C  C   IEG  ++ C+EC + FHV C     L   V H  HS HP
Sbjct:   124 HAVVFLKIREEKVPCELCKESIEGPSYS-CLECDMYFHVNC---VHLSEEVNHPCHSIHP 179

Query:   336 LSLIDKSETLGTDDATHLYCDACKEETNPSHPCYGCSECDQYYAHVRCVITEIHLDNTER 395
             L LI  SE+L TDDA    C  C       +  Y CS C+ + + + C      L   E 
Sbjct:   180 LKLIT-SESL-TDDAEKS-CLLCGN-IPAENMLYHCSVCN-FTSCLGCTKNPPLLV-IEH 233

Query:   396 HKHFSHHHLLVLLENERNDDIECHACENLIIQGHSAYGCDPCRFYLHKSCFELPKVMKHI 455
              K  +H H L LL   R     C  C     Q  +AY C  C F   + C + P+V+   
Sbjct:   234 MK--THKHPLTLLP--RRISCICDVCGKKC-Q-FTAYVCLQCDFVTARKCIDRPRVININ 287

Query:   456 SDSH--YLTLQ-NSSFSERCTACGQ---QLKGNAIYHCETC-DFDLDLDCAAQHP---SI 505
                H  YLT    + +SE C  C +   Q KG   Y C  C ++ +   CA +      +
Sbjct:   288 RHDHRIYLTHHLGTGYSE-CGVCHKNVSQYKG--AYSCSVCPNYAVHSTCAVRTDVWDGV 344

Query:   506 KLEWKAS-SDDHDENR---DG-IRHYSHYHYLTVL---DVGDAECQLCHKNIH----GTS 553
             +LE     ++D    +   D  I H+SH  +   L   DV   E + C   IH    G+ 
Sbjct:   345 ELEGTTEITEDISPFKVVGDNLICHFSHEEHQLKLHKEDVIHDERRRCEACIHPVQFGSI 404

Query:   554 YGCTP--CMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYR 611
             Y C    C F +HE CA LP + R  F  R   T+ + T +  + C+ C   +  G  Y 
Sbjct:   405 YVCEEEECCFVLHEKCANLPMKKRLVFGTR-PYTLMKETTEITH-CELCGI-LSDGFAYS 461

Query:   612 CDE-CDFDLHLECLSLKANIRYEDHQHLLILIENMSCKSKCEACRCDIEGTFFLRCVECK 670
               E  D D+H  C SL   + ++ H H L   +    +  C+ C+  IE  + LRC  C 
Sbjct:   462 SHEWSDVDVH--CGSLNEPLVHDGHIHPLYFAKKE--EHTCDGCQKSIED-YMLRCKACD 516

Query:   671 LNFHVQCGPDWLPPTVDQQHHDHPLTLTTGTIVKDNDGDLLRCEICKEERNPNHPSYGCV 730
              +  + C    LP  +  ++  HPLTL  G   K+       C+IC++E +P+   Y C 
Sbjct:   517 FDLCLYCAT--LPEKIWHRNDGHPLTLCCGE--KEEASGKYWCDICEKELDPSIWFYTCY 572

Query:   731 ECECHAHVRCVI 742
             +C    H +CV+
Sbjct:   573 DCGVTLHAQCVL 584
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0047134 "protein-disulfide reductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009411 "response to UV" evidence=IMP
GO:0010224 "response to UV-B" evidence=IMP
GO:0019992 "diacylglycerol binding" evidence=ISS
GO:0020037 "heme binding" evidence=ISS
TAIR|locus:504955646 AT3G48400 "AT3G48400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049244 AT2G04680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2831854 AT5G03360 "AT5G03360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132158 AT4G02180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954854 AT5G22355 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052551 AT2G21840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200415 AT1G65180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515103389 AT4G13992 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095477 AT3G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00190202
hypothetical protein (838 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 868
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 98.38
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 98.12
PF0310730 C1_2: C1 domain; InterPro: IPR004146 This short do 97.87
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 97.74
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 97.26
cd0234043 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger pre 96.92
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 96.27
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 95.81
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 95.68
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 95.49
cd0233549 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present 95.48
cd0233945 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger pre 95.08
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 94.94
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 94.9
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 94.53
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 94.53
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 94.51
cd0233849 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger pre 94.31
cd0224946 ZZ Zinc finger, ZZ type. Zinc finger present in dy 94.27
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 94.11
cd0234148 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present 93.95
KOG0696683 consensus Serine/threonine protein kinase [Signal 93.63
cd0234445 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present 93.12
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 92.87
KOG1280381 consensus Uncharacterized conserved protein contai 92.72
cd0233449 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger pr 92.63
cd0234243 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger pre 92.48
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 92.3
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 92.1
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 92.06
PF0013053 C1_1: Phorbol esters/diacylglycerol binding domain 92.03
KOG0957 707 consensus PHD finger protein [General function pre 91.6
KOG0696 683 consensus Serine/threonine protein kinase [Signal 91.25
cd0234549 ZZ_dah Zinc finger, ZZ type. Zinc finger present i 91.24
KOG1280381 consensus Uncharacterized conserved protein contai 91.06
cd0234348 ZZ_EF Zinc finger, ZZ type. Zinc finger present in 89.96
PF0056946 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc 89.73
smart0029144 ZnF_ZZ Zinc-binding domain, present in Dystrophin, 89.65
KOG0954 893 consensus PHD finger protein [General function pre 89.36
KOG0956900 consensus PHD finger protein AF10 [General functio 88.68
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 87.37
KOG4582278 consensus Uncharacterized conserved protein, conta 87.22
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 86.72
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 85.9
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 85.43
cd0233741 ZZ_CBP Zinc finger, ZZ type. Zinc finger present i 85.36
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 85.02
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 84.7
cd0002950 C1 Protein kinase C conserved region 1 (C1) . Cyst 84.52
KOG4582278 consensus Uncharacterized conserved protein, conta 84.18
KOG0957707 consensus PHD finger protein [General function pre 83.88
smart0010949 C1 Protein kinase C conserved region 1 (C1) domain 83.44
KOG0954893 consensus PHD finger protein [General function pre 81.98
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 80.4
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information 
Probab=98.38  E-value=1.6e-07  Score=67.06  Aligned_cols=30  Identities=33%  Similarity=0.844  Sum_probs=28.6

Q ss_pred             eecccccccccCCCceEeCCCCCceeecccc
Q 045873          711 LRCEICKEERNPNHPSYGCVECECHAHVRCV  741 (868)
Q Consensus       711 ~~C~vC~~~~d~~~~~Y~C~~C~~~lH~~C~  741 (868)
                      |||+||++++++.+ +|+|++|+++||++||
T Consensus         1 ~~C~~C~~~~~~~~-~Y~C~~c~f~lh~~Ca   30 (30)
T PF03107_consen    1 FWCDVCRRKIDGFY-FYHCSECCFTLHVRCA   30 (30)
T ss_pred             CCCCCCCCCcCCCE-eEEeCCCCCeEcCccC
Confidence            69999999999888 9999999999999997

The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF03107 C1_2: C1 domain; InterPro: IPR004146 This short domain is rich in cysteines and histidines Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02335 ZZ_ADA2 Zinc finger, ZZ type Back     alignment and domain information
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type Back     alignment and domain information
>cd02249 ZZ Zinc finger, ZZ type Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd02344 ZZ_HERC2 Zinc finger, ZZ type Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd02334 ZZ_dystrophin Zinc finger, ZZ type Back     alignment and domain information
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>PF00130 C1_1: Phorbol esters/diacylglycerol binding domain (C1 domain); InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd02345 ZZ_dah Zinc finger, ZZ type Back     alignment and domain information
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>cd02343 ZZ_EF Zinc finger, ZZ type Back     alignment and domain information
>PF00569 ZZ: Zinc finger, ZZ type; InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd02337 ZZ_CBP Zinc finger, ZZ type Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00029 C1 Protein kinase C conserved region 1 (C1) Back     alignment and domain information
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains) Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query868
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 8e-16
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-14
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 1e-09
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 1e-08
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 6e-08
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-07
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 1e-06
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 3e-04
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-04
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
 Score = 72.6 bits (178), Expect = 8e-16
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 4/76 (5%)

Query: 196 CGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDC 255
                    +   + P++V+H  H  H L L    +   Y CD C         Y CD+C
Sbjct: 12  LKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQV---YTCDKCEEEGT-IWSYHCDEC 67

Query: 256 DFDMHPECMSLKPNIK 271
           DFD+H +C   +   +
Sbjct: 68  DFDLHAKCALNEDTKE 83
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Length = 89 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query868
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.52
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 99.43
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 95.76
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 95.4
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 95.31
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 95.08
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 95.01
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 94.92
2fc7_A82 ZZZ3 protein; structure genomics, ZZ domain, struc 94.17
1tot_A52 CREB-binding protein; zinc binding, CBP, TAZ2, tra 93.6
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 93.13
2dip_A98 Zinc finger SWIM domain-containing protein 2; ZZ d 92.97
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 92.5
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 91.95
2e5r_A63 Dystrobrevin alpha; ZZ domain, structural genomics 91.92
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 91.45
1ptq_A50 Protein kinase C delta type; phosphotransferase; 1 91.34
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 91.32
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 90.66
1kbe_A49 Kinase suppressor of RAS; KSR, cysteine-rich domai 90.53
2enz_A65 NPKC-theta, protein kinase C theta type; zinc bind 90.52
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 90.5
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 90.01
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 89.45
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 89.27
3uej_A65 NPKC-delta, protein kinase C delta type; proteine 89.16
1faq_A52 RAF-1; transferase, serine/threonine-protein kinas 88.43
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 88.43
2row_A84 RHO-associated protein kinase 2; ATP-binding, coil 88.13
2fnf_X72 Putative RAS effector NORE1; zinc, signal transduc 88.11
2yuu_A83 NPKC-delta, protein kinase C delta type; metal bin 88.09
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 88.08
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 87.76
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 87.61
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 87.56
1rfh_A59 RAS association (ralgds/AF-6) domain family 5; zin 87.4
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 87.31
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 86.93
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 86.78
2eli_A85 Protein kinase C alpha type; PKC-alpha, PKC-A, str 86.49
2db6_A74 SH3 and cysteine rich domain 3; STAC3, C1 domain, 86.36
1y8f_A66 UNC-13 homolog A, MUNC13-1; cysteine-rich domain, 85.98
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 85.74
2enn_A77 NPKC-theta, protein kinase C theta type; zinc bind 85.68
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 83.6
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 82.81
4b6d_A61 RAC GTPase-activating protein 1; signaling protein 82.27
2k16_A75 Transcription initiation factor TFIID subunit 3; p 81.53
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 81.27
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 81.23
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
Probab=99.52  E-value=2.2e-15  Score=134.01  Aligned_cols=67  Identities=33%  Similarity=0.656  Sum_probs=61.4

Q ss_pred             CCccccccccCCCceecCCCCCCCceEEEecccccccccccceecccCCceEEcCCcCcccccccccCccc
Q 045873          559 CMFNIHESCAELPQEVRHPFHPRHSLTVQENTFQSRYFCDACRFDVKPGLRYRCDECDFDLHLECLSLKAN  629 (868)
Q Consensus       559 Cdf~lH~~Ca~lP~~i~H~~h~~HpL~L~~~~~~~~~~C~~C~~~~~~g~~Y~C~~C~~~lH~~Ca~~p~p  629 (868)
                      ++.+||++||++|++|+||+||+|||+|....   .++|++|++.. .+|+|+|..|+|+||+.||++|++
T Consensus        15 ~~~~lhe~Ca~lP~~i~Hp~Hp~H~L~L~~~~---~~~C~~C~~~~-~~~~Y~C~~C~f~lH~~Ca~~p~~   81 (89)
T 1v5n_A           15 IEAKYDEIAKDWPKKVKHVLHEEHELELTRVQ---VYTCDKCEEEG-TIWSYHCDECDFDLHAKCALNEDT   81 (89)
T ss_dssp             HHHHHHHHTSSSCSEECCSTTTTSCEEEECCS---SCCCTTTSCCC-CSCEEECTTTCCCCCHHHHHCSSC
T ss_pred             HHHHHhHHHHcCCceecCCCCCCCccEEeeCC---CeEeCCCCCcC-CCcEEEcCCCCCeEcHHhcCCCCc
Confidence            45799999999999999999999999998753   68999999998 899999999999999999988765
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2fc7_A ZZZ3 protein; structure genomics, ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>1tot_A CREB-binding protein; zinc binding, CBP, TAZ2, transferase; NMR {Mus musculus} SCOP: g.44.1.6 Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>2dip_A Zinc finger SWIM domain-containing protein 2; ZZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.44.1.6 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e5r_A Dystrobrevin alpha; ZZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1ptq_A Protein kinase C delta type; phosphotransferase; 1.95A {Mus musculus} SCOP: g.49.1.1 PDB: 1ptr_A* Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>1kbe_A Kinase suppressor of RAS; KSR, cysteine-rich domain, zinc- binding protein, signaling protein; NMR {Mus musculus} SCOP: g.49.1.1 PDB: 1kbf_A Back     alignment and structure
>2enz_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>3uej_A NPKC-delta, protein kinase C delta type; proteine kinase cdelta, phosphotransferase, anesthetic bindi metal binding protein; 1.30A {Mus musculus} PDB: 3ugi_A 3ugl_A 3uey_A 3ugd_A 3uff_A 1ptq_A 1ptr_A* Back     alignment and structure
>1faq_A RAF-1; transferase, serine/threonine-protein kinase, proto- oncogene, zinc, ATP-binding, phorbol-ester binding; NMR {Homo sapiens} SCOP: g.49.1.1 PDB: 1far_A Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2row_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2fnf_X Putative RAS effector NORE1; zinc, signal transduction, apoptosis, cysteine rich domain; NMR {Mus musculus} Back     alignment and structure
>2yuu_A NPKC-delta, protein kinase C delta type; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>1rfh_A RAS association (ralgds/AF-6) domain family 5; zinc, signal transduction, apoptosis, cysteine rich domain, metal binding protein; NMR {Mus musculus} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2eli_A Protein kinase C alpha type; PKC-alpha, PKC-A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db6_A SH3 and cysteine rich domain 3; STAC3, C1 domain, cystein-rich domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1y8f_A UNC-13 homolog A, MUNC13-1; cysteine-rich domain, C1-domain, zinc-binding domain, endocytosis/exocytosis,signaling protein complex; NMR {Rattus norvegicus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2enn_A NPKC-theta, protein kinase C theta type; zinc binding, DAG/PE-binding protein, diacylglycerol, phorbol ester, TCR, T-cell, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>4b6d_A RAC GTPase-activating protein 1; signaling protein, cytokinesis, plasma membrane, phospholipi centralspindlin, spindle midzone, central spindle; 2.20A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 868
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 1e-12
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 6e-12
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 4e-08
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 7e-07
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 4e-06
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 7e-06
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 1e-05
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 1e-04
d1v5na_89 g.49.1.3 (A:) Pdi-like hypothetical protein At1g60 4e-04
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure

class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 62.2 bits (151), Expect = 1e-12
 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 4/75 (5%)

Query: 199 CNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFD 258
                 +   + P++V+H  H  H L L      + Y CD C         Y CD+CDFD
Sbjct: 15  IEAKYDEIAKDWPKKVKHVLHEEHELELTR---VQVYTCDKCEEEGT-IWSYHCDECDFD 70

Query: 259 MHPECMSLKPNIKYP 273
           +H +C   +   +  
Sbjct: 71  LHAKCALNEDTKESG 85
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query868
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.61
d1v5na_89 Pdi-like hypothetical protein At1g60420 {Thale cre 99.58
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 96.0
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 95.35
d2fc7a169 Zinc finger ZZ-type-containing protein 3, ZZZ3 {Hu 94.92
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 94.78
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 94.09
d1tota152 CREB-binding protein, CBP {Mouse (Mus musculus) [T 93.96
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 93.73
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 93.45
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 93.09
d1tbna_66 Protein kinase c-gamma {Rat (Rattus rattus) [TaxId 92.91
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 92.3
d1ptqa_50 Protein kinase C-delta (PKCdelta) {Mouse (Mus musc 92.04
d2dipa185 Zinc finger ZZ-type-containing protein 2 {Human (H 91.87
d1kbea_49 Kinase suppressor of Ras, Ksr {Mouse (Mus musculus 91.05
d1xa6a362 Beta-chimaerin, middle domain {Human (Homo sapiens 91.05
d1faqa_52 RAF-1 {Human (Homo sapiens) [TaxId: 9606]} 91.01
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.58
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 87.48
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 86.18
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 83.57
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 81.55
d1r79a_84 Diacylglycerol kinase delta {Human (Homo sapiens) 80.99
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: Cysteine-rich domain
superfamily: Cysteine-rich domain
family: C1-like domain
domain: Pdi-like hypothetical protein At1g60420
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.61  E-value=5e-17  Score=141.90  Aligned_cols=77  Identities=27%  Similarity=0.510  Sum_probs=69.7

Q ss_pred             CCCcEEeccCCCccccccCCCCccccCCCCCCCceEEeecCCcccccccccccccCCCceEeCCCCCCCCCccccCCCCC
Q 045873          190 SQSYYCCGPCNFYIHKSCSELPQQVRHPFHPCHSLTLQNNDLSEWYRCDACRSYIDLGMRYRCDDCDFDMHPECMSLKPN  269 (868)
Q Consensus       190 ~~~~Y~C~~Cd~~~H~~C~~~p~~i~Hp~Hp~H~L~L~~~~~~~~~~C~~C~~~~~~g~~Y~C~~C~f~lh~~Ca~~P~~  269 (868)
                      .|..|+|.+|++.||++|+++|++|+||+||+|+|+|....   .+.|++|++.+. |++|+|.+|||+||+.||.+|.+
T Consensus         6 ~~t~~~~~e~~~~~he~c~~~P~~I~Hp~Hp~H~L~L~~~~---~~~C~~C~~~~~-g~~Y~C~~C~f~LH~~CA~~P~~   81 (89)
T d1v5na_           6 SGTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTRVQ---VYTCDKCEEEGT-IWSYHCDECDFDLHAKCALNEDT   81 (89)
T ss_dssp             CCCSSCCSHHHHHHHHHTSSSCSEECCSTTTTSCEEEECCS---SCCCTTTSCCCC-SCEEECTTTCCCCCHHHHHCSSC
T ss_pred             CchHHHHHHHHhhhhHHHhcCCCeecCCCCCCCCeEEecCC---CCEeCCCCCCcC-CcEeEeccCCCEecHHHcCCCcc
Confidence            45679999999999999999999999999999999998752   568999998654 78999999999999999999987


Q ss_pred             C
Q 045873          270 I  270 (868)
Q Consensus       270 i  270 (868)
                      +
T Consensus        82 ~   82 (89)
T d1v5na_          82 K   82 (89)
T ss_dssp             S
T ss_pred             c
Confidence            6
>d1v5na_ g.49.1.3 (A:) Pdi-like hypothetical protein At1g60420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fc7a1 g.44.1.6 (A:8-76) Zinc finger ZZ-type-containing protein 3, ZZZ3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tota1 g.44.1.6 (A:1-52) CREB-binding protein, CBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1tbna_ g.49.1.1 (A:) Protein kinase c-gamma {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ptqa_ g.49.1.1 (A:) Protein kinase C-delta (PKCdelta) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dipa1 g.44.1.6 (A:8-92) Zinc finger ZZ-type-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kbea_ g.49.1.1 (A:) Kinase suppressor of Ras, Ksr {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa6a3 g.49.1.1 (A:209-270) Beta-chimaerin, middle domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faqa_ g.49.1.1 (A:) RAF-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r79a_ g.49.1.1 (A:) Diacylglycerol kinase delta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure