Citrus Sinensis ID: 045967

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------93
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHEEEEEEEAESSSSWFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
cccEEEEEEEEEEEEcccccHHHcHHHHHcccccccEEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEccccccEEccccHHHccccccccEEEcccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccEEEcccccccccccccccEEEcccccccccccHHHcccccccEEEccccccEEEccccccccccEEEcccccccccccHHHHccccccEEEccccccEEEEccHHccccccccEEEccccccEEEcccccccccccccEEEccccccccccHHccccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccEEEcccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEEEccccEEEEcccHHHHHcccccEEEcccccccccccccccccccccEEEcccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccccEEEEEEEEEEcccHHHHHccccccEEEEcccccccccccHHHHHHccccccccccccccccccHHHHccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccEEEEEEEEEEEEEEEEEHHHHHHHHccccEEEEEEcccccccc
ccEEEEEEEEEEEHHHHHHHHHHHHHHEEEEEcHHHHHHccccccccccccHHHccHHHHHHHHHHHHccccccccccEEEEEEEEccccccccccHHHccccccHHccccccccccccccccccccccEEEccccEEEcccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEccccccEEcccccHHHcccccccEEEcccccccccccHHHcccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccEEEEEccccccccccccccccccEEEEccccccccccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccEEEEEccccccccccHHHHcccccEEEEcccccccccccHHHHccccccEEEEcccccccccccHHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHHccccccEEEEEcccccccccccccccccEEEEcccccccccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEEcccccccccccHHHHcccccEEEEcccccccccccHHHccccccEEEEEccccccccccEEEcccccccccccHHHHHHHHHHHcccccccccccccccEEEEcccccccccccHHHcccccEEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccccccHHHccHHHcccccEEEccccccccccccccccccccccHHHcccccccccEEEEEEEcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccc
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVteslslisppcallppvsiaFPLASLLFLLLTEAflsgphrrrqnidarfwlpslprlgTLLDklyhdqdlssnglmpltgvrprewhirgraeyscsfspatrllqdthvrrtlppnicSSRLVLLLHSLSyakhcpheqsSALIQFKQlfsfdgdssfvcqhsypkmiswkkdtnycswdgltcdmatvsLETPVFQALVQNMTKLQVLSLASLEMStvvpdslknlssslTFSELANSIGNLKLLGRLMLGysqfvgpvpaslgnltQLTLLHLMHNnfsshipsslsnlvqltcldlsgnsfvgeipdivnlTQVSffdlsnnqlagpvpsheMLIRLnnnslsgtipswlfslplleyvrlsdnqlsghidefpskslqniylsnnrlqgsipsSIFELVNLIdlqldsnnfsgiaEPYMFAKLIKLKYLYIshnslslgttfkidipfpkfsylslfacnisafpsflrtQDKLFYldlseskidgqiprwISKIGKDSLSYLNLSHNFITKMKQISWKNlgyldlrsnllqgplpvppsreIIHSICDIIALdvldlsnnrlsgtipecignfspwLSVSLNlnnneleganpqslvnctklevldignnkindvfpywlgnlpeLRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNvgadegklrylgeeyyqdSVVVTLKGTEIELQKILTVFTtidfssngfdgeISQVIGKLHSLRLLNLthnhftgkipsslgnlaklesldlssnnlagkipkqlaSLTSLSVLnishnrldgpipqgpqfntiqedsyignlglcgfsltkkygndeapttfheeeeeeeaesssswfdWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLseskidgqiprWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHEEEEEeeaesssswfdWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVsiafplasllflllteaflsGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICssrlvlllhslsYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASlgnltqltllhlmhnnFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWlsvslnlnnneleGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHeeeeeeeaessssWFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
***************************LAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLE***********KIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKY***********************WFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTW****
**RMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLN**************LGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSL***************************WFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQS**
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDE******************SWFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKY*********************SSWFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQ***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SWRMVVRVSICFSIRSIRSNIAFSRASLAISLSVTESLSLISPPCALLPPVSIAFPLASLLFLLLTEAFLSGPHRRRQNIDARFWLPSLPRLGTLLDKLYHDQDLSSNGLMPLTGVRPREWHIRGRAEYSCSFSPATRLLQDTHVRRTLPPNICSSRLVLLLHSLSYAKHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSHEMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHEEEEEEEAESSSSWFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query929 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.673 0.739 0.346 1e-100
C0LGQ5 1249 LRR receptor-like serine/ no no 0.660 0.491 0.317 1e-58
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.650 0.482 0.307 3e-57
Q9FL28 1173 LRR receptor-like serine/ no no 0.668 0.529 0.298 2e-55
C0LGS2 1136 Probable LRR receptor-lik no no 0.558 0.456 0.335 6e-54
Q9SHI3729 Receptor-like protein 2 O no no 0.621 0.791 0.292 3e-51
Q9C7S5 1095 Tyrosine-sulfated glycope no no 0.611 0.518 0.286 4e-51
Q8VZG8 1045 Probable LRR receptor-lik no no 0.634 0.563 0.275 7e-51
Q9LP24 1120 Probable leucine-rich rep no no 0.668 0.554 0.277 1e-50
C0LGF5 1072 Probable LRR receptor-lik no no 0.654 0.567 0.328 2e-50
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  365 bits (938), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 262/756 (34%), Positives = 385/756 (50%), Gaps = 130/756 (17%)

Query: 234 ALVQNMTKLQVLSLASLEMSTVVPDSLKNLS--------SSLTFSELANSIGNLKLLGRL 285
           A + N+ +L+ L LA+  ++  +P SL NLS        S+    ++ +SIG+LK L  L
Sbjct: 152 ASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNL 211

Query: 286 MLGYSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGEIP 345
            L  +  +G +P+SLGNL+ L  L L HN     +P+S+ NL++L  +    NS  G IP
Sbjct: 212 SLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIP 271

Query: 346 -DIVNLTQVSFFDLSNNQLAGPVPSHEMLIR------LNNNSLSGTIPSWLFSLPLLEYV 398
               NLT++S F LS+N      P    +        ++ NS SG  P  L  +P LE +
Sbjct: 272 ISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESI 331

Query: 399 RLSDNQLSGHIDEFPSKS----LQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGI 454
            L +NQ +G I EF + S    LQ++ L  NRL G IP SI  L+NL +L +  NNF+G 
Sbjct: 332 YLQENQFTGPI-EFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTG- 389

Query: 455 AEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKL 514
           A P   +KL+                                                 L
Sbjct: 390 AIPPTISKLVN------------------------------------------------L 401

Query: 515 FYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQISWKN--LGYLDLRSNLLQ 572
            +LDLS++ ++G++P  + +     L+ + LSHN  +  +  S +   +  LDL SN  Q
Sbjct: 402 LHLDLSKNNLEGEVPACLWR-----LNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQ 456

Query: 573 GPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLS------------- 619
           GP+P        + IC + +L  LDLSNN  SG+IP CI NFS  +              
Sbjct: 457 GPIP--------YMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTL 508

Query: 620 ----------VSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRV 669
                     VSL++++N+LEG  P+SL+NC  LE++++ +NKI D+FP WL +LP L V
Sbjct: 509 PDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHV 568

Query: 670 LVLRSNKLRG------------SLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKL- 716
           L LRSNK  G            SLRI+D+S NNFSG LP  +F     M  +  +  +  
Sbjct: 569 LNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYM 628

Query: 717 ----RYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRL 772
               RY  + YY +  +V  KG ++  ++I   F  IDFS N  +G I + +G L  LR+
Sbjct: 629 TEFWRY-ADSYYHEMEMVN-KGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRV 686

Query: 773 LNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPI 832
           LNL+ N FT  IP  L NL KLE+LD+S N L+G+IP+ LA+L+ LS +N SHN L GP+
Sbjct: 687 LNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPV 746

Query: 833 PQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHEEEEEEEAESSSSWFDWKFAK 892
           P+G QF   +  S++ N GL G     +      PT+   +  E+ +E+  + F+W  A 
Sbjct: 747 PRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTS---QLPEDLSEAEENMFNWVAAA 803

Query: 893 IGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSK 928
           I YG G++ G+ IG+  + S    WF +     Q K
Sbjct: 804 IAYGPGVLCGLVIGHF-YTSHNHEWFTEKFGRKQHK 838
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI3|RLP2_ARATH Receptor-like protein 2 OS=Arabidopsis thaliana GN=RLP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query929
2254621161001 PREDICTED: receptor-like protein 12-like 0.723 0.671 0.495 1e-176
224116970921 predicted protein [Populus trichocarpa] 0.738 0.744 0.439 1e-161
359493479814 PREDICTED: receptor-like protein 12-like 0.743 0.848 0.452 1e-160
225455498980 PREDICTED: receptor-like protein 12-like 0.682 0.646 0.477 1e-154
225459979979 PREDICTED: receptor-like protein 12-like 0.674 0.640 0.474 1e-152
147793123951 hypothetical protein VITISV_032542 [Viti 0.659 0.644 0.479 1e-151
359493544978 PREDICTED: receptor-like protein 12-like 0.706 0.670 0.469 1e-150
359493546985 PREDICTED: LRR receptor-like serine/thre 0.670 0.632 0.459 1e-147
3594935391001 PREDICTED: receptor-like protein 12-like 0.696 0.646 0.455 1e-146
2555680901014 serine/threonine-protein kinase bri1, pu 0.724 0.663 0.436 1e-139
>gi|225462116|ref|XP_002263233.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  626 bits (1615), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 365/736 (49%), Positives = 469/736 (63%), Gaps = 64/736 (8%)

Query: 244 VLSLASLEMSTVVPDSLK--------NLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGP 295
           +L L+S   S  +P S+         +LSS+    EL +SIG+LK L  L L +  F G 
Sbjct: 264 LLDLSSTNFSGELPSSIGILKSLESLDLSSTKFSGELPSSIGSLKSLESLDLSHCNFSGS 323

Query: 296 VPASLGNLTQLTLLHLMHNNFSSHIPSSLSNLVQLTCLDLSGNSFVGE-IPDIVNLTQVS 354
           +P+ LGNLTQ+T L L  N F   I +  + + +L  LDLS NSF G+ I  + NLT++S
Sbjct: 324 IPSVLGNLTQITHLDLSRNQFDGEISNVFNKIRKLIVLDLSSNSFRGQFIASLDNLTELS 383

Query: 355 FFDLSNNQLAGPVPSHEML------IRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGH 408
           F DLSNN L G +PSH         I L+NN L+GTIPSWLFSLP L  + LS N+L+GH
Sbjct: 384 FLDLSNNNLEGIIPSHVKELSSLSDIHLSNNLLNGTIPSWLFSLPSLIRLDLSHNKLNGH 443

Query: 409 IDEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKY 468
           IDEF S SL++I LS+N L G +PSSIFELVNL  LQL SNN  GI E  MF  L  L Y
Sbjct: 444 IDEFQSPSLESIDLSSNELDGPVPSSIFELVNLTYLQLSSNNLGGIVETDMFMNLENLVY 503

Query: 469 LYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQI 528
           L +S+N L+L      +   P    L L +CNIS FP FL +Q+ L +LDLS +KI GQ+
Sbjct: 504 LDLSYNILTLSNYSHSNCALPFLETLLLSSCNISEFPRFLCSQEVLEFLDLSNNKIYGQL 563

Query: 529 PRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSIC 588
           P+W   +G ++LSY NLS N +T+ ++  WKN+ +LDL SNLLQGPLP          IC
Sbjct: 564 PKWAWNMGTETLSYFNLSQNLLTRFERFPWKNMLFLDLHSNLLQGPLP--------SLIC 615

Query: 589 DIIALDVLDLSNNRLSGTIPECIGNFSPWLSV-----------------------SLNLN 625
           ++  + VLD SNN LSG IP+C+GNFS  LSV                       +L  N
Sbjct: 616 EMSYISVLDFSNNNLSGLIPQCLGNFSESLSVLDLRMNQLHGNIPETFSKGNFIRNLGFN 675

Query: 626 NNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRG------ 679
            N+LEG  P+SL+NC +L+VLD+GNN+IND FPYWL  LPEL+VL+LRSN+  G      
Sbjct: 676 GNQLEGPLPRSLINCRRLQVLDLGNNRINDTFPYWLETLPELQVLILRSNRFHGHISGSN 735

Query: 680 ------SLRILDLSINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLK 733
                  LRI+DLS N+FSG LP  + +   AM NV  D+ KL+Y+GE YY+DS++ T+K
Sbjct: 736 FQFPFPKLRIMDLSRNDFSGSLPEMYLKNFKAMMNVTEDKMKLKYMGEYYYRDSIMGTIK 795

Query: 734 GTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAK 793
           G + E   IL+ FTTID SSN F GEI   IG L SLR LNL+HN+ TG IPSSLGNL  
Sbjct: 796 GFDFEFV-ILSTFTTIDLSSNRFQGEILDFIGSLSSLRELNLSHNNLTGHIPSSLGNLMV 854

Query: 794 LESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLC 853
           LESLDLSSN L+G+IP++L SLT L VLN+S N L G IP+G QF+T   +SY GN+GLC
Sbjct: 855 LESLDLSSNKLSGRIPRELTSLTFLEVLNLSKNHLTGVIPRGNQFDTFANNSYSGNIGLC 914

Query: 854 GFSLTKKYGNDEAPTTFHEEEEEEEAESSSSWFDWKFAKIGYGSGLVIGMSIGYMVFASG 913
           G  L+KK   DEAP    +  +EEE ES +  FDWK   +GYG GLV+G+ +G +VF + 
Sbjct: 915 GLPLSKKCVVDEAP----QPPKEEEVESDTG-FDWKVILMGYGCGLVVGLFMGCLVFLTR 969

Query: 914 EPLWFMKMVVTWQSKK 929
           +P WF+ M+   + KK
Sbjct: 970 KPKWFVTMIEGDRHKK 985

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224116970|ref|XP_002331797.1| predicted protein [Populus trichocarpa] gi|222874493|gb|EEF11624.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493479|ref|XP_003634609.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455498|ref|XP_002264793.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225459979|ref|XP_002267546.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147793123|emb|CAN75335.1| hypothetical protein VITISV_032542 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493544|ref|XP_002267509.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493546|ref|XP_002267585.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493539|ref|XP_002267388.2| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255568090|ref|XP_002525021.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223535683|gb|EEF37348.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query929
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.689 0.732 0.333 4.2e-79
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.736 0.843 0.330 4.2e-79
TAIR|locus:2825389784 RLP11 "AT1G71390" [Arabidopsis 0.756 0.896 0.326 3.8e-78
TAIR|locus:2085537894 RLP34 "AT3G11010" [Arabidopsis 0.683 0.710 0.332 7.1e-77
TAIR|locus:2096339786 RLP30 "receptor like protein 3 0.755 0.893 0.318 9e-77
TAIR|locus:2090754711 RLP43 "receptor like protein 4 0.612 0.800 0.369 1.9e-76
TAIR|locus:2144392957 RLP53 "receptor like protein 5 0.684 0.664 0.330 2.4e-76
TAIR|locus:2078112868 RLP32 "receptor like protein 3 0.692 0.740 0.340 2.7e-75
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.687 0.642 0.328 1.4e-73
TAIR|locus:2074633943 RLP35 "AT3G11080" [Arabidopsis 0.702 0.692 0.316 1.4e-73
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 795 (284.9 bits), Expect = 4.2e-79, P = 4.2e-79
 Identities = 235/705 (33%), Positives = 367/705 (52%)

Query:   262 NLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASXXXXXXXXXXXXXXXXFSSHIP 321
             +LS++    E+ +S G+L  L  L L  ++  G +P                  F+  +P
Sbjct:   189 DLSTNNFVGEIPSSFGSLNQLSILRLDNNKLSGNLPLEVINLTKLSEISLSHNQFTGTLP 248

Query:   322 SSLSNLVQLTCLDLSGNSFVGEIPD-IVNLTQVSFFDLSNNQLAGPV-------PSHEML 373
              ++++L  L     SGN+FVG IP  +  +  ++   L NNQL+G +       PS+ ++
Sbjct:   249 PNITSLSILESFSASGNNFVGTIPSSLFTIPSITLIFLDNNQLSGTLEFGNISSPSNLLV 308

Query:   374 IRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDE--FPS-KSLQNIYLSNNRLQGS 430
             ++L  N+L G IP+ +  L  L  + LS   + G +D   F   K L N+YLS++    +
Sbjct:   309 LQLGGNNLRGPIPTSISRLVNLRTLDLSHFNIQGQVDFNIFSHLKLLGNLYLSHSNTTTT 368

Query:   431 IP-SSIFELVN-LIDLQLDSN-----NFSGIAEPYMFAKLIKLKYLYISHNSLSLGTTFK 483
             I  +++      LI L L  N     N S +++P +   LI       S N    G T  
Sbjct:   369 IDLNAVLSCFKMLISLDLSGNHVLVTNKSSVSDPPL--GLIG------SLNLSGCGITEF 420

Query:   484 IDIPFPKFSYLSLFACN--ISA-FPSFLRTQDKLFYLDLSESKIDG-QIPRWISK--IGK 537
              DI   +    +L   N  I    PS+L  Q  L Y+ +S +   G +    + K  + K
Sbjct:   421 PDILRTQRQMRTLDISNNKIKGQVPSWLLLQ--LEYMHISNNNFIGFERSTKLEKTVVPK 478

Query:   538 DSLS-YLNLSHNFITKMKQI--SWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALD 594
              S+  +   ++NF  K+     S ++L  LDL +N   G +P P   +   ++ D     
Sbjct:   479 PSMKHFFGSNNNFSGKIPSFICSLRSLIILDLSNNNFSGAIP-PCVGKFKSTLSD----- 532

Query:   595 VLDLSNNRLSGTIPECIGNFSPWXXXXXXXXXXXXXGANPQSLVNCTKLEVLDIGNNKIN 654
              L+L  NRLSG++P+ I                   G  P+SL++ + LEVL++ +N+IN
Sbjct:   533 -LNLRRNRLSGSLPKTIIK----SLRSLDVSHNELEGKLPRSLIHFSTLEVLNVESNRIN 587

Query:   655 DVFPYWLGNLPELRVLVLRSNKLRG--------SLRILDLSINNFSGYLPARFFEKLNAM 706
             D FP+WL +L +L+VLVLRSN   G         LRI+D+S N+F+G LP+  F +   M
Sbjct:   588 DTFPFWLSSLKKLQVLVLRSNAFHGRIHKTRFPKLRIIDISRNHFNGTLPSDCFVEWTGM 647

Query:   707 RNVGADEGKL--RYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVI 764
              ++  +E +   +Y+G  YY DS+V+  KG E+EL +IL ++T +DFS N F+GEI + I
Sbjct:   648 HSLEKNEDRFNEKYMGSGYYHDSMVLMNKGLEMELVRILKIYTALDFSGNKFEGEIPRSI 707

Query:   765 GKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNIS 824
             G L  L +LNL+ N FTG IPSS+GNL +LESLD+S N L+G+IP++L +L+ L+ +N S
Sbjct:   708 GLLKELHILNLSSNGFTGHIPSSMGNLRELESLDVSRNKLSGEIPQELGNLSYLAYMNFS 767

Query:   825 HNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEAPTTFHXXXXXXXXXXXXX 884
             HN+L G +P G QF T    S+  NLGLCG  L +     E PT                
Sbjct:   768 HNQLVGQVPGGTQFRTQSASSFEENLGLCGRPLEECRVVHE-PTP----SGESETLESEQ 822

Query:   885 WFDWKFAKIGYGSGLVIGMSIGYMVFASGEPLWFMKMVVTWQSKK 929
                W  A IG+  G+V+G++IG++V +S +P WF K++    S++
Sbjct:   823 VLSWIAAAIGFTPGIVLGLTIGHIVLSS-KPRWFFKVLYINNSRR 866
GO:0005886 "plasma membrane" evidence=ISM
GO:0006952 "defense response" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006457 "protein folding" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009617 "response to bacterium" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0035304 "regulation of protein dephosphorylation" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825389 RLP11 "AT1G71390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090754 RLP43 "receptor like protein 43" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144392 RLP53 "receptor like protein 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query929
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-59
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  220 bits (562), Expect = 1e-59
 Identities = 206/692 (29%), Positives = 297/692 (42%), Gaps = 174/692 (25%)

Query: 205 SWKKDTNYCSWDGLTCDMAT--VSLETP------VFQALVQNMTKLQVLSLASLEMSTVV 256
           +W    + C W G+TC+ ++  VS++           + +  +  +Q ++L++ ++S  +
Sbjct: 50  NWNSSADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPI 109

Query: 257 PDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLGNLTQLTLLHLMHNNF 316
           PD +   SSSL +  L+N+                F G +P   G++  L  L L +N  
Sbjct: 110 PDDIFTTSSSLRYLNLSNN---------------NFTGSIPR--GSIPNLETLDLSNNML 152

Query: 317 SSHIPSSLSNLVQLTCLDLSGNSFVGEIP-DIVNLTQVSFFDLSNNQLAGPVPSHEM--- 372
           S  IP+ + +   L  LDL GN  VG+IP  + NLT + F  L++NQL G +P  E+   
Sbjct: 153 SGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIP-RELGQM 211

Query: 373 ----LIRLNNNSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPS-----KSLQNIYLS 423
                I L  N+LSG IP  +  L  L ++ L  N L+G I   PS     K+LQ ++L 
Sbjct: 212 KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI---PSSLGNLKNLQYLFLY 268

Query: 424 NNRLQGSIPSSIFELVNLIDLQLDSNNFSG-IAEPYMFAKLIKLKYLYISHNSLSLGTTF 482
            N+L G IP SIF L  LI L L  N+ SG I E      +I+L+ L I H         
Sbjct: 269 QNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPE-----LVIQLQNLEILH--------- 314

Query: 483 KIDIPFPKFSYLSLFACNISA-FPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLS 541
                        LF+ N +   P  L +  +L  L L  +K  G+IP+ + K       
Sbjct: 315 -------------LFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGK------- 354

Query: 542 YLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNN 601
                HN +T                                           VLDLS N
Sbjct: 355 -----HNNLT-------------------------------------------VLDLSTN 366

Query: 602 RLSGTIPECI---GNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFP 658
            L+G IPE +   GN        L L +N LEG  P+SL  C  L  + + +N  +   P
Sbjct: 367 NLTGEIPEGLCSSGNLF-----KLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELP 421

Query: 659 YWLGNLPELRVLVLRSNKLRG----------SLRILDLSINNFSGYLPARF----FEKLN 704
                LP +  L + +N L+G          SL++L L+ N F G LP  F     E L+
Sbjct: 422 SEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLD 481

Query: 705 AMRNV--GADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQ 762
             RN   GA   KL  L E                           +  S N   GEI  
Sbjct: 482 LSRNQFSGAVPRKLGSLSE------------------------LMQLKLSENKLSGEIPD 517

Query: 763 VIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLN 822
            +     L  L+L+HN  +G+IP+S   +  L  LDLS N L+G+IPK L ++ SL  +N
Sbjct: 518 ELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVN 577

Query: 823 ISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCG 854
           ISHN L G +P    F  I   +  GN+ LCG
Sbjct: 578 ISHNHLHGSLPSTGAFLAINASAVAGNIDLCG 609

Length = 968
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 929
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
KOG4237498 consensus Extracellular matrix protein slit, conta 99.82
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
KOG4237498 consensus Extracellular matrix protein slit, conta 99.8
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.72
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.59
PLN03150623 hypothetical protein; Provisional 99.55
KOG0617264 consensus Ras suppressor protein (contains leucine 99.52
PLN03150623 hypothetical protein; Provisional 99.5
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.03
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.92
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.88
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.86
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.86
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.74
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.69
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.64
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.61
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.6
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.56
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.15
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.14
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.91
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.88
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.87
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.74
PRK15386426 type III secretion protein GogB; Provisional 97.63
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.62
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.57
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.45
PRK15386426 type III secretion protein GogB; Provisional 97.45
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.38
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.07
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.91
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 96.69
KOG4341483 consensus F-box protein containing LRR [General fu 96.49
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.27
KOG4341483 consensus F-box protein containing LRR [General fu 96.25
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.52
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.4
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.01
KOG4308478 consensus LRR-containing protein [Function unknown 94.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.03
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.39
KOG4308478 consensus LRR-containing protein [Function unknown 91.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 90.16
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.46
KOG0473326 consensus Leucine-rich repeat protein [Function un 89.06
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 85.55
smart0037026 LRR Leucine-rich repeats, outliers. 82.82
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.82
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.5e-68  Score=675.58  Aligned_cols=563  Identities=33%  Similarity=0.497  Sum_probs=422.8

Q ss_pred             CHHHHHHHHHHhhcCCCCCCCcccccccccccCCCCCCCCCCCCcccccCCCCcccccCchhhhhcCCCCceEEEcCCCC
Q 045967          172 PHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATVSLETPVFQALVQNMTKLQVLSLASLE  251 (929)
Q Consensus       172 ~~~e~~aLl~~k~~l~~~~~~~~~~~~~~~~l~sW~~~~~~C~W~Gv~C~~~~~~~~~~~~~~~l~~l~~L~~L~Ls~~~  251 (929)
                      .++|++||++||+++.++.+          .+.+|+.+.+||.|.||+|+..                .+++.|+|++++
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~----------~~~~w~~~~~~c~w~gv~c~~~----------------~~v~~L~L~~~~   80 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK----------YLSNWNSSADVCLWQGITCNNS----------------SRVVSIDLSGKN   80 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc----------cCCCCCCCCCCCcCcceecCCC----------------CcEEEEEecCCC
Confidence            67899999999999975443          5789987889999999999854                279999999998


Q ss_pred             CCCCCCcccccccccccccccccccCCCCCCcEEECCCCCCCCCCccccC-CCCCCCEEeccCccCCCCCccccCCCCCC
Q 045967          252 MSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGYSQFVGPVPASLG-NLTQLTLLHLMHNNFSSHIPSSLSNLVQL  330 (929)
Q Consensus       252 l~~~~p~~l~~l~~~L~~g~ip~~l~~l~~L~~L~Ls~n~l~~~lp~~~~-~l~~L~~L~Ls~n~l~~~~p~~l~~L~~L  330 (929)
                      ++|.                ++..+..+++|++|+|++|.+.+.+|..+. .+++|++|+|++|++++.+|.  +.+++|
T Consensus        81 i~~~----------------~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L  142 (968)
T PLN00113         81 ISGK----------------ISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNL  142 (968)
T ss_pred             cccc----------------CChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCC
Confidence            8544                455677789999999999999988887755 899999999999999988885  568999


Q ss_pred             CEEEccCCcCCCCCCC-CCCCCCCCEEeCCCCcCCCCCCCC------CcEEEcCCCCCCCCCCccccCCCCCcEEEcccc
Q 045967          331 TCLDLSGNSFVGEIPD-IVNLTQVSFFDLSNNQLAGPVPSH------EMLIRLNNNSLSGTIPSWLFSLPLLEYVRLSDN  403 (929)
Q Consensus       331 ~~L~Ls~N~l~~~~p~-l~~L~~L~~L~Ls~n~l~~~~p~~------L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N  403 (929)
                      ++|++++|.+++.+|. ++++++|++|++++|.+.+.+|..      |++|++++|.+++.+|..++++++|++|++++|
T Consensus       143 ~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n  222 (968)
T PLN00113        143 ETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN  222 (968)
T ss_pred             CEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCC
Confidence            9999999999988887 899999999999999888766643      566666666666666666666666666666666


Q ss_pred             cCCCCCCCC--CCCCCcEEEecCCCCCCCCccccccCCCCcEEeccCCCCcCccchhhhhccCcccEEEccCCCCCCCcc
Q 045967          404 QLSGHIDEF--PSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSLSLGTT  481 (929)
Q Consensus       404 ~l~~~~~~~--~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~  481 (929)
                      ++++.+|..  .+++|++|++++|.+++.+|..+.++++|+.|++++|++.+..| ..+.++++|++|++++|.  +.+ 
T Consensus       223 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L~Ls~n~--l~~-  298 (968)
T PLN00113        223 NLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP-PSIFSLQKLISLDLSDNS--LSG-  298 (968)
T ss_pred             ccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc-hhHhhccCcCEEECcCCe--ecc-
Confidence            666555543  55666666666666666666666666666666666666655554 455566666666666652  222 


Q ss_pred             ccccCCCCCcceeeccccCCCCCChhhhcccccceeccCCCcCCCCCchhhhccCCCCccEEeccccccccccc---CCC
Q 045967          482 FKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITKMKQ---ISW  558 (929)
Q Consensus       482 ~~~~~~~~~L~~L~L~~n~l~~lp~~l~~~~~L~~L~Ls~N~l~~~~p~~l~~~~~~~L~~L~Ls~N~l~~~~~---~~~  558 (929)
                                           .+|..+..+++|++|++++|.+.+..|..+  ..+++|+.|++++|.+++..+   ..+
T Consensus       299 ---------------------~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~--~~l~~L~~L~L~~n~l~~~~p~~l~~~  355 (968)
T PLN00113        299 ---------------------EIPELVIQLQNLEILHLFSNNFTGKIPVAL--TSLPRLQVLQLWSNKFSGEIPKNLGKH  355 (968)
T ss_pred             ---------------------CCChhHcCCCCCcEEECCCCccCCcCChhH--hcCCCCCEEECcCCCCcCcCChHHhCC
Confidence                                 345555556666666666666666666555  455666666666666655444   334


Q ss_pred             CCccEEEcCCCCCCCCCCCCCCcccchhhhccCCCCEEeCCCCcCcCCCccccccCcccccceeeccCcccCCCCccccc
Q 045967          559 KNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLV  638 (929)
Q Consensus       559 ~~L~~L~Ls~N~l~~~~~~~~~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~l~~l~~ll~~~L~Ls~N~l~~~~p~~~~  638 (929)
                      ++|+.|++++|+++        +.+|..++.+++|+.|++++|++.+.+|..++.++.+  +.+++++|.+++..|..+.
T Consensus       356 ~~L~~L~Ls~n~l~--------~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L--~~L~L~~n~l~~~~p~~~~  425 (968)
T PLN00113        356 NNLTVLDLSTNNLT--------GEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSL--RRVRLQDNSFSGELPSEFT  425 (968)
T ss_pred             CCCcEEECCCCeeE--------eeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCC--CEEECcCCEeeeECChhHh
Confidence            56666666666666        5556666666667777777777766666666666653  4667777777666666666


Q ss_pred             CCCCCcEEEccCCcCCCCCcccccCCCCCceeecccccccc---------ccceeeCCCCcCcccCCHHHHhhhhccccc
Q 045967          639 NCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRG---------SLRILDLSINNFSGYLPARFFEKLNAMRNV  709 (929)
Q Consensus       639 ~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~---------~L~~LdLs~N~l~g~ip~~~~~~l~~L~~L  709 (929)
                      ++++|+.|++++|.+++.+|..+..+++|+.|++++|++.+         .|+.||+++|++++.+|..+          
T Consensus       426 ~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~----------  495 (968)
T PLN00113        426 KLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKL----------  495 (968)
T ss_pred             cCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhh----------
Confidence            77777777777777777666666666677666666665543         14555555555555555322          


Q ss_pred             ccCCCcccccCccccccceEEEecCchhhHhhhcccccEeeccccccCcccchhhccccccceeeccCccCCCCCCcccc
Q 045967          710 GADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLG  789 (929)
Q Consensus       710 ~ls~n~l~~l~~~~~~~~~~~~~~~~~~~~~~~l~~L~~LdLs~N~l~~~ip~~l~~L~~L~~L~Ls~N~l~~~ip~~l~  789 (929)
                                                     ..++.|+.|+|++|++++.+|+.++++++|++|+|++|.+++.+|..++
T Consensus       496 -------------------------------~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~  544 (968)
T PLN00113        496 -------------------------------GSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFS  544 (968)
T ss_pred             -------------------------------hhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHh
Confidence                                           1267889999999999999999999999999999999999999999999


Q ss_pred             CcCCCCEeeCCCCcCCCCCchhhccCCCCCEEECccCcCccCCCCCCCCCccccccccCCcCCCCCC
Q 045967          790 NLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFS  856 (929)
Q Consensus       790 ~L~~L~~LdLs~N~ls~~ip~~l~~L~~L~~L~Ls~N~l~g~iP~~~~~~~~~~~~~~gn~~Lcg~~  856 (929)
                      .+++|+.|||++|+++|.+|..+.++++|+.|++++|+++|.+|..++|.++...+|.||+++||.+
T Consensus       545 ~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        545 EMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             CcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999864

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query929
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-34
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-34
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-09
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 6e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  144 bits (362), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 159/589 (26%), Positives = 251/589 (42%), Gaps = 78/589 (13%)
Query: 329 QLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVP-----SHEMLIRLNNNSLSG 383
           +L  L +SGN   G++ D+     + F D+S+N  +  +P     S    + ++ N LSG
Sbjct: 176 ELKHLAISGNKISGDV-DVSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISGNKLSG 234
Query: 384 TIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFELVN-LI 442
                + +   L+ + +S NQ  G I   P KSLQ + L+ N+  G IP  +    + L 
Sbjct: 235 DFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLT 294
Query: 443 DLQLDSNNFSGIAEPYMFAKLIKLKYLYISHN---SLSLGTTFK------IDIPFPKFS- 492
            L L  N+F G   P+  +  +       S+N    L + T  K      +D+ F +FS 
Sbjct: 295 GLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSG 354
Query: 493 YLSLFACNISAFPSFLRTQDKLFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFITK 552
            L     N+SA          L  LDLS +   G I   + +  K++L  L L +N  T 
Sbjct: 355 ELPESLTNLSA---------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG 405
Query: 553 MKQISWKN---LGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPE 609
               +  N   L  L L  N L G +P         S+  +  L  L L  N L G IP+
Sbjct: 406 KIPPTLSNCSELVSLHLSFNYLSGTIP--------SSLGSLSKLRDLKLWLNMLEGEIPQ 457
Query: 610 CIGNFSPWXXXXXXXXXXXXXGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRV 669
            +                   G  P  L NCT L  + + NN++    P W+G L  L +
Sbjct: 458 EL--MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAI 515
Query: 670 LVLRSNKLRG----------SLRILDLSINNFSGYLPARFFE---KLNAMRNVGADEGKL 716
           L L +N   G          SL  LDL+ N F+G +PA  F+   K+ A    G     +
Sbjct: 516 LKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYI 575
Query: 717 RYLG--EEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLN 774
           +  G  +E +    ++  +G   E    L+     + +S  + G  S       S+  L+
Sbjct: 576 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLD 635
Query: 775 LTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNISHNRLDGPIPQ 834
           +++N  +G IP  +G++  L  L+L  N+++G IP ++  L  L++L++S N+LDG IPQ
Sbjct: 636 MSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQ 695
Query: 835 -------------------GP-----QFNTIQEDSYIGNLGLCGFSLTK 859
                              GP     QF T     ++ N GLCG+ L +
Sbjct: 696 AMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPR 744
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query929
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-129
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-107
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-87
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-17
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-92
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-54
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-44
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-16
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-73
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-65
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-62
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-44
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-57
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-54
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-22
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-63
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-37
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-63
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-49
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-25
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-62
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-62
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-50
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-47
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-26
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-43
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-28
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-43
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-42
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-43
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-12
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-33
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-32
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-19
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-31
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-29
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-26
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-30
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-28
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-24
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-17
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-19
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-17
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-20
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-15
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-18
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-17
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-17
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-13
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-12
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-10
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  406 bits (1047), Expect = e-129
 Identities = 172/672 (25%), Positives = 266/672 (39%), Gaps = 134/672 (19%)

Query: 238 NMTKLQVLSLASLEMSTVVPDSLKNLSSSLTFSELAN---------SIGNLKLLGRLMLG 288
               L+ L ++S   ST +P  L + S+ L   +++          +I     L  L + 
Sbjct: 198 RCVNLEFLDVSSNNFSTGIP-FLGDCSA-LQHLDISGNKLSGDFSRAISTCTELKLLNIS 255

Query: 289 YSQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLS-NLVQLTCLDLSGNSFVGEIPD- 346
            +QFVGP+P     L  L  L L  N F+  IP  LS     LT LDLSGN F G +P  
Sbjct: 256 SNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPF 313

Query: 347 IVNLTQVSFFDLSNNQLAGPVPSHEM-------LIRLNNNSLSGTIPSWLFSLPL-LEYV 398
             + + +    LS+N  +G +P   +       ++ L+ N  SG +P  L +L   L  +
Sbjct: 314 FGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTL 373

Query: 399 RLSDNQLSGHI----DEFPSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSG- 453
            LS N  SG I     + P  +LQ +YL NN   G IP ++     L+ L L  N  SG 
Sbjct: 374 DLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGT 433

Query: 454 IAEPYMFAKLIKLKYLYISHNSLSLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDK 513
           I  P     L KL+ L +  N L  G                         P  L     
Sbjct: 434 I--PSSLGSLSKLRDLKLWLNMLE-GE-----------------------IPQELMYVKT 467

Query: 514 LFYLDLSESKIDGQIPRWISKIGKDSLSYLNLSHNFIT-----KMKQISWKNLGYLDLRS 568
           L  L L  + + G+IP  +S     +L++++LS+N +T      + ++   NL  L L +
Sbjct: 468 LETLILDFNDLTGEIPSGLSNCT--NLNWISLSNNRLTGEIPKWIGRLE--NLAILKLSN 523

Query: 569 NLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNE 628
           N   G +P          + D  +L  LDL+ N  +GTIP  +   S        +  N 
Sbjct: 524 NSFSGNIP--------AELGDCRSLIWLDLNTNLFNGTIPAAMFKQS------GKIAANF 569

Query: 629 LEGANPQSLVNCTKLEVLDIGNNKIND--VFPYWLGNLPELRVLVLRSNKLRGSLRILDL 686
           + G     + N    +      N +    +    L  L               +    ++
Sbjct: 570 IAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS--------------TRNPCNI 615

Query: 687 SINNFSGYLPARFFEKLNAMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVF 746
           +   + G+    F                                               
Sbjct: 616 TSRVYGGHTSPTF-----------------------------------------DNNGSM 634

Query: 747 TTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAG 806
             +D S N   G I + IG +  L +LNL HN  +G IP  +G+L  L  LDLSSN L G
Sbjct: 635 MFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDG 694

Query: 807 KIPKQLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDEA 866
           +IP+ +++LT L+ +++S+N L GPIP+  QF T     ++ N GLCG+ L +   ++  
Sbjct: 695 RIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNAD 754

Query: 867 PTTFHEEEEEEE 878
               H+      
Sbjct: 755 GYAHHQRSHHHH 766
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query929
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.91
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.82
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.8
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.67
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.65
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.61
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.56
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.45
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.35
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.27
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.24
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.23
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.12
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.02
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.01
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.97
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.74
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.46
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.41
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.25
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.65
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.29
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.61
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.54
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.49
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.7
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.4e-81  Score=771.03  Aligned_cols=668  Identities=29%  Similarity=0.429  Sum_probs=533.4

Q ss_pred             CCCCHHHHHHHHHHhhcCCCCCCCcccccccccccCCCCCCCCCCCCcccccCCCCc---cccc----Cc---hhhhhcC
Q 045967          169 KHCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCSWDGLTCDMATV---SLET----PV---FQALVQN  238 (929)
Q Consensus       169 ~~c~~~e~~aLl~~k~~l~~~~~~~~~~~~~~~~l~sW~~~~~~C~W~Gv~C~~~~~---~~~~----~~---~~~~l~~  238 (929)
                      ..+.++|++|||+||+++.++.           .+++|+.+++||+|+||+|+..++   .+..    ..   +++.+.+
T Consensus         7 ~~~~~~~~~all~~k~~~~~~~-----------~l~~W~~~~~~C~w~gv~C~~~~v~~L~L~~~~l~g~~~~l~~~l~~   75 (768)
T 3rgz_A            7 SQSLYREIHQLISFKDVLPDKN-----------LLPDWSSNKNPCTFDGVTCRDDKVTSIDLSSKPLNVGFSAVSSSLLS   75 (768)
T ss_dssp             -CCHHHHHHHHHHHHTTCSCTT-----------SSTTCCTTSCGGGSTTEEEETTEEEEEECTTSCCCEEHHHHHHHTTT
T ss_pred             ccCCHHHHHHHHHHHhhCCCcc-----------cccCCCCCCCCcCCcceEECCCcEEEEECCCCCcCCccCccChhHhc
Confidence            3456889999999999998542           588998888999999999983211   1110    11   5666666


Q ss_pred             CCCceEEEcCCCCCCCCCCccccccccccc---------cccccc--ccCCCCCCcEEECCCCCCCCCCcccc-CCCCCC
Q 045967          239 MTKLQVLSLASLEMSTVVPDSLKNLSSSLT---------FSELAN--SIGNLKLLGRLMLGYSQFVGPVPASL-GNLTQL  306 (929)
Q Consensus       239 l~~L~~L~Ls~~~l~~~~p~~l~~l~~~L~---------~g~ip~--~l~~l~~L~~L~Ls~n~l~~~lp~~~-~~l~~L  306 (929)
                      +++|+.++++.+.+.. +|..++++ .+|+         .|.+|.  .++++++|++|+|++|.+.+.+|..+ .++++|
T Consensus        76 L~~L~~l~~~~~~~~~-l~~~~~~l-~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L  153 (768)
T 3rgz_A           76 LTGLESLFLSNSHING-SVSGFKCS-ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSL  153 (768)
T ss_dssp             CTTCCEEECTTSCEEE-CCCCCCCC-TTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTC
T ss_pred             cCcccccCCcCCCcCC-CchhhccC-CCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCC
Confidence            6666666666654421 23444444 3333         345666  77777888888888887777777655 677888


Q ss_pred             CEEeccCccCCCCCccc---cCCCCCCCEEEccCCcCCCCCCCCCCCCCCCEEeCCCCcCCCCCCCC-----CcEEEcCC
Q 045967          307 TLLHLMHNNFSSHIPSS---LSNLVQLTCLDLSGNSFVGEIPDIVNLTQVSFFDLSNNQLAGPVPSH-----EMLIRLNN  378 (929)
Q Consensus       307 ~~L~Ls~n~l~~~~p~~---l~~L~~L~~L~Ls~N~l~~~~p~l~~L~~L~~L~Ls~n~l~~~~p~~-----L~~L~Ls~  378 (929)
                      ++|+|++|++++..|..   +.++++|++|++++|.+++.++ +.++++|++|++++|.+++.+|..     |++|++++
T Consensus       154 ~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~-~~~l~~L~~L~Ls~n~l~~~~~~l~~l~~L~~L~Ls~  232 (768)
T 3rgz_A          154 EVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD-VSRCVNLEFLDVSSNNFSTGIPFLGDCSALQHLDISG  232 (768)
T ss_dssp             SEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB-CTTCTTCCEEECCSSCCCSCCCBCTTCCSCCEEECCS
T ss_pred             CEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC-cccCCcCCEEECcCCcCCCCCcccccCCCCCEEECcC
Confidence            88888888887777766   6788888888888888876655 378888999999999888877642     88999999


Q ss_pred             CCCCCCCCccccCCCCCcEEEcccccCCCCCCCCCCCCCcEEEecCCCCCCCCccccccC-CCCcEEeccCCCCcCccch
Q 045967          379 NSLSGTIPSWLFSLPLLEYVRLSDNQLSGHIDEFPSKSLQNIYLSNNRLQGSIPSSIFEL-VNLIDLQLDSNNFSGIAEP  457 (929)
Q Consensus       379 N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l-~~L~~L~Ls~N~l~~~~~~  457 (929)
                      |.+++.+|..++++++|++|++++|.+++.++...+++|++|++++|++++.+|..+... ++|++|++++|++++..| 
T Consensus       233 n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p-  311 (768)
T 3rgz_A          233 NKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVP-  311 (768)
T ss_dssp             SCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCC-
T ss_pred             CcCCCcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccc-
Confidence            999988888899999999999999998888887788899999999999988888888775 899999999999988876 


Q ss_pred             hhhhccCcccEEEccCCCCCCCcccccc-C-CCCCcceeeccccCCC-CCChhhhccc-ccceeccCCCcCCCCCchhhh
Q 045967          458 YMFAKLIKLKYLYISHNSLSLGTTFKID-I-PFPKFSYLSLFACNIS-AFPSFLRTQD-KLFYLDLSESKIDGQIPRWIS  533 (929)
Q Consensus       458 ~~~~~l~~L~~L~Ls~N~l~~~~~~~~~-~-~~~~L~~L~L~~n~l~-~lp~~l~~~~-~L~~L~Ls~N~l~~~~p~~l~  533 (929)
                      ..|+++++|++|++++|  .+.+.++.. + .+++|++|++++|.++ .+|..+..++ +|++|++++|.+.+.+|..+.
T Consensus       312 ~~~~~l~~L~~L~L~~n--~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~  389 (768)
T 3rgz_A          312 PFFGSCSLLESLALSSN--NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLC  389 (768)
T ss_dssp             GGGGGCTTCCEEECCSS--EEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTT
T ss_pred             hHHhcCCCccEEECCCC--cccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhh
Confidence            78899999999999999  555666654 3 7889999999999887 8888888887 899999999999888888773


Q ss_pred             ccCCCCccEEeccccccccccc---CCCCCccEEEcCCCCCCCCCCCCCCcccchhhhccCCCCEEeCCCCcCcCCCccc
Q 045967          534 KIGKDSLSYLNLSHNFITKMKQ---ISWKNLGYLDLRSNLLQGPLPVPPSREIIHSICDIIALDVLDLSNNRLSGTIPEC  610 (929)
Q Consensus       534 ~~~~~~L~~L~Ls~N~l~~~~~---~~~~~L~~L~Ls~N~l~~~~~~~~~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~  610 (929)
                      ...+++|++|++++|.+++..+   ..+++|++|++++|.++        +.+|..++.+++|++|++++|++++.+|..
T Consensus       390 ~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~--------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~  461 (768)
T 3rgz_A          390 QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS--------GTIPSSLGSLSKLRDLKLWLNMLEGEIPQE  461 (768)
T ss_dssp             CSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEE--------SCCCGGGGGCTTCCEEECCSSCCCSCCCGG
T ss_pred             hcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCccc--------CcccHHHhcCCCCCEEECCCCcccCcCCHH
Confidence            2337889999999999987766   45678999999999998        677888899999999999999999999999


Q ss_pred             cccCcccccceeeccCcccCCCCcccccCCCCCcEEEccCCcCCCCCcccccCCCCCceeeccccccccc----------
Q 045967          611 IGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLEVLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGS----------  680 (929)
Q Consensus       611 l~~l~~ll~~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~----------  680 (929)
                      +..++.+  +.|++++|.+++.+|..+.++++|++|++++|++++.+|.+++.+++|++|++++|++++.          
T Consensus       462 ~~~l~~L--~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~  539 (768)
T 3rgz_A          462 LMYVKTL--ETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRS  539 (768)
T ss_dssp             GGGCTTC--CEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTT
T ss_pred             HcCCCCc--eEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCC
Confidence            8888874  5899999999999999999999999999999999999999999999999999999998753          


Q ss_pred             cceeeCCCCcCcccCCHHHHhhhhcccccccCC-CcccccCccc-------------cc----------------cceEE
Q 045967          681 LRILDLSINNFSGYLPARFFEKLNAMRNVGADE-GKLRYLGEEY-------------YQ----------------DSVVV  730 (929)
Q Consensus       681 L~~LdLs~N~l~g~ip~~~~~~l~~L~~L~ls~-n~l~~l~~~~-------------~~----------------~~~~~  730 (929)
                      |++||+++|+++|.+|..++... .+..+.+.. +.+.++....             +.                +....
T Consensus       540 L~~L~Ls~N~l~g~ip~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~  618 (768)
T 3rgz_A          540 LIWLDLNTNLFNGTIPAAMFKQS-GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSR  618 (768)
T ss_dssp             CCEEECCSSEEESBCCGGGGTTT-TCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSC
T ss_pred             CCEEECCCCccCCcCChHHhccc-chhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccc
Confidence            88999999999999998765432 222222221 1111110000             00                00000


Q ss_pred             EecCchhhHhhhcccccEeeccccccCcccchhhccccccceeeccCccCCCCCCccccCcCCCCEeeCCCCcCCCCCch
Q 045967          731 TLKGTEIELQKILTVFTTIDFSSNGFDGEISQVIGKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPK  810 (929)
Q Consensus       731 ~~~~~~~~~~~~l~~L~~LdLs~N~l~~~ip~~l~~L~~L~~L~Ls~N~l~~~ip~~l~~L~~L~~LdLs~N~ls~~ip~  810 (929)
                      ...|........++.|+.|||++|+++|.+|.+++++++|+.|+|++|+++|.+|..|+++++|++|||++|+++|.+|.
T Consensus       619 ~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~  698 (768)
T 3rgz_A          619 VYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQ  698 (768)
T ss_dssp             EEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCG
T ss_pred             eecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCCh
Confidence            11111222233468899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCCCCEEECccCcCccCCCCCCCCCccccccccCCcCCCCCCCCCCCCCCC
Q 045967          811 QLASLTSLSVLNISHNRLDGPIPQGPQFNTIQEDSYIGNLGLCGFSLTKKYGNDE  865 (929)
Q Consensus       811 ~l~~L~~L~~L~Ls~N~l~g~iP~~~~~~~~~~~~~~gn~~Lcg~~l~~~c~~~~  865 (929)
                      .+.++++|++||+++|+++|+||++++|.+++..+|.||++|||.|+. .|....
T Consensus       699 ~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~~  752 (768)
T 3rgz_A          699 AMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP-RCDPSN  752 (768)
T ss_dssp             GGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSC-CCCSCC
T ss_pred             HHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCc-CCCCCc
Confidence            999999999999999999999999999999999999999999999987 896543
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 929
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-12
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-10
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-09
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-08
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-07
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 5e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.004
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 92.8 bits (229), Expect = 1e-20
 Identities = 71/422 (16%), Positives = 134/422 (31%), Gaps = 61/422 (14%)

Query: 412 FPSKSLQN---IYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKY 468
           F   +L       L    +  ++  +  +L  +  LQ D      I        L  L  
Sbjct: 16  FTDTALAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKSIDG---VEYLNNLTQ 70

Query: 469 LYISHNSLSLGTTFK--IDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKIDG 526
           +  S+N L+  T  K    +     +   +      A  + L               +  
Sbjct: 71  INFSNNQLTDITPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKN 130

Query: 527 QIPRWISKIGKDSLSYLNLSHNFITKMKQISWKNLGYLDLRSNLLQGPLPVPPS--REII 584
                  ++  +++S ++      +  +      +  L   +NL         S     I
Sbjct: 131 LTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI 190

Query: 585 HSICDIIALDVLDLSNNRLSGTIPECIGNFSPWLSVSLNLNNNELEGANPQSLVNCTKLE 644
             +  +  L+ L  +NN++S   P         L   L+LN N+L+     +L + T L 
Sbjct: 191 SVLAKLTNLESLIATNNQISDITPLG---ILTNLDE-LSLNGNQLKD--IGTLASLTNLT 244

Query: 645 VLDIGNNKINDVFPYWLGNLPELRVLVLRSNKLRGSLRILDLSINNFSGYLPARFFEKLN 704
            LD+ NN+I+++ P  L  L +L  L L +N++     +  L+          +  +   
Sbjct: 245 DLDLANNQISNLAP--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISP 302

Query: 705 AMRNVGADEGKLRYLGEEYYQDSVVVTLKGTEIELQKILTVFTTIDFSSNGFDGEISQVI 764
                                                 L   T +    N         +
Sbjct: 303 ISN-----------------------------------LKNLTYLTLYFNNISDISP--V 325

Query: 765 GKLHSLRLLNLTHNHFTGKIPSSLGNLAKLESLDLSSNNLAGKIPKQLASLTSLSVLNIS 824
             L  L+ L   +N  +    SSL NL  +  L    N ++   P  LA+LT ++ L ++
Sbjct: 326 SSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLN 381

Query: 825 HN 826
             
Sbjct: 382 DQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query929
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.82
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.59
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.58
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.56
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.34
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.28
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.27
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.07
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.22
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.21
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.5
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.24
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=4.4e-37  Score=335.99  Aligned_cols=289  Identities=29%  Similarity=0.452  Sum_probs=240.4

Q ss_pred             CCCHHHHHHHHHHhhcCCCCCCCcccccccccccCCCCCCCCCCC--CcccccCCCCcccccCchhhhhcCCCCceEEEc
Q 045967          170 HCPHEQSSALIQFKQLFSFDGDSSFVCQHSYPKMISWKKDTNYCS--WDGLTCDMATVSLETPVFQALVQNMTKLQVLSL  247 (929)
Q Consensus       170 ~c~~~e~~aLl~~k~~l~~~~~~~~~~~~~~~~l~sW~~~~~~C~--W~Gv~C~~~~~~~~~~~~~~~l~~l~~L~~L~L  247 (929)
                      -|.++||+||++||+++.++.           .+++|..++|||.  |+||+|+..+.             ..+|+.|+|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~-----------~l~sW~~~~d~C~~~w~gv~C~~~~~-------------~~~v~~L~L   57 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT-----------TLSSWLPTTDCCNRTWLGVLCDTDTQ-------------TYRVNNLDL   57 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-----------GGTTCCTTSCTTTTCSTTEEECCSSS-------------CCCEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCC-----------cCCCCCCCCCCCCCcCCCeEEeCCCC-------------cEEEEEEEC
Confidence            499999999999999998653           6899998899994  99999986531             247999999


Q ss_pred             CCCCCCCCCCcccccccccccccccccccCCCCCCcEEECCC-CCCCCCCccccCCCCCCCEEeccCccCCCCCccccCC
Q 045967          248 ASLEMSTVVPDSLKNLSSSLTFSELANSIGNLKLLGRLMLGY-SQFVGPVPASLGNLTQLTLLHLMHNNFSSHIPSSLSN  326 (929)
Q Consensus       248 s~~~l~~~~p~~l~~l~~~L~~g~ip~~l~~l~~L~~L~Ls~-n~l~~~lp~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~  326 (929)
                      ++++++|.              ..+|++++++++|++|+|++ |+++|.+|..|+++++|++|+|++|++.+..+..+..
T Consensus        58 ~~~~l~g~--------------~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~  123 (313)
T d1ogqa_          58 SGLNLPKP--------------YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ  123 (313)
T ss_dssp             ECCCCSSC--------------EECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGG
T ss_pred             CCCCCCCC--------------CCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccc
Confidence            99988653              35678889999999999996 8999999999999999999999999999999999999


Q ss_pred             CCCCCEEEccCCcCCCCCCC-CCCCCCCCEEeCCCCcCCCCCCCC-------CcEEEcCCCCCCCCCCccccCCCCCcEE
Q 045967          327 LVQLTCLDLSGNSFVGEIPD-IVNLTQVSFFDLSNNQLAGPVPSH-------EMLIRLNNNSLSGTIPSWLFSLPLLEYV  398 (929)
Q Consensus       327 L~~L~~L~Ls~N~l~~~~p~-l~~L~~L~~L~Ls~n~l~~~~p~~-------L~~L~Ls~N~l~~~~p~~l~~l~~L~~L  398 (929)
                      +.+|+++++++|.+.+.+|. +.++++|+++++++|.+++.+|..       ++.+++++|++++..|..+.++..+ .+
T Consensus       124 ~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l  202 (313)
T d1ogqa_         124 IKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FV  202 (313)
T ss_dssp             CTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EE
T ss_pred             hhhhcccccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-cc
Confidence            99999999999999988886 999999999999999998877754       4778888888888888887776554 68


Q ss_pred             EcccccCCCCCCCC--CCCCCcEEEecCCCCCCCCccccccCCCCcEEeccCCCCcCccchhhhhccCcccEEEccCCCC
Q 045967          399 RLSDNQLSGHIDEF--PSKSLQNIYLSNNRLQGSIPSSIFELVNLIDLQLDSNNFSGIAEPYMFAKLIKLKYLYISHNSL  476 (929)
Q Consensus       399 ~Ls~N~l~~~~~~~--~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~~l~~L~~L~Ls~N~l  476 (929)
                      +++++...+.++..  .+++|+.+++++|.+++.+| .+..+++|+.|+|++|+++|.+| ..++++++|++|+|++|+ 
T Consensus       203 ~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP-~~l~~L~~L~~L~Ls~N~-  279 (313)
T d1ogqa_         203 DLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLP-QGLTQLKFLHSLNVSFNN-  279 (313)
T ss_dssp             ECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCC-GGGGGCTTCCEEECCSSE-
T ss_pred             cccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCC-hHHhCCCCCCEEECcCCc-
Confidence            88888877776665  66788888888888876554 57778888888888888887776 678888888888888883 


Q ss_pred             CCCccccccCCCCCcceeeccccCCCCCChhhhcccccceeccCCCcC
Q 045967          477 SLGTTFKIDIPFPKFSYLSLFACNISAFPSFLRTQDKLFYLDLSESKI  524 (929)
Q Consensus       477 ~~~~~~~~~~~~~~L~~L~L~~n~l~~lp~~l~~~~~L~~L~Ls~N~l  524 (929)
                       +.|.                      +|. ++++++|+.+++++|+.
T Consensus       280 -l~g~----------------------iP~-~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         280 -LCGE----------------------IPQ-GGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             -EEEE----------------------CCC-STTGGGSCGGGTCSSSE
T ss_pred             -cccc----------------------CCC-cccCCCCCHHHhCCCcc
Confidence             3343                      443 45677888888888873
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure