Citrus Sinensis ID: 045919


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------
MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASATDDLRYSINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGLIKTKRSLDDDRGGEKKRNLNSDNENSNSFMVPTEEKGKEMNENNNGHVKKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ
ccEEEccccccHHHHHHHHHccccEEEEcccccHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHccHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHcccccccHHHHHcccc
ccccccccccHHHHHHHHcHccccEEEEEccccccEEEHHHHccHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHEEEEcccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHcc
manvdisnidsLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFflekpisfddlkyVWQHSYIYkrrskiqledarkPEQEILLNrgnisqgkrineggddvsrnianasatddlRYSINAdqneknnkqMEVDAQVhifdensvkesqNACNMEQHLVMANDQIQEQGgliktkrsldddrggekkrnlnsdnensnsfmvpteekgkemnennnghvkkkrkprivwtSELHLKFIEAVSslgdikarPKLILQkmnvpgltQRQVASHLQ
manvdisnidslsfVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEkpisfddlKYVWQHSYIYKrrskiqledarKPEQEillnrgnisqgkrineggddvsRNIANasatddlrySINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGLiktkrsldddrggekkrnlnsdnensnsfmvpteekgkemnennnghvkkkrkprivWTSELHLKFIEAVSSLGDIKARPKLILQkmnvpgltqRQVASHLQ
MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASATDDLRYSINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGLIKTKRSLDDDRGGEKKRNLNSDNENSNSFMVPTeekgkemnennngHVKKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ
*****ISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKI***********************************************************************************************************************************************************RIVWTSELHLKFIEAVSSLGDIKARPKLILQKM***************
MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKI**************************EGGDDVSRNIANASATDDLRYSINADQNEKNNKQMEVDAQVHIFDEN*****QNA**********************************************************************KRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHL*
MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASATDDLRYSINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGLIKTKR***********RNLNSDNENSNSFMVPTEEKGKEMNENNNGHVKKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLT*********
**NVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKR**************************************************************KQMEVDAQVHIFDENSVKESQ*************************************************************************RKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLT*RQV*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYKRRSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASATDDLRYSINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGLIKTKRSLDDDRGGEKKRNLNSDNENSNSFMVPTEEKGKEMNENNNGHVKKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query277 2.2.26 [Sep-21-2011]
Q6LA43 535 Two-component response re yes no 0.873 0.452 0.277 6e-13
Q940D0 690 Two-component response re no no 0.241 0.097 0.507 2e-12
Q9ZWJ9 664 Two-component response re no no 0.480 0.200 0.342 6e-12
Q9FGT7 635 Two-component response re no no 0.227 0.099 0.5 5e-10
Q8L9Y3 382 Two-component response re no no 0.184 0.133 0.588 1e-09
Q9M9B9 407 Putative two-component re no no 0.194 0.132 0.551 1e-09
O49397 552 Two-component response re no no 0.212 0.106 0.533 2e-09
Q7Y0W3341 Two-component response re N/A no 0.263 0.214 0.460 4e-09
Q7Y0W5341 Two-component response re no no 0.263 0.214 0.460 4e-09
Q9FFH0 386 Transcription activator G no no 0.187 0.134 0.576 6e-09
>sp|Q6LA43|APRR2_ARATH Two-component response regulator-like APRR2 OS=Arabidopsis thaliana GN=APRR2 PE=2 SV=2 Back     alignment and function desciption
 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 80/288 (27%), Positives = 138/288 (47%), Gaps = 46/288 (15%)

Query: 10  DSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKYVWQHSYIYK 69
           +S  F+    K+ +P I++S+      + + +  GA  FL+KP+S + LK +WQH  ++K
Sbjct: 84  ESFKFLEA-AKDVLPTIMISTDHCITTTMKCIALGAVEFLQKPLSPEKLKNIWQH-VVHK 141

Query: 70  R----RSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASATDDLRYSINA 125
                 S + +  + KP +E +++  ++     I E           A +T  L+     
Sbjct: 142 AFNDGGSNVSI--SLKPVKESVVSMLHLETDMTIEEKDP--------APSTPQLK----- 186

Query: 126 DQNEKNNKQMEVDAQVHI-FDENSVKESQNACNMEQHLVMANDQIQEQGGLIKTKRSLDD 184
               ++++ ++ D Q +I F   +V  S    NME H       I E   +  T R LDD
Sbjct: 187 ----QDSRLLDGDCQENINFSMENVNSSTEKDNMEDH-----QDIGESKSVDTTNRKLDD 237

Query: 185 DRGGEKKRNLNSD-----------NENSNSFMV-PTEEKGKEMNENN---NGHVKKKRKP 229
           D+   K+   +S+           +E ++S  +   E++ K +N+++   N    K  + 
Sbjct: 238 DKVVVKEERGDSEKEEEGETGDLISEKTDSVDIHKKEDETKPINKSSGIKNVSGNKTSRK 297

Query: 230 RIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277
           ++ WT ELH KF++AV  LG  +A P  IL+ M V  LT+  VASHLQ
Sbjct: 298 KVDWTPELHKKFVQAVEQLGVDQAIPSRILELMKVGTLTRHNVASHLQ 345




Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'.
Arabidopsis thaliana (taxid: 3702)
>sp|Q940D0|ARR1_ARATH Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZWJ9|ARR2_ARATH Two-component response regulator ARR2 OS=Arabidopsis thaliana GN=ARR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FGT7|ARR18_ARATH Two-component response regulator ARR18 OS=Arabidopsis thaliana GN=ARR18 PE=2 SV=2 Back     alignment and function description
>sp|Q8L9Y3|ARR14_ARATH Two-component response regulator ARR14 OS=Arabidopsis thaliana GN=ARR14 PE=1 SV=2 Back     alignment and function description
>sp|Q9M9B9|ARR19_ARATH Putative two-component response regulator ARR19 OS=Arabidopsis thaliana GN=ARR19 PE=2 SV=2 Back     alignment and function description
>sp|O49397|ARR10_ARATH Two-component response regulator ARR10 OS=Arabidopsis thaliana GN=ARR10 PE=1 SV=1 Back     alignment and function description
>sp|Q7Y0W3|EHD1_ORYSI Two-component response regulator EHD1 OS=Oryza sativa subsp. indica PE=2 SV=1 Back     alignment and function description
>sp|Q7Y0W5|EHD1_ORYSJ Two-component response regulator EHD1 OS=Oryza sativa subsp. japonica GN=EHD1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FFH0|GLK2_ARATH Transcription activator GLK2 OS=Arabidopsis thaliana GN=GLK2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
449503419 557 PREDICTED: uncharacterized protein LOC10 0.837 0.416 0.342 4e-27
449458817 607 PREDICTED: uncharacterized protein LOC10 0.837 0.382 0.342 4e-27
297737760 500 unnamed protein product [Vitis vinifera] 0.844 0.468 0.334 2e-18
224108401295 predicted protein [Populus trichocarpa] 0.787 0.738 0.297 7e-16
255570679 549 hypothetical protein RCOM_0577360 [Ricin 0.184 0.092 0.725 7e-14
224138036 448 pseudo response regulator [Populus trich 0.967 0.598 0.286 2e-13
326515596 580 predicted protein [Hordeum vulgare subsp 0.685 0.327 0.248 3e-13
168009967193 predicted protein [Physcomitrella patens 0.487 0.699 0.335 2e-12
356540587 570 PREDICTED: two-component response regula 0.978 0.475 0.300 1e-11
225427316 557 PREDICTED: two-component response regula 0.967 0.481 0.262 1e-11
>gi|449503419|ref|XP_004161993.1| PREDICTED: uncharacterized protein LOC101230585 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  127 bits (320), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 98/286 (34%), Positives = 141/286 (49%), Gaps = 54/286 (18%)

Query: 1   MANVDISNIDSLSFVRVLVKEEIPIILMSSRRNEIFSWRALVEGACFFLEKPISFDDLKY 60
           MANV + ++DS SF+ VL+K  I +I MSS  N   + +AL EGAC+FL+KPIS  DLKY
Sbjct: 74  MANVSMPDMDSFSFLHVLLKMNIAVIFMSSGMNLSVATKALAEGACYFLQKPISRGDLKY 133

Query: 61  VWQHSY-----IYKRRSKIQLEDARKPEQEILLNRGNISQGKRINEGGDDVSRNIANASA 115
           +WQH Y     I K+  K    +  KP +E        S G +I +    +SR+ A  S 
Sbjct: 134 MWQHVYRWNRNITKQTYKANCIETAKPRKE--------SVGIQITDAV-VLSRSAAAVS- 183

Query: 116 TDDLRYSINADQNEKNNKQMEVDAQVHIFDENSVKESQNACNMEQHLVMANDQIQEQGGL 175
                Y+ N   N K  +  E D  V I   +S+                       G  
Sbjct: 184 -----YNNNCCINYKPMENKEKDKSVQIGSHDSL----------------------VGSF 216

Query: 176 IKTKRSLDDDRGGEKKRNLNSDNENSNSFMVPTEEKGKEMNENN----NGHVKKKRKPRI 231
              KR  DD  G  +++ +   +E       PT+     ++E++      ++    + R+
Sbjct: 217 FGGKRLSDDIEGISREKRVKYYSE-------PTKFGFSRIDEDHERRKEYYIASDSRTRV 269

Query: 232 VWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277
           VW +E   KF +A++ LGD K+RPKLIL+ MN P LT RQVA+HLQ
Sbjct: 270 VWNAERRRKFTDALNKLGD-KSRPKLILKMMNEPCLTLRQVANHLQ 314




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449458817|ref|XP_004147143.1| PREDICTED: uncharacterized protein LOC101203501 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297737760|emb|CBI26961.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224108401|ref|XP_002314834.1| predicted protein [Populus trichocarpa] gi|222863874|gb|EEF01005.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255570679|ref|XP_002526294.1| hypothetical protein RCOM_0577360 [Ricinus communis] gi|223534375|gb|EEF36083.1| hypothetical protein RCOM_0577360 [Ricinus communis] Back     alignment and taxonomy information
>gi|224138036|ref|XP_002326502.1| pseudo response regulator [Populus trichocarpa] gi|222833824|gb|EEE72301.1| pseudo response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|326515596|dbj|BAK07044.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|168009967|ref|XP_001757676.1| predicted protein [Physcomitrella patens subsp. patens] gi|162690952|gb|EDQ77316.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information
>gi|356540587|ref|XP_003538769.1| PREDICTED: two-component response regulator-like APRR2-like [Glycine max] Back     alignment and taxonomy information
>gi|225427316|ref|XP_002279150.1| PREDICTED: two-component response regulator-like APRR2 [Vitis vinifera] gi|297742160|emb|CBI33947.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query277
TAIR|locus:2093668 690 RR1 "response regulator 1" [Ar 0.184 0.073 0.627 1.7e-18
TAIR|locus:2199342 755 APRR6 "pseudo-response regulat 0.577 0.211 0.289 1.6e-17
TAIR|locus:2040194 596 RR12 "response regulator 12" [ 0.187 0.087 0.596 8.6e-16
TAIR|locus:2116587 552 RR10 "response regulator 10" [ 0.187 0.094 0.576 1.6e-15
TAIR|locus:2065398 382 RR14 "response regulator 14" [ 0.184 0.133 0.588 1.7e-14
TAIR|locus:2008585 521 ARR11 "response regulator 11" 0.184 0.097 0.596 1.4e-13
TAIR|locus:2141020 535 APRR2 [Arabidopsis thaliana (t 0.880 0.456 0.272 1.8e-13
TAIR|locus:2130095 664 RR2 "response regulator 2" [Ar 0.494 0.206 0.324 1.1e-11
UNIPROTKB|Q7Y0W3341 Q7Y0W3 "Two-component response 0.180 0.146 0.58 5.5e-11
UNIPROTKB|Q7Y0W5341 EHD1 "Two-component response r 0.180 0.146 0.58 5.5e-11
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 1.7e-18, Sum P(2) = 1.7e-18
 Identities = 32/51 (62%), Positives = 40/51 (78%)

Query:   227 RKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277
             +KPR+VW+ ELH +F+ AV+ LG  KA PK IL+ MNVPGLT+  VASHLQ
Sbjct:   236 KKPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQ 286


GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;IDA
GO:0009736 "cytokinin mediated signaling pathway" evidence=IGI;RCA;TAS
GO:0009735 "response to cytokinin stimulus" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0010380 "regulation of chlorophyll biosynthetic process" evidence=IGI
GO:0031537 "regulation of anthocyanin metabolic process" evidence=IGI;RCA
GO:0048367 "shoot system development" evidence=IGI
GO:0080022 "primary root development" evidence=IGI
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0010029 "regulation of seed germination" evidence=RCA
GO:0010043 "response to zinc ion" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0048831 "regulation of shoot system development" evidence=RCA
TAIR|locus:2199342 APRR6 "pseudo-response regulator 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065398 RR14 "response regulator 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141020 APRR2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W3 Q7Y0W3 "Two-component response regulator EHD1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Y0W5 EHD1 "Two-component response regulator EHD1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 2e-13
PLN03162 526 PLN03162, PLN03162, golden-2 like transcription fa 3e-10
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 7e-04
pfam00072111 pfam00072, Response_reg, Response regulator receiv 0.002
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
 Score = 63.6 bits (155), Expect = 2e-13
 Identities = 30/51 (58%), Positives = 37/51 (72%), Gaps = 1/51 (1%)

Query: 228 KPRIVWTSELHLKFIEAVSSLGDI-KARPKLILQKMNVPGLTQRQVASHLQ 277
           KPR+VWT +LH +F++AV  LG    A PK IL+ M V GLT+ QVASHLQ
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQ 51


This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57

>gnl|CDD|178707 PLN03162, PLN03162, golden-2 like transcription factor; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 277
PLN03162 526 golden-2 like transcription factor; Provisional 99.86
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.78
COG0745229 OmpR Response regulators consisting of a CheY-like 99.25
COG4566202 TtrR Response regulator [Signal transduction mecha 99.11
COG2204 464 AtoC Response regulator containing CheY-like recei 98.98
COG4565224 CitB Response regulator of citrate/malate metaboli 98.9
PF00072112 Response_reg: Response regulator receiver domain; 98.86
COG4753 475 Response regulator containing CheY-like receiver d 98.84
COG3437360 Response regulator containing a CheY-like receiver 98.72
COG2197211 CitB Response regulator containing a CheY-like rec 98.7
PRK10046225 dpiA two-component response regulator DpiA; Provis 98.68
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 98.65
PLN03029222 type-a response regulator protein; Provisional 98.62
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 98.61
PRK11173237 two-component response regulator; Provisional 98.57
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 98.56
COG3706435 PleD Response regulator containing a CheY-like rec 98.54
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 98.54
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 98.54
PRK09836227 DNA-binding transcriptional activator CusR; Provis 98.53
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 98.53
KOG0519786 consensus Sensory transduction histidine kinase [S 98.52
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 98.49
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 98.48
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 98.47
PRK09581457 pleD response regulator PleD; Reviewed 98.46
PRK10693303 response regulator of RpoS; Provisional 98.46
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 98.45
PRK09468239 ompR osmolarity response regulator; Provisional 98.45
PRK11517223 transcriptional regulatory protein YedW; Provision 98.45
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 98.43
PRK13856241 two-component response regulator VirG; Provisional 98.43
PRK10161229 transcriptional regulator PhoB; Provisional 98.42
CHL00148240 orf27 Ycf27; Reviewed 98.41
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 98.41
PRK11083228 DNA-binding response regulator CreB; Provisional 98.4
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 98.39
PRK10840216 transcriptional regulator RcsB; Provisional 98.37
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 98.36
PRK09935210 transcriptional regulator FimZ; Provisional 98.32
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 98.31
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 98.3
PRK09483217 response regulator; Provisional 98.27
COG4567182 Response regulator consisting of a CheY-like recei 98.26
PRK14084246 two-component response regulator; Provisional 98.25
PRK10841924 hybrid sensory kinase in two-component regulatory 98.24
TIGR02915 445 PEP_resp_reg putative PEP-CTERM system response re 98.23
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 98.22
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 98.2
PRK15479221 transcriptional regulatory protein TctD; Provision 98.19
PRK15347921 two component system sensor kinase SsrA; Provision 98.14
PRK15115 444 response regulator GlrR; Provisional 98.14
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 98.13
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 98.13
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisiona 98.11
TIGR01818 463 ntrC nitrogen regulation protein NR(I). This model 98.11
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; P 98.1
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 98.1
PRK10365 441 transcriptional regulatory protein ZraR; Provision 98.09
PRK11697238 putative two-component response-regulatory protein 98.09
COG3947361 Response regulator containing CheY-like receiver a 98.09
PRK10610129 chemotaxis regulatory protein CheY; Provisional 98.08
PRK09581 457 pleD response regulator PleD; Reviewed 98.06
PRK10403215 transcriptional regulator NarP; Provisional 98.05
PRK15369211 two component system sensor kinase SsrB; Provision 98.05
PRK10651216 transcriptional regulator NarL; Provisional 98.01
PRK099591197 hybrid sensory histidine kinase in two-component r 97.98
PRK09390202 fixJ response regulator FixJ; Provisional 97.97
PRK12555337 chemotaxis-specific methylesterase; Provisional 97.9
PRK11091779 aerobic respiration control sensor protein ArcB; P 97.86
PRK13435145 response regulator; Provisional 97.83
cd00156113 REC Signal receiver domain; originally thought to 97.7
PRK13558 665 bacterio-opsin activator; Provisional 97.68
PRK00742354 chemotaxis-specific methylesterase; Provisional 97.62
COG3707194 AmiR Response regulator with putative antiterminat 97.61
PRK09191261 two-component response regulator; Provisional 97.56
PRK13837828 two-component VirA-like sensor kinase; Provisional 97.18
PRK13557540 histidine kinase; Provisional 97.15
COG2201350 CheB Chemotaxis response regulator containing a Ch 97.1
PRK15411207 rcsA colanic acid capsular biosynthesis activation 97.04
COG3279244 LytT Response regulator of the LytR/AlgR family [T 96.65
COG3706 435 PleD Response regulator containing a CheY-like rec 96.6
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 96.26
smart0042668 TEA TEA domain. 94.11
PRK15029 755 arginine decarboxylase; Provisional 92.14
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 90.57
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 87.79
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
Probab=99.86  E-value=2.7e-22  Score=187.96  Aligned_cols=56  Identities=46%  Similarity=0.678  Sum_probs=53.3

Q ss_pred             CCCCCCCCccccChHHHHHHHHHHHhcCCCCCCcHHHHhhcCCCCCCHHHHhhccC
Q 045919          222 HVKKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ  277 (277)
Q Consensus       222 ~~~~~~k~r~~Wt~~lh~~Fv~av~~lg~~~a~pk~il~~m~v~~lt~~~v~shlq  277 (277)
                      .....||+||+||+|||++||+||++||+++||||+||++|+|+||||+|||||||
T Consensus       229 ~~~g~KKpRLrWTpELH~rFVeAV~qLG~dKATPK~ILelMnV~GLTRenVKSHLQ  284 (526)
T PLN03162        229 AAPGKKKAKVDWTPELHRRFVHAVEQLGVEKAFPSRILELMGVQCLTRHNIASHLQ  284 (526)
T ss_pred             cCCCCCCCcccCCHHHHHHHHHHHHHhCcCccchHHHHHHcCCCCcCHHHHHHHHH
Confidence            33457999999999999999999999999999999999999999999999999998



>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
1irz_A64 Solution Structure Of Arr10-B Belonging To The Garp 5e-09
>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family Of Plant Myb-Related Dna Binding Motifs Of The Arabidopsis Response Regulators Length = 64 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 5e-09, Method: Composition-based stats. Identities = 30/52 (57%), Positives = 37/52 (71%) Query: 226 KRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277 ++KPR++WT ELH KF+ AV LG +A PK IL MNV LT+ VASHLQ Sbjct: 3 QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQ 54

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query277
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 9e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
 Score = 77.3 bits (190), Expect = 9e-19
 Identities = 30/52 (57%), Positives = 37/52 (71%)

Query: 226 KRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277
           ++KPR++WT ELH KF+ AV  LG  +A PK IL  MNV  LT+  VASHLQ
Sbjct: 3   QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQ 54


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.94
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.44
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.18
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.16
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.15
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.14
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.14
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.1
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.09
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.07
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.07
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.06
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.05
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.05
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.04
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.04
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.04
3luf_A259 Two-component system response regulator/ggdef doma 99.03
1xhf_A123 DYE resistance, aerobic respiration control protei 99.03
3jte_A143 Response regulator receiver protein; structural ge 99.02
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.02
4dad_A146 Putative pilus assembly-related protein; response 99.02
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.01
3rqi_A184 Response regulator protein; structural genomics, s 99.01
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.01
3r0j_A250 Possible two component system response transcript 99.01
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.01
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.0
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.0
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 98.99
3hdg_A137 Uncharacterized protein; two-component sensor acti 98.99
3heb_A152 Response regulator receiver domain protein (CHEY); 98.99
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 98.99
3gt7_A154 Sensor protein; structural genomics, signal receiv 98.98
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 98.98
2lpm_A123 Two-component response regulator; transcription re 98.98
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 98.98
2zay_A147 Response regulator receiver protein; structural ge 98.97
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 98.97
1dz3_A130 Stage 0 sporulation protein A; response regulator, 98.97
3eul_A152 Possible nitrate/nitrite response transcriptional 98.97
3lua_A140 Response regulator receiver protein; two-component 98.96
3snk_A135 Response regulator CHEY-like protein; P-loop conta 98.96
3f6c_A134 Positive transcription regulator EVGA; structural 98.95
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 98.95
1mvo_A136 PHOP response regulator; phosphate regulon, transc 98.95
1mb3_A124 Cell division response regulator DIVK; signal tran 98.94
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 98.93
3hdv_A136 Response regulator; PSI-II, structural genomics, P 98.93
3cnb_A143 DNA-binding response regulator, MERR family; signa 98.93
3nhm_A133 Response regulator; protein structure initiative I 98.93
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 98.93
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 98.93
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 98.92
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 98.92
1yio_A208 Response regulatory protein; transcription regulat 98.92
3h5i_A140 Response regulator/sensory box protein/ggdef domai 98.91
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 98.9
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 98.9
3grc_A140 Sensor protein, kinase; protein structure initiati 98.9
2ayx_A254 Sensor kinase protein RCSC; two independent struct 98.89
3cg0_A140 Response regulator receiver modulated diguanylate 98.88
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 98.88
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 98.87
1s8n_A205 Putative antiterminator; RV1626, structural genomi 98.87
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 98.87
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.86
3q9s_A249 DNA-binding response regulator; DNA binding protei 98.86
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 98.86
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 98.86
3n53_A140 Response regulator receiver modulated diguanylate; 98.86
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 98.85
1w25_A 459 Stalked-cell differentiation controlling protein; 98.84
2rjn_A154 Response regulator receiver:metal-dependent phosph 98.84
2qxy_A142 Response regulator; regulation of transcription, N 98.84
3cz5_A153 Two-component response regulator, LUXR family; str 98.83
3n0r_A286 Response regulator; sigma factor, receiver, two-co 98.82
3i42_A127 Response regulator receiver domain protein (CHEY- 98.82
3c3m_A138 Response regulator receiver protein; structural ge 98.81
2qr3_A140 Two-component system response regulator; structura 98.81
3cg4_A142 Response regulator receiver domain protein (CHEY-; 98.8
3bre_A358 Probable two-component response regulator; protein 98.79
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 98.78
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.78
2qv0_A143 Protein MRKE; structural genomics, transcription, 98.78
3eqz_A135 Response regulator; structural genomics, unknown f 98.78
1ys7_A233 Transcriptional regulatory protein PRRA; response 98.77
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 98.76
3eq2_A394 Probable two-component response regulator; adaptor 98.75
3a10_A116 Response regulator; phosphoacceptor, signaling pro 98.74
3lte_A132 Response regulator; structural genomics, PSI, prot 98.73
2oqr_A230 Sensory transduction protein REGX3; response regul 98.73
2gwr_A238 DNA-binding response regulator MTRA; two-component 98.72
2qsj_A154 DNA-binding response regulator, LUXR family; struc 98.72
3c3w_A225 Two component transcriptional regulatory protein; 98.68
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 98.68
3luf_A259 Two-component system response regulator/ggdef doma 98.67
2gkg_A127 Response regulator homolog; social motility, recei 98.65
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 98.64
2pln_A137 HP1043, response regulator; signaling protein; 1.8 98.62
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 98.59
2rdm_A132 Response regulator receiver protein; structural ge 98.55
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 98.53
3c97_A140 Signal transduction histidine kinase; structural g 98.5
2hqr_A223 Putative transcriptional regulator; phosporylation 98.48
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 98.45
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 98.35
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 98.3
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 98.18
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 98.12
1w25_A459 Stalked-cell differentiation controlling protein; 97.94
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 92.4
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 91.65
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 91.16
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
Probab=99.94  E-value=8.1e-28  Score=174.65  Aligned_cols=54  Identities=56%  Similarity=0.824  Sum_probs=52.4

Q ss_pred             CCCCCCccccChHHHHHHHHHHHhcCCCCCCcHHHHhhcCCCCCCHHHHhhccC
Q 045919          224 KKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ  277 (277)
Q Consensus       224 ~~~~k~r~~Wt~~lh~~Fv~av~~lg~~~a~pk~il~~m~v~~lt~~~v~shlq  277 (277)
                      ++.+|+|++||+|||++||+||++||.++||||+||++|+|+|||++|||||||
T Consensus         1 ~~~~k~r~~WT~elH~~Fv~Av~~LG~~~AtPk~Il~~M~v~gLT~~~VkSHLQ   54 (64)
T 1irz_A            1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQ   54 (64)
T ss_dssp             CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHH
T ss_pred             CCCCCCCCcCCHHHHHHHHHHHHHhCCCCCCcHHHHHHcCCCCCCHHHHHHHHH
Confidence            467999999999999999999999999999999999999999999999999998



>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 277
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 4e-18
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 0.001
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 0.001
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 0.002
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 0.004
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 74.6 bits (183), Expect = 4e-18
 Identities = 30/52 (57%), Positives = 37/52 (71%)

Query: 226 KRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ 277
           ++KPR++WT ELH KF+ AV  LG  +A PK IL  MNV  LT+  VASHLQ
Sbjct: 3   QKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQ 54


>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query277
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.9
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.44
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.43
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.41
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.41
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.41
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.39
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.39
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.39
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.38
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.37
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.37
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.36
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.36
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.35
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.35
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.35
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.35
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.34
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.34
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.33
d1s8na_190 Probable two-component system transcriptional regu 99.33
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.32
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.32
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.32
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.31
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.31
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.31
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.3
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.29
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.25
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.21
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.01
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 98.88
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 98.75
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.90  E-value=3.3e-25  Score=159.46  Aligned_cols=54  Identities=56%  Similarity=0.824  Sum_probs=52.3

Q ss_pred             CCCCCCccccChHHHHHHHHHHHhcCCCCCCcHHHHhhcCCCCCCHHHHhhccC
Q 045919          224 KKKRKPRIVWTSELHLKFIEAVSSLGDIKARPKLILQKMNVPGLTQRQVASHLQ  277 (277)
Q Consensus       224 ~~~~k~r~~Wt~~lh~~Fv~av~~lg~~~a~pk~il~~m~v~~lt~~~v~shlq  277 (277)
                      +..+|+|++||+|||++||+||++||.+.|+||.||++|+|+|||++||+||||
T Consensus         1 s~~kk~R~~WT~elH~~Fv~Av~~lG~~~atpk~I~~~m~v~~lT~~qV~SHlQ   54 (64)
T d1irza_           1 TAQKKPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQ   54 (64)
T ss_dssp             CCCCCSSCSSCHHHHHHHHHHHHHHCTTTCCHHHHHHHHCCTTCCHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHhCccccchHHHHHHcCCCCCCHHHHHHHHH
Confidence            457999999999999999999999999999999999999999999999999998



>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure