Citrus Sinensis ID: 046008
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1624 | 2.2.26 [Sep-21-2011] | |||||||
| Q9CAE3 | 789 | Lysine-specific histone d | no | no | 0.264 | 0.544 | 0.400 | 7e-88 | |
| Q8VXV7 | 844 | Lysine-specific histone d | no | no | 0.266 | 0.511 | 0.4 | 1e-86 | |
| Q6Z690 | 849 | Lysine-specific histone d | no | no | 0.256 | 0.491 | 0.379 | 5e-83 | |
| Q6YYZ1 | 763 | Lysine-specific histone d | no | no | 0.254 | 0.541 | 0.383 | 1e-82 | |
| Q01H90 | 811 | Lysine-specific histone d | N/A | no | 0.263 | 0.527 | 0.405 | 2e-80 | |
| Q7XUR2 | 811 | Lysine-specific histone d | no | no | 0.263 | 0.527 | 0.403 | 5e-80 | |
| Q9LID0 | 746 | Lysine-specific histone d | no | no | 0.264 | 0.576 | 0.397 | 4e-79 | |
| Q6ZQ88 | 853 | Lysine-specific histone d | yes | no | 0.192 | 0.366 | 0.433 | 2e-70 | |
| O60341 | 852 | Lysine-specific histone d | yes | no | 0.192 | 0.367 | 0.433 | 3e-70 | |
| Q8NB78 | 822 | Lysine-specific histone d | no | no | 0.275 | 0.543 | 0.340 | 1e-65 |
| >sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 327 bits (837), Expect = 7e-88, Method: Compositional matrix adjust.
Identities = 198/494 (40%), Positives = 263/494 (53%), Gaps = 64/494 (12%)
Query: 861 KKRIIVIGAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTS---LSVPVDLGASI 917
K +I++GAG +GL AAR L R GF VTVLE R R GGRVYT + + DLG S+
Sbjct: 184 KSSVIIVGAGLSGLAAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEANRVGAAADLGGSV 243
Query: 918 ITGVEADVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNS 977
+TG +P ++ QLG L + CPLY V G+ V +VD +E FN
Sbjct: 244 LTGT--------LGNPLGIIARQLGSSLYKVRDKCPLYR-VDGKPVDPDVDIKVEVAFNQ 294
Query: 978 LLDDMVLLVAQKGEHAMKMSLEDGLEYALKRRRMARLGRGREDASMHNSMDVYSKTSSVD 1037
LLD L G+ +M +SL LE
Sbjct: 295 LLDKASKLRQLMGDVSMDVSLGAALE--------------------------------TF 322
Query: 1038 SRVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCM 1097
+V D + E E + +WH ANLEY A L+ ++SL FW+QDD Y GG HC
Sbjct: 323 RQVSGNDVATE------EMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYD-MGGDHCF 375
Query: 1098 IKGGYSTVVEALGKELLIHHNHVVTDISYSFKDSDLSDGQSRVKVSTSNGSEFSGDAVLI 1157
+ GG +V+AL + + I + V I Y G + VKV+ N + GD VL
Sbjct: 376 LPGGNGRLVQALAENVPILYEKTVQTIRY---------GSNGVKVTAGN-QVYEGDMVLC 425
Query: 1158 TVPLGCLKAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDDTVDYFGATAKET 1217
TVPLG LK SI F P LPQ K I+RLGFG+LNKV + F VFW +D FG ++
Sbjct: 426 TVPLGVLKNGSIKFVPELPQRKLDCIKRLGFGLLNKVAMLFPYVFWSTDLDTFGHLTEDP 485
Query: 1218 DLRGRCFMFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAVMVLRQIF--GAASV 1275
+ RG F+F++ G +LIALV G+AA + + P+D V + +LR I+ +V
Sbjct: 486 NYRGEFFLFYSYAPVAGGALLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINV 545
Query: 1276 PDPVASVVTDWGRDPFSYGAYSYVATGASGEDYDILGRPV-ENCLFFAGEATCKEHPDTV 1334
PDP+ +V T WG DPFS G+YS VA GASG+DYDIL V + LFFAGEAT + +P T+
Sbjct: 546 PDPLQTVCTRWGGDPFSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATM 605
Query: 1335 GGAMLSGLREAVRI 1348
GA ++GLREA +
Sbjct: 606 HGAFVTGLREAANM 619
|
Probable histone demethylase that promotes flowering independently of the photoperiod and vernalization pathways by repressing FLOWERING LOCUS C (FLC), a floral repressor that blocks the transition from vegetative to reproductive development. Probably mediates histone H3 'Lys-4' demethylation at FLC locus. Seems to act in partial redundancy with LDL1 and LDL2 to repress FLC expression. Required for histone H4 deacetylation of FLC locus. May be a component of the histone deacetylase complex. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: -EC: .EC: -EC: .EC: - |
| >sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1624 | ||||||
| 224085802 | 1669 | hypothetical protein POPTRDRAFT_73001 [P | 0.917 | 0.892 | 0.567 | 0.0 | |
| 224062045 | 1655 | hypothetical protein POPTRDRAFT_643019 [ | 0.766 | 0.751 | 0.620 | 0.0 | |
| 359492715 | 2145 | PREDICTED: uncharacterized protein LOC10 | 0.657 | 0.497 | 0.687 | 0.0 | |
| 255538844 | 1947 | lysine-specific histone demethylase, put | 0.680 | 0.567 | 0.664 | 0.0 | |
| 356552077 | 1866 | PREDICTED: uncharacterized protein LOC10 | 0.633 | 0.550 | 0.654 | 0.0 | |
| 356562385 | 1875 | PREDICTED: uncharacterized protein LOC10 | 0.624 | 0.540 | 0.648 | 0.0 | |
| 357466899 | 2063 | Lysine-specific histone demethylase-like | 0.631 | 0.496 | 0.659 | 0.0 | |
| 357438195 | 1935 | Lysine-specific histone demethylase-like | 0.654 | 0.549 | 0.640 | 0.0 | |
| 449470112 | 1909 | PREDICTED: uncharacterized protein LOC10 | 0.628 | 0.534 | 0.639 | 0.0 | |
| 449514663 | 1886 | PREDICTED: uncharacterized protein LOC10 | 0.618 | 0.532 | 0.636 | 0.0 |
| >gi|224085802|ref|XP_002307701.1| hypothetical protein POPTRDRAFT_73001 [Populus trichocarpa] gi|222857150|gb|EEE94697.1| hypothetical protein POPTRDRAFT_73001 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1667 bits (4318), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 958/1687 (56%), Positives = 1157/1687 (68%), Gaps = 197/1687 (11%)
Query: 19 KLRSRKSASESFLRPRVKKMDGEEKKCESKKRSKPVEIGFDSDDDEPIGSLFKLKKQRNP 78
KL S+K S++ L+PRV K E+K+ K+ +E G DSDD+EPIGSLF+LK+ RNP
Sbjct: 15 KLGSQKGLSKNLLKPRVNKGMEEQKELLGKQ----IEFGIDSDDNEPIGSLFRLKRPRNP 70
Query: 79 KKAKG--QKIEAREDKVTVEDDGLVGGMDDTLASFRKKLKGPKKDAGSGVLNGRGSALNG 136
KK K +KIE REDK+ ED+ L GGMDDTLASF+KKLK PKK GS SA+
Sbjct: 71 KKVKVVLEKIEVREDKLVTEDEDL-GGMDDTLASFKKKLKAPKKGLGSV------SAIQN 123
Query: 137 SLDDDWVLDVKLAPKHDEKVGVSCEDGSGVTLDKWVETKCKERVKRSKIDSKMTIIGNHV 196
+ D +LD ++K V+ K KER + K G
Sbjct: 124 --EGDELLDG--------------------NVEKKVQNKRKERASKVGSGWKRVRTGGDA 161
Query: 197 VCDDDSKCLCCRGDSLEDQKEEEL-----------------STFFQRTPSGLLRKSRTNS 239
DDDS+ L +G LE+Q+EE L S F+Q+ SG +RKS NS
Sbjct: 162 AVDDDSEGLGSQGALLENQEEESLLPGESSSQSLDKLEDSISAFYQKKQSGSVRKSCANS 221
Query: 240 GSKQNIKEWSLRDGSIPSS---EGDSK----SLMRSQSVSASKLSRKDPKSDDNSNTVSN 292
SKQ + L P + G SK S RS VS+ + KD + D+S+ V+N
Sbjct: 222 SSKQINRVQCLEARLSPETGFGSGGSKDVDLSTFRSSPVSS--VVCKDLEGGDSSHIVAN 279
Query: 293 -----------LRT---------------LELDSDQCKKVG------------------- 307
L T +E +SD+ K +
Sbjct: 280 SSLLDSTSRQILNTKNQRLDNGFGETSYCIEENSDRIKGLSVSKDESMKSNDKRHGKSSE 339
Query: 308 ----------PMLETYHSNV-----QDPCSSNKVCDSDGKAHTCLPV-----GHASASGQ 347
P L + H + QDPC S+ + GK C P H SA G
Sbjct: 340 VTAEVAAPASPALGSQHGVIEDEETQDPCISDFKGEPMGKP--CSPYRIWNESH-SAPGN 396
Query: 348 KARSDTQTL-DELKLSSMEKASTLILDVVEVPDPASCSKAMEEFHEFDGESDRGFTDALD 406
+ QTL + LKL S+ K ST + L+
Sbjct: 397 NDGLEAQTLKNGLKLCSVGKVST--------------------------------RNTLE 424
Query: 407 LQSNSISAMNVSSPDPEISSSSTGKEVSL---PCAEDELASKSCKTASKQIHVSASEKIL 463
QS +SA +S+ +P+IS SS G+EVS P ++++L + + K+ +V S+ L
Sbjct: 425 QQSKGVSAACISNAEPQISISSGGREVSASSSPHSQNDL--QDLASVPKKENVEISDVRL 482
Query: 464 QATSKLLTQKSLGAEKSESWFNFDQCPADSSNKENAIPSDDEYANGGSPSSVAPDENGSF 523
T S K F C + N + + S +E ANG SP S+ P+EN S+
Sbjct: 483 SP----FTVTSREVHKC----TFSLCMNHNGNSLDYL-SINEEANGPSPRSLTPEENESY 533
Query: 524 TEDTLSMPDYENRDTKLSAVQRAVRNAKKRRLGDMAYEGDADWEVLINEQGFLENHQVMD 583
ED +S+PD + +D L+AV RA+R KKRRLGDMAYEGDADWE LINEQ FLEN+QV++
Sbjct: 534 PEDAVSVPDSDIKDGHLAAVHRAMRKPKKRRLGDMAYEGDADWETLINEQQFLENYQVVE 593
Query: 584 YEQALRTRDKFDSSSTTLTEAENTGAAAVAVGLKARAAGPIERIKFKEILKRRGGLQEYL 643
+++ RTR+K DSSS + EAEN G AAV+ GLKARAAGP+E+IKFKE+LKR+GGLQEYL
Sbjct: 594 SDRSFRTREKSDSSSNS-AEAENGGIAAVSAGLKARAAGPVEKIKFKEVLKRKGGLQEYL 652
Query: 644 ECRNQILSLWSGDVGRILPLTECGVSDTPLGDEPSRASLIREIYKFLDQSGYINVGIAST 703
ECRN+IL LWS DV RILPL +CG+++TP +E RASLIR+IY+FLDQSGYIN GIAS
Sbjct: 653 ECRNRILGLWSKDVSRILPLADCGITETPSQNESPRASLIRQIYEFLDQSGYINAGIASE 712
Query: 704 KEKADHNAKHSYKLLKEERLEKSSGASIADSEDGVAFILGQIKSSETTTEAKHGVECNDG 763
KE A+ +A H+YKL++E+ E + GAS+AD EDGV+FILGQ+KSS+ + E K V +
Sbjct: 713 KESAEPSANHNYKLVEEKTFEGNPGASVADLEDGVSFILGQVKSSQNSLEPKDRVPMD-- 770
Query: 764 NQQIGIKT--GGSMTPELPNEIRQKESVVDDCQQRVDSDPKASNRLVGVDVSCDDPSCGM 821
NQ + +K G + +LPN +E +D +Q S+ K SN L +D DPSC M
Sbjct: 771 NQDLALKALKSGKLV-DLPNVKECEEWPAEDIKQNSVSNTKLSNGLASLDALSTDPSCTM 829
Query: 822 VDGGTVP-LTIEERSESERVQSASCDDAGENHYLRCDIDVKKRIIVIGAGPAGLTAARHL 880
+D T P + E R+ + V+S SC + G +H L CD +K+IIVIGAGPAGLTAARHL
Sbjct: 830 LDSRTAPVINPELRNGLQSVKSNSCAEMGGSHKLLCDSQDRKKIIVIGAGPAGLTAARHL 889
Query: 881 QRQGFSVTVLEARNRIGGRVYTDRTSLSVPVDLGASIITGVEADVATERRADPSSLVCAQ 940
QRQGFSVT+LEAR+RIGGRVYTD +SLSVPVDLGASIITGVEADV TERR DPSSL+CAQ
Sbjct: 890 QRQGFSVTILEARSRIGGRVYTDHSSLSVPVDLGASIITGVEADVTTERRPDPSSLICAQ 949
Query: 941 LGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNSLLDDMVLLVAQKGEHAMKMSLED 1000
LGLELTVLNSDCPLYDIV+G+KVP ++DE LEAE+NSLLDDMVL++AQKG+HAMKMSLED
Sbjct: 950 LGLELTVLNSDCPLYDIVTGEKVPTDLDEELEAEYNSLLDDMVLVIAQKGQHAMKMSLED 1009
Query: 1001 GLEYALKRRRMARLGRGREDASMHNSMDVY--SKTSSVDSRVPDKDCSREDILSPVERRV 1058
GL YALK RRMA G ++ N++D SKT SVD P+ S+E+ILSP+ERRV
Sbjct: 1010 GLNYALKTRRMAHPGAFFDETESGNAVDALYDSKTCSVDGGAPEN--SKEEILSPLERRV 1067
Query: 1059 MDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCMIKGGYSTVVEALGKELLIHHN 1118
MDWHFA+LEYGCAA LKEVSLP+WNQDDVYGGFGGAHCMIKGGYS VVE+LG+ L IH N
Sbjct: 1068 MDWHFAHLEYGCAASLKEVSLPYWNQDDVYGGFGGAHCMIKGGYSNVVESLGERLPIHLN 1127
Query: 1119 HVVTDISYSFKDSDLS-DGQSRVKVSTSNGSEFSGDAVLITVPLGCLKAESIMFSPPLPQ 1177
HVVTDISY KD+ S +S+VKV TSNGSEF GDAVLITVPLGCLKAE+I FSPPLPQ
Sbjct: 1128 HVVTDISYGIKDARASVSHRSKVKVCTSNGSEFLGDAVLITVPLGCLKAEAIKFSPPLPQ 1187
Query: 1178 WKYSAIQRLGFGVLNKVVLEFAEVFWDDTVDYFGATAKETDLRGRCFMFWNVRKTVGAPV 1237
WK S+IQRLGFGVLNKVVLEF +VFWDD++DYFGATA+ETD RG CFMFWNV+KTVGAPV
Sbjct: 1188 WKRSSIQRLGFGVLNKVVLEFPDVFWDDSMDYFGATAEETDRRGHCFMFWNVKKTVGAPV 1247
Query: 1238 LIALVVGKAAVDGQNVSPSDHVNHAVMVLRQIFGAASVPDPVASVVTDWGRDPFSYGAYS 1297
LIALV GKAA+DGQ +S SDHV+HA+MVLR++FG A VPDPVASVVTDWGRDPFSYGAYS
Sbjct: 1248 LIALVAGKAAIDGQRMSSSDHVSHALMVLRKLFGEALVPDPVASVVTDWGRDPFSYGAYS 1307
Query: 1298 YVATGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRIIDILTTGND 1357
YVA G+SGEDYDILGRPVENC+FFAGEATCKEHPDTVGGAM+SGLREAVRIIDIL+ G D
Sbjct: 1308 YVAIGSSGEDYDILGRPVENCVFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILSMGTD 1367
Query: 1358 FTAEVEAMEAAQMQSESEGDEVRDITRRLEAVELSNVLYKNSLDRALILTRESLLQDMFF 1417
FT EVEAME AQ SE E DEVRDIT+RLEAVELSNVLYKNSLDRA +LTRE+LL+DMFF
Sbjct: 1368 FTTEVEAMEGAQRHSEVERDEVRDITKRLEAVELSNVLYKNSLDRARLLTREALLRDMFF 1427
Query: 1418 NAKTTAGRLHLAKELLNLPVATLKSFAGTREGLTTLNSWILDSMGKDGTQLLRHCVRLLV 1477
+AKT AGRLHLAK+LLNLPV TLKSFAGTR+GL LNSWILDSMGKDGTQLLRHCVRLLV
Sbjct: 1428 SAKTIAGRLHLAKKLLNLPVGTLKSFAGTRKGLAMLNSWILDSMGKDGTQLLRHCVRLLV 1487
Query: 1478 RVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLVSVWLEVFRKEKASS-RLKLLKQ 1536
VSTDLLAVRLSGIGKTV+EKVCVHTSRDIRAIASQLVSVWLEVFR+EKAS+ +KL +
Sbjct: 1488 LVSTDLLAVRLSGIGKTVKEKVCVHTSRDIRAIASQLVSVWLEVFRREKASNGGVKLSRH 1547
Query: 1537 STAVDSIKRKSLKDPSSGKPPLHSHHGGLES----KVSPGSH--LTSNANIKKENGK--T 1588
+TA++S KRKS + +S KPPLH+HHG LE+ +VS + L SN+N++K K T
Sbjct: 1548 ATALESSKRKSFNNSTSRKPPLHAHHGALENSGNLQVSTSTRGPLPSNSNMEKAKSKPET 1607
Query: 1589 IKLGSEL 1595
+K S L
Sbjct: 1608 LKCSSRL 1614
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224062045|ref|XP_002300727.1| hypothetical protein POPTRDRAFT_643019 [Populus trichocarpa] gi|222842453|gb|EEE80000.1| hypothetical protein POPTRDRAFT_643019 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359492715|ref|XP_002280631.2| PREDICTED: uncharacterized protein LOC100255769 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255538844|ref|XP_002510487.1| lysine-specific histone demethylase, putative [Ricinus communis] gi|223551188|gb|EEF52674.1| lysine-specific histone demethylase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356552077|ref|XP_003544397.1| PREDICTED: uncharacterized protein LOC100791869 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356562385|ref|XP_003549452.1| PREDICTED: uncharacterized protein LOC100779479 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357466899|ref|XP_003603734.1| Lysine-specific histone demethylase-like protein [Medicago truncatula] gi|355492782|gb|AES73985.1| Lysine-specific histone demethylase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357438195|ref|XP_003589373.1| Lysine-specific histone demethylase-like protein [Medicago truncatula] gi|355478421|gb|AES59624.1| Lysine-specific histone demethylase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449470112|ref|XP_004152762.1| PREDICTED: uncharacterized protein LOC101212190 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449514663|ref|XP_004164443.1| PREDICTED: uncharacterized protein LOC101225931 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1624 | ||||||
| TAIR|locus:2130454 | 1628 | LDL3 "LSD1-like 3" [Arabidopsi | 0.461 | 0.460 | 0.603 | 3.2e-254 | |
| UNIPROTKB|F1NDF4 | 755 | KDM1A "Uncharacterized protein | 0.180 | 0.388 | 0.436 | 7.9e-85 | |
| RGD|1562975 | 755 | Kdm1a "lysine (K)-specific dem | 0.180 | 0.388 | 0.436 | 8.6e-83 | |
| UNIPROTKB|F1LVQ3 | 735 | Kdm1 "Protein Kdm1" [Rattus no | 0.180 | 0.398 | 0.436 | 8.6e-83 | |
| TAIR|locus:2091501 | 746 | LDL2 "LSD1-like2" [Arabidopsis | 0.175 | 0.382 | 0.443 | 2.2e-82 | |
| TAIR|locus:2075870 | 789 | FLD "FLOWERING LOCUS D" [Arabi | 0.181 | 0.372 | 0.427 | 2.6e-82 | |
| UNIPROTKB|F1STX8 | 873 | KDM1A "Uncharacterized protein | 0.180 | 0.335 | 0.436 | 7.4e-79 | |
| MGI|MGI:1196256 | 853 | Kdm1a "lysine (K)-specific dem | 0.180 | 0.343 | 0.436 | 1.1e-78 | |
| UNIPROTKB|F1MBS5 | 873 | KDM1A "Uncharacterized protein | 0.180 | 0.335 | 0.436 | 1.5e-78 | |
| UNIPROTKB|O60341 | 852 | KDM1A "Lysine-specific histone | 0.180 | 0.343 | 0.436 | 2e-78 |
| TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2290 (811.2 bits), Expect = 3.2e-254, Sum P(2) = 3.2e-254
Identities = 467/774 (60%), Positives = 571/774 (73%)
Query: 787 ESVVDDCQQRVDSDPKASNRLVGVDVSCDDPSCGMVDGGTVPLTIEERSESERVQSASCD 846
ES+ C+ + D K S V ++ + D + V+ ++ + + S + SA +
Sbjct: 547 ESISKKCEASIIDDNKRS---VSMN-ALQDSTASNVEKHPETFSVAKPALSSTLSSAHSN 602
Query: 847 DAGENHYLRCDIDVKKRIIVIGAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTS 906
+ C++ +K++IVIGAGPAGLTAARHLQRQGFSVTVLEAR+R+GGRV+TDR+S
Sbjct: 603 QMRGRDCVPCEVIDEKKVIVIGAGPAGLTAARHLQRQGFSVTVLEARSRVGGRVFTDRSS 662
Query: 907 LSVPVDLGASIITGVEADVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPAN 966
LSVPVDLGASIITG+EADV +ER DPS LVC QLGLEL+VL+ CPLYD V+G+KVPA
Sbjct: 663 LSVPVDLGASIITGIEADVPSERMPDPSVLVCNQLGLELSVLHGFCPLYDTVTGKKVPAE 722
Query: 967 VDEALEAEFNSLLDDMVLLVAQKG-EHAMKMSLEDGLEYXXXXXXXXXXXXXXEDASMHN 1025
+D+AL+AEFNSL+DD+ LLV + G E A KMSLEDGLEY + + N
Sbjct: 723 LDDALQAEFNSLIDDVDLLVEEIGKERANKMSLEDGLEYGLQRLRMPHDKVNIDKFGLLN 782
Query: 1026 SMDVYSKTSSVDSRVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQD 1085
S SKT + D+ ++D L+P+ERRVM+WHFA+ EYGCAA+LKEVSLP WNQD
Sbjct: 783 SS---SKTGIRGPFMQDESW-KDDFLNPLERRVMNWHFAHTEYGCAAVLKEVSLPHWNQD 838
Query: 1086 DVYGGFGGAHCMIKGGYSTVVEALGKELLIHHNHVVTDISYSFKDSDLSDGQSRVKVSTS 1145
+ YGGFGG H MIKGGYS VVE+L + L IH N +V+D+SY S + + + +V+VSTS
Sbjct: 839 EFYGGFGGPHAMIKGGYSRVVESLAEGLDIHLNKIVSDVSYVSDVSAMDNSKHKVRVSTS 898
Query: 1146 NGSEFSGDAVLITVPLGCLKAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDD 1205
NG E+ GDAVL+TVPLGCLKAE+I FSPPLP WKY++I++LGFGVLNKVVLEF VFWDD
Sbjct: 899 NGCEYLGDAVLVTVPLGCLKAETIKFSPPLPDWKYASIKQLGFGVLNKVVLEFPTVFWDD 958
Query: 1206 TVDYFGATAKETDLRGRCFMFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAVMV 1265
+VDYFGATA+ETDLRG CFMFWNV+KTVGAPVLIALVVGKAA + N S S+HVNHA+MV
Sbjct: 959 SVDYFGATAEETDLRGECFMFWNVKKTVGAPVLIALVVGKAAFEYTNKSKSEHVNHAMMV 1018
Query: 1266 LRQIFGXXXXXXXXXXXXTDWGRDPFSYGAYSYVATGASGEDYDILGRPVENCLFFAGEA 1325
LR++FG TDWG DP+SYGAYSYVA GASGEDYD+LGRPV+NCLFFAGEA
Sbjct: 1019 LRKLFGGDLVPDPVASVVTDWGTDPYSYGAYSYVAIGASGEDYDVLGRPVQNCLFFAGEA 1078
Query: 1326 TCKEHPDTVGGAMLSGLREAVRIIDILTTGNDFTXXXXXXXXXXXXXXXXGDEVRDITRR 1385
TCKEHPDTVGGAM++G+REAVRIIDIL +GND+T DEVRD+ +R
Sbjct: 1079 TCKEHPDTVGGAMMTGVREAVRIIDILRSGNDYTAEIETLEKAQRKSVPVRDEVRDLIKR 1138
Query: 1386 LEAVELSNVLYKNSLDRALILTRESLLQDMFFNAKTTAGRLHLAKELLNLPVATLKSFAG 1445
LE VELSNVL R+SLL++MFF+AKTT GRLHLAKELLNLP TLKSFAG
Sbjct: 1139 LEVVELSNVL-----------ARQSLLRNMFFSAKTTVGRLHLAKELLNLPGETLKSFAG 1187
Query: 1446 TREGLTTLNSWILDSMGKDGTQXXXXXXXXXXXXSTDLLAVRLSGIGKTVREKVCVHTSR 1505
T+EGL LNSWILDSMGK+GTQ ++DL A+RLSGIGKTV+EKVC HTSR
Sbjct: 1188 TKEGLAVLNSWILDSMGKNGTQLLRHCVHILVRVTSDLFALRLSGIGKTVKEKVCAHTSR 1247
Query: 1506 DIRAIASQLVSVWLEVFRKEKASSRLKLLKQSTAVDSIK-RKSLKDP---SSGK 1555
DIRAIASQLV+VWL+++RKEKA+S K L+Q+ ++ + R+ L P S GK
Sbjct: 1248 DIRAIASQLVNVWLDLYRKEKANSGKKSLRQANTTNTSRIRRKLNSPDTDSKGK 1301
|
|
| UNIPROTKB|F1NDF4 KDM1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1562975 Kdm1a "lysine (K)-specific demethylase 1A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LVQ3 Kdm1 "Protein Kdm1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075870 FLD "FLOWERING LOCUS D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STX8 KDM1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196256 Kdm1a "lysine (K)-specific demethylase 1A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MBS5 KDM1A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60341 KDM1A "Lysine-specific histone demethylase 1A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.4.3.2 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.5.3.17 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.4.3.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1624 | |||
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 0.0 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 1e-101 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 1e-100 | |
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 4e-97 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 5e-91 | |
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 9e-88 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 1e-47 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 2e-23 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 7e-18 | |
| pfam13450 | 66 | pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- | 1e-15 | |
| COG1233 | 487 | COG1233, COG1233, Phytoene dehydrogenase and relat | 1e-15 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 1e-12 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 9e-11 | |
| PRK11749 | 457 | PRK11749, PRK11749, dihydropyrimidine dehydrogenas | 2e-10 | |
| PRK11883 | 451 | PRK11883, PRK11883, protoporphyrinogen oxidase; Re | 3e-10 | |
| PRK07208 | 479 | PRK07208, PRK07208, hypothetical protein; Provisio | 3e-10 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 2e-09 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 2e-09 | |
| TIGR03997 | 645 | TIGR03997, mycofact_OYE_2, mycofactocin system Fad | 2e-09 | |
| PRK12810 | 471 | PRK12810, gltD, glutamate synthase subunit beta; R | 4e-09 | |
| TIGR02734 | 502 | TIGR02734, crtI_fam, phytoene desaturase | 5e-09 | |
| PRK09853 | 1019 | PRK09853, PRK09853, putative selenate reductase su | 7e-09 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-08 | |
| COG1232 | 444 | COG1232, HemY, Protoporphyrinogen oxidase [Coenzym | 3e-08 | |
| TIGR02733 | 492 | TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | 6e-08 | |
| COG0446 | 415 | COG0446, HcaD, Uncharacterized NAD(FAD)-dependent | 7e-08 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 9e-08 | |
| pfam04433 | 80 | pfam04433, SWIRM, SWIRM domain | 1e-07 | |
| PRK04176 | 257 | PRK04176, PRK04176, ribulose-1,5-biphosphate synth | 1e-07 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 1e-07 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 5e-07 | |
| COG2072 | 443 | COG2072, TrkA, Predicted flavoprotein involved in | 5e-07 | |
| COG1635 | 262 | COG1635, THI4, Ribulose 1,5-bisphosphate synthetas | 5e-07 | |
| COG1148 | 622 | COG1148, HdrA, Heterodisulfide reductase, subunit | 7e-07 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 7e-07 | |
| TIGR00275 | 400 | TIGR00275, TIGR00275, flavoprotein, HI0933 family | 3e-06 | |
| COG0493 | 457 | COG0493, GltD, NADPH-dependent glutamate synthase | 4e-06 | |
| PRK12814 | 652 | PRK12814, PRK12814, putative NADPH-dependent gluta | 4e-06 | |
| TIGR01316 | 449 | TIGR01316, gltA, glutamate synthase (NADPH), homot | 5e-06 | |
| PLN02172 | 461 | PLN02172, PLN02172, flavin-containing monooxygenas | 8e-06 | |
| PRK13984 | 604 | PRK13984, PRK13984, putative oxidoreductase; Provi | 9e-06 | |
| PRK12831 | 464 | PRK12831, PRK12831, putative oxidoreductase; Provi | 9e-06 | |
| COG3380 | 331 | COG3380, COG3380, Predicted NAD/FAD-dependent oxid | 1e-05 | |
| PRK12778 | 752 | PRK12778, PRK12778, putative bifunctional 2-polypr | 1e-05 | |
| COG1249 | 454 | COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas | 1e-05 | |
| TIGR01317 | 485 | TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH | 2e-05 | |
| TIGR02032 | 295 | TIGR02032, GG-red-SF, geranylgeranyl reductase fam | 2e-05 | |
| pfam01946 | 229 | pfam01946, Thi4, Thi4 family | 2e-05 | |
| COG0492 | 305 | COG0492, TrxB, Thioredoxin reductase [Posttranslat | 2e-05 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 2e-05 | |
| TIGR00292 | 254 | TIGR00292, TIGR00292, thiazole biosynthesis enzyme | 4e-05 | |
| TIGR03315 | 1012 | TIGR03315, Se_ygfK, putative selenate reductase, Y | 5e-05 | |
| COG0562 | 374 | COG0562, Glf, UDP-galactopyranose mutase [Cell env | 6e-05 | |
| PRK01747 | 662 | PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- | 7e-05 | |
| PRK06753 | 373 | PRK06753, PRK06753, hypothetical protein; Provisio | 8e-05 | |
| pfam03486 | 405 | pfam03486, HI0933_like, HI0933-like protein | 8e-05 | |
| PRK12409 | 410 | PRK12409, PRK12409, D-amino acid dehydrogenase sma | 2e-04 | |
| pfam00890 | 401 | pfam00890, FAD_binding_2, FAD binding domain | 2e-04 | |
| PLN02576 | 496 | PLN02576, PLN02576, protoporphyrinogen oxidase | 2e-04 | |
| PRK09126 | 392 | PRK09126, PRK09126, hypothetical protein; Provisio | 4e-04 | |
| TIGR01372 | 985 | TIGR01372, soxA, sarcosine oxidase, alpha subunit | 4e-04 | |
| COG2081 | 408 | COG2081, COG2081, Predicted flavoproteins [General | 5e-04 | |
| COG2907 | 447 | COG2907, COG2907, Predicted NAD/FAD-binding protei | 5e-04 | |
| PRK08243 | 392 | PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen | 5e-04 | |
| PRK12769 | 654 | PRK12769, PRK12769, putative oxidoreductase Fe-S b | 9e-04 | |
| PRK07538 | 413 | PRK07538, PRK07538, hypothetical protein; Provisio | 0.001 | |
| pfam12831 | 415 | pfam12831, FAD_oxidored, FAD dependent oxidoreduct | 0.001 | |
| pfam13454 | 153 | pfam13454, NAD_binding_9, FAD-NAD(P)-binding | 0.001 | |
| COG0569 | 225 | COG0569, TrkA, K+ transport systems, NAD-binding c | 0.001 | |
| PRK06183 | 500 | PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr | 0.002 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 0.002 | |
| PRK08163 | 396 | PRK08163, PRK08163, salicylate hydroxylase; Provis | 0.002 | |
| PRK05249 | 461 | PRK05249, PRK05249, soluble pyridine nucleotide tr | 0.002 | |
| PRK12770 | 352 | PRK12770, PRK12770, putative glutamate synthase su | 0.002 | |
| TIGR04018 | 316 | TIGR04018, Bthiol_YpdA, putative bacillithiol syst | 0.003 | |
| PRK12779 | 944 | PRK12779, PRK12779, putative bifunctional glutamat | 0.003 | |
| TIGR01318 | 467 | TIGR01318, gltD_gamma_fam, glutamate synthase smal | 0.003 | |
| pfam13738 | 202 | pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp | 0.003 | |
| PRK08132 | 547 | PRK08132, PRK08132, FAD-dependent oxidoreductase; | 0.003 | |
| PRK12834 | 549 | PRK12834, PRK12834, putative FAD-binding dehydroge | 0.004 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 0.004 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 0.004 |
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
Score = 1880 bits (4872), Expect = 0.0
Identities = 896/1573 (56%), Positives = 1051/1573 (66%), Gaps = 158/1573 (10%)
Query: 38 MDGEEKKCESKKRSKPVEIGFDSDDDEPIGSLFKLKKQRNPKKAK--GQKIEAREDKVTV 95
M +E+K SK+ K ++IG DSDDDEPIGSLFKLK+ +N KK K + RE+K++
Sbjct: 1 MKDKERKSGSKRGLKVIQIGDDSDDDEPIGSLFKLKRPKNSKKVKVGLESTGKREEKLSA 60
Query: 96 EDDGLVGGMDDTLASFRKKLKGPKKDAGSGVLNGRGSALNGSLDDDWVLDVKLAPKHDEK 155
D+ GMDDTLASFRK+LKGPKK GS A L +E
Sbjct: 61 LDEDS-EGMDDTLASFRKRLKGPKKGVGSVSARMSQGA--------------LLENQEEV 105
Query: 156 VGVSCEDGSGVTLDKWVETKCKERVKRSKIDSKMTIIGNHVVCDDDSKCLCCRGDSLEDQ 215
D + K + + DS S L L +
Sbjct: 106 -------------DTVLNEGSKRSLDGNLEDSL-------------SAFLREAQAGLSRK 139
Query: 216 KEEELSTFFQRTPSGLLRKSRTNSGSKQNIKEWSLRDGSIPSSEGDSKSLMRSQS----- 270
S NS KQ + L G P SE +
Sbjct: 140 -------------------SCANSCGKQLNRVQGLEAGLSPGSEKVKTVSNEREGNGFHQ 180
Query: 271 VSASKLSRKDPKSDDNSNTVSNLRTLELDSDQCKKVG-PMLETYHSNVQDPCSSNKVCDS 329
+S +D S+ + ++ + + +V P LE++ ++D + +
Sbjct: 181 ISYHTEEAEDGISEVAATKDRVSKSSDDRHGESSEVNHPALESHSGVIEDENMVD-PSIA 239
Query: 330 DGKAHTCLPVGHASASGQKARSDTQTLDELKLSSMEKASTLILDVVEVPDPASCSKAMEE 389
+ P+G + + L L S K T
Sbjct: 240 PTQEE---PLGEPCSEDRICDKKG-----LVLCSCGKQPTF------------------- 272
Query: 390 FHEFDGESDRGFTDALDLQSNSISAMNVSSPDPEISSSSTGKEVSLPCAEDELASKSCKT 449
AL QS +S +SS + + S SS KE S
Sbjct: 273 ----------EIKSALSQQSKGVSTKCISSAEQQASVSSDNKETS--------------- 307
Query: 450 ASKQIHVSASEKILQATSKLLTQKSLGAEKSESWFNFDQCPADSSNKENAIPSDDEYANG 509
S ++H + + L + E D I NG
Sbjct: 308 -STEVHKANFTMQMNHNGGSL--EVNTLE--------DSPSH-------DIVGSHPVCNG 349
Query: 510 GSPSSVAPDENGSFTEDTLSMPDYENRDTKLSAVQRAVRNAKKRRLGDMAYEGDADWEVL 569
SP S+ P+EN S+ ED +S+PD E +D KLS +QR R AKKR+LGDMAYEGDADWE L
Sbjct: 350 ASPVSITPEENESYVEDAVSLPDSEIKDGKLSKLQRVTRKAKKRKLGDMAYEGDADWETL 409
Query: 570 INEQGFLENHQVMDYEQALRTRDKFDSSSTTLTEAENTGAAAVAVGLKARAAGPIERIKF 629
INEQGFLEN D +++ +TRDK DSSS E EN GAAAV+ GLKARA GPIE+IKF
Sbjct: 410 INEQGFLENPSACDSDRSFKTRDKSDSSS-VSKEGENGGAAAVSAGLKARAVGPIEKIKF 468
Query: 630 KEILKRRGGLQEYLECRNQILSLWSGDVGRILPLTECGVSDTPLGDEPSRASLIREIYKF 689
KE+LKR+GGLQEYLECRN IL LWS DV RILPL +CGV+DTP DE RASLIRE+Y F
Sbjct: 469 KEVLKRKGGLQEYLECRNMILGLWSKDVSRILPLADCGVTDTPSEDESPRASLIREVYLF 528
Query: 690 LDQSGYINVGIASTKEKADHNAKHSYKLLKEERLEKSSGASIADSEDGVAFILGQIKSSE 749
LDQ GYIN GIAS KEKA+ + H+YKL++E+ LE+SSGAS+ADSEDGV+FILGQ+KSSE
Sbjct: 529 LDQRGYINAGIASEKEKAEPSTNHNYKLVEEKTLEESSGASVADSEDGVSFILGQVKSSE 588
Query: 750 TTTEAKHGVECNDGNQQIGIKTGGSMTPELPNEIRQKESVVDDCQQRVDSDPKASNRLVG 809
++TE K V +D N G +LPN E + D QQ S+ K +N LV
Sbjct: 589 SSTEGKDCVLVDDENDASG---------DLPNVCECSELLASDIQQCGASNEKLNNGLVS 639
Query: 810 VDVSCDDPSCGMVDG-GTVPLTIEE-RSESERVQSASCDDAGENHYLRCDIDVKKRIIVI 867
+D PS ++D T+ + E R+E + VQS SC + G NH + CD +K+IIV+
Sbjct: 640 LDALSASPSSSVLDSPETLSVIKPELRNELQSVQSNSCIEMGGNHCVLCDSVDRKKIIVV 699
Query: 868 GAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTSLSVPVDLGASIITGVEADVAT 927
GAGPAGLTAARHLQRQGFSVTVLEAR+RIGGRVYTDR+SLSVPVDLGASIITGVEADVAT
Sbjct: 700 GAGPAGLTAARHLQRQGFSVTVLEARSRIGGRVYTDRSSLSVPVDLGASIITGVEADVAT 759
Query: 928 ERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNSLLDDMVLLVA 987
ERR DPSSL+CAQLGLELTVLNSDCPLYD+V+G+KVPA++DEALEAE+NSLLDDMVLLVA
Sbjct: 760 ERRPDPSSLICAQLGLELTVLNSDCPLYDVVTGEKVPADLDEALEAEYNSLLDDMVLLVA 819
Query: 988 QKGEHAMKMSLEDGLEYALKRRRMARLGRG-REDASMHNSMDVY-SKTSSVDSRVPDKDC 1045
QKGEHAMKMSLEDGLEYALKRRRM R G E + + D+Y S ++ VD +K+
Sbjct: 820 QKGEHAMKMSLEDGLEYALKRRRMPRPGVDIDETELGNAADDLYDSASTGVDGGHCEKE- 878
Query: 1046 SREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCMIKGGYSTV 1105
S+ED+LSP+ERRVM+WHFA+LEYGCAALLKEVSLP+WNQDDVYGGFGGAHCMIKGGYS V
Sbjct: 879 SKEDVLSPLERRVMNWHFAHLEYGCAALLKEVSLPYWNQDDVYGGFGGAHCMIKGGYSNV 938
Query: 1106 VEALGKELLIHHNHVVTDISYSFKDSDLSDGQ-SRVKVSTSNGSEFSGDAVLITVPLGCL 1164
VE+L + L IH NHVVTD+SY KD+ S +VKVSTSNGSEF GDAVLITVPLGCL
Sbjct: 939 VESLAEGLDIHLNHVVTDVSYGSKDAGASGSSRKKVKVSTSNGSEFLGDAVLITVPLGCL 998
Query: 1165 KAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDDTVDYFGATAKETDLRGRCF 1224
KAE+I FSPPLP WKYS+IQRLGFGVLNKVVLEF EVFWDD+VDYFGATA+ETDLRG+CF
Sbjct: 999 KAETIKFSPPLPDWKYSSIQRLGFGVLNKVVLEFPEVFWDDSVDYFGATAEETDLRGQCF 1058
Query: 1225 MFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAVMVLRQIFGAASVPDPVASVVT 1284
MFWNV+KTVGAPVLIALVVGKAA+DGQ++S SDHVNHA+MVLR++FG A VPDPVASVVT
Sbjct: 1059 MFWNVKKTVGAPVLIALVVGKAAIDGQSMSSSDHVNHALMVLRKLFGEALVPDPVASVVT 1118
Query: 1285 DWGRDPFSYGAYSYVATGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMLSGLRE 1344
DWGRDPFSYGAYSYVA GASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAM+SGLRE
Sbjct: 1119 DWGRDPFSYGAYSYVAIGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMMSGLRE 1178
Query: 1345 AVRIIDILTTGNDFTAEVEAMEAAQMQSESEGDEVRDITRRLEAVELSNVLYKNSLDRAL 1404
AVRIIDIL TGND+TAEVEA+E AQ SESE DEVRDIT+RLEAVELSNVLYKNSLD
Sbjct: 1179 AVRIIDILNTGNDYTAEVEALETAQRHSESERDEVRDITKRLEAVELSNVLYKNSLDADP 1238
Query: 1405 ILTRESLLQDMFFNAKTTAGRLHLAKELLNLPVATLKSFAGTREGLTTLNSWILDSMGKD 1464
ILTRE+LLQ+MFF+AKTTAGRLHLAKELLNLPV TLKSFAGT+EGL TLNSWILDSMGKD
Sbjct: 1239 ILTREALLQEMFFSAKTTAGRLHLAKELLNLPVETLKSFAGTKEGLATLNSWILDSMGKD 1298
Query: 1465 GTQLLRHCVRLLVRVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLVSVWLEVFRK 1524
GTQLLRHCVRLLV VSTDLLAVRLSGIGKTV+EKVCVHTSRDIRAIASQLVSVWLEVFR+
Sbjct: 1299 GTQLLRHCVRLLVLVSTDLLAVRLSGIGKTVKEKVCVHTSRDIRAIASQLVSVWLEVFRR 1358
Query: 1525 EKASS-RLKLLKQSTAVDSIKRKSLKDPS-SGKPPLHSHHGGLESKVSPGSHLT-SNANI 1581
EKAS+ LKLL+Q+TA +S KR+ L PS K L S K S + +I
Sbjct: 1359 EKASNGGLKLLRQATANESSKRRKLNSPSTDTKGKLSSLENVKTDKSKSESLKSVGRQDI 1418
Query: 1582 KKENGKTIKLGSE 1594
++E G I + E
Sbjct: 1419 EEEEGNQIPMSEE 1431
|
Length = 1713 |
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|203011 pfam04433, SWIRM, SWIRM domain | Back alignment and domain information |
|---|
| >gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224550 COG1635, THI4, Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|232901 TIGR00275, TIGR00275, flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|145231 pfam01946, Thi4, Thi4 family | Back alignment and domain information |
|---|
| >gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|232908 TIGR00292, TIGR00292, thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225459 COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|222141 pfam13454, NAD_binding_9, FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >gnl|CDD|223643 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235373 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237197 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family | Back alignment and domain information |
|---|
| >gnl|CDD|183740 PRK12779, PRK12779, putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|236158 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1624 | |||
| PLN02976 | 1713 | amine oxidase | 100.0 | |
| PLN03000 | 881 | amine oxidase | 100.0 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 100.0 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 100.0 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 100.0 | |
| PLN02268 | 435 | probable polyamine oxidase | 100.0 | |
| PLN02568 | 539 | polyamine oxidase | 100.0 | |
| PLN02676 | 487 | polyamine oxidase | 100.0 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 100.0 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 100.0 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 100.0 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 100.0 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 100.0 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 100.0 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 100.0 | |
| PLN02612 | 567 | phytoene desaturase | 100.0 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 100.0 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 100.0 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 99.97 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.97 | |
| PLN02487 | 569 | zeta-carotene desaturase | 99.97 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.96 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 99.96 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.96 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.95 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.94 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.9 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.9 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.87 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.82 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.79 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.77 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 99.45 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 99.44 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.34 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 99.23 | |
| PF04433 | 86 | SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM | 99.19 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.1 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 99.07 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 98.99 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 98.98 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 98.93 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 98.87 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 98.86 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 98.86 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.85 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 98.82 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 98.81 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 98.81 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.8 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 98.79 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 98.79 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.78 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.77 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 98.76 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 98.75 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 98.74 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 98.73 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.72 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 98.71 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 98.71 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 98.71 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 98.7 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.69 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 98.69 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 98.68 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 98.67 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 98.67 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 98.66 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 98.66 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 98.66 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 98.65 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 98.64 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 98.63 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 98.63 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 98.62 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 98.62 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 98.61 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.61 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 98.61 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.61 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 98.61 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.61 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 98.6 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 98.58 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 98.56 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 98.56 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 98.55 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.55 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 98.53 | |
| PRK05868 | 372 | hypothetical protein; Validated | 98.53 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 98.53 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 98.53 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 98.51 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 98.51 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 98.48 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 98.48 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 98.46 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 98.45 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 98.44 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.42 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 98.41 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 98.39 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 98.39 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.38 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 98.37 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.35 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 98.35 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 98.35 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 98.34 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 98.33 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 98.31 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 98.31 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 98.31 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 98.29 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 98.29 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 98.27 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.24 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 98.23 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 98.23 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 98.22 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 98.22 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 98.22 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 98.17 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.15 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.12 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 98.07 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.04 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 98.04 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.04 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 98.01 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 98.0 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 97.99 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 97.97 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 97.97 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 97.95 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.95 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 97.92 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.88 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 97.88 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 97.85 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 97.84 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 97.83 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 97.83 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 97.81 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 97.76 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 97.74 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 97.73 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 97.71 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 97.69 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 97.69 | |
| PLN02661 | 357 | Putative thiazole synthesis | 97.67 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 97.64 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.63 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 97.62 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 97.62 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 97.6 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 97.59 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.58 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 97.57 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.56 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.56 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 97.55 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 97.53 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 97.53 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 97.52 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.52 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 97.51 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.5 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.5 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 97.43 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 97.42 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.42 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 97.4 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 97.4 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.39 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.38 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 97.37 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.35 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 97.31 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 97.31 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 97.3 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.29 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.28 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 97.26 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 97.25 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 97.24 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 97.24 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 97.22 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.22 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 97.21 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 97.19 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 97.18 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 97.16 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 97.14 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.14 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.11 | |
| PRK07121 | 492 | hypothetical protein; Validated | 97.11 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 97.08 | |
| PLN02985 | 514 | squalene monooxygenase | 97.07 | |
| PLN02507 | 499 | glutathione reductase | 97.06 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 97.06 | |
| PLN02463 | 447 | lycopene beta cyclase | 97.05 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 97.01 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 97.01 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 97.01 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 97.0 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 96.96 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 96.96 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 96.93 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 96.92 | |
| PLN02546 | 558 | glutathione reductase | 96.91 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 96.89 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 96.85 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 96.84 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 96.84 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.81 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.8 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 96.79 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 96.75 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 96.75 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 96.74 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 96.74 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 96.73 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 96.72 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 96.71 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 96.7 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 96.7 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.7 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 96.68 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 96.65 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.64 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 96.62 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 96.6 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 96.59 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 96.58 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 96.58 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 96.58 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 96.55 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 96.51 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.5 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 96.5 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.47 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.42 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 96.41 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 96.4 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 96.39 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 96.37 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 96.37 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 96.36 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 96.35 | |
| PLN02815 | 594 | L-aspartate oxidase | 96.33 | |
| PF08711 | 53 | Med26: TFIIS helical bundle-like domain; InterPro: | 96.32 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 96.28 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 96.26 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 96.24 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 96.23 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 96.13 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 96.05 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 96.05 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 96.04 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 95.99 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 95.98 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 95.9 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 95.89 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 95.89 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 95.89 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 95.88 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 95.86 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 95.78 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 95.69 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 95.67 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 95.62 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 95.58 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 95.57 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 95.56 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 95.52 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 95.28 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 95.2 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 95.16 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 95.14 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 95.07 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 95.04 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 94.96 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 94.91 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 94.9 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 94.65 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 94.43 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 94.39 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 94.35 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 94.21 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 94.18 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 93.87 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 93.85 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 93.76 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 93.54 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 93.5 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.44 | |
| PLN02785 | 587 | Protein HOTHEAD | 93.43 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.41 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 93.38 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 93.32 | |
| cd00183 | 76 | TFIIS_I N-terminal domain (domain I) of transcript | 93.23 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 92.87 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 92.6 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 92.47 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 92.32 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 92.3 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 92.23 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 92.18 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 91.9 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 91.87 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 91.86 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 91.8 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 91.66 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 91.66 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 91.56 | |
| PRK06370 | 463 | mercuric reductase; Validated | 91.54 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 91.52 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 91.49 | |
| smart00509 | 75 | TFS2N Domain in the N-terminus of transcription el | 91.49 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 91.43 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 91.37 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 91.31 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 91.31 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 91.21 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 91.11 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 91.09 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 91.08 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 91.06 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 91.06 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.87 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 90.7 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 90.65 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 90.52 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 90.51 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 90.44 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 90.43 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 90.38 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 90.09 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 89.73 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 89.72 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.37 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 89.33 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 89.25 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 89.25 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.15 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 89.11 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 89.05 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 89.04 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.97 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 88.93 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 88.89 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 88.73 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 88.56 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.55 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.41 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 88.41 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 88.34 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 88.21 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 88.09 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 88.09 | |
| PRK06116 | 450 | glutathione reductase; Validated | 88.09 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 87.98 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 87.95 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 87.89 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 87.89 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 87.81 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 87.79 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 87.72 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 87.72 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 87.66 | |
| PLN02507 | 499 | glutathione reductase | 87.57 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 87.42 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 87.33 | |
| PLN02546 | 558 | glutathione reductase | 87.25 | |
| PLN02463 | 447 | lycopene beta cyclase | 86.85 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 86.82 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 86.79 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 86.65 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 86.55 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 86.43 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 86.37 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 86.32 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 86.26 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 85.88 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 85.76 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 85.67 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 85.64 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.57 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 85.54 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 85.47 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 85.4 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 85.39 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.35 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 85.34 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 85.3 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 85.13 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 85.08 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 85.03 | |
| TIGR01816 | 565 | sdhA_forward succinate dehydrogenase, flavoprotein | 85.02 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.93 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 84.8 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.58 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 84.52 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 84.45 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 84.42 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 84.36 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 84.35 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 84.24 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 84.2 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 84.12 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 84.01 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 83.92 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 83.83 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 83.8 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 83.48 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 83.42 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.27 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 83.15 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 83.1 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 83.03 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 82.98 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 82.68 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 82.59 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 82.43 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 82.39 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 82.2 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 82.06 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 82.0 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 81.77 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 81.6 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 81.4 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 81.29 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 81.09 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 80.98 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 80.31 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 80.3 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 80.04 |
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-207 Score=1962.10 Aligned_cols=1348 Identities=66% Similarity=0.967 Sum_probs=1138.2
Q ss_pred hhhhhhcccCCCCceeeeccCCCCCccceeEEEecccCcccccc--ccceeccCcccccccCCcCCCCchhhhhhhhccC
Q 046008 40 GEEKKCESKKRSKPVEIGFDSDDDEPIGSLFKLKKQRNPKKAKG--QKIEAREDKVTVEDDGLVGGMDDTLASFRKKLKG 117 (1624)
Q Consensus 40 e~~~k~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 117 (1624)
....|+++++..++|+||+|++|+|||+++|+|+++++++|+|+ .+...++++++.++++ ++||||||++|++++++
T Consensus 3 ~~~~~~~~~~~~k~i~~g~d~~ddepigs~~kl~~~~~~~k~k~~~~~~g~~~~~~~~~~~~-~~~mddtla~~~kr~~~ 81 (1713)
T PLN02976 3 DKERKSGSKRGLKVIQIGDDSDDDEPIGSLFKLKRPKNSKKVKVGLESTGKREEKLSALDED-SEGMDDTLASFRKRLKG 81 (1713)
T ss_pred cccccccccccCCceecccccccccccccceeeecccccccceecccccccccccccccccc-ccccchhHHHHHHhccC
Confidence 34578888888999999999999999999999999999999998 7779999999998888 99999999999999999
Q ss_pred CCCCCCCCcccCCCCCCCCCCCccccccccccccccccccccccCCCCCChhhhHHhhhhhhhhccccCccccccCCccc
Q 046008 118 PKKDAGSGVLNGRGSALNGSLDDDWVLDVKLAPKHDEKVGVSCEDGSGVTLDKWVETKCKERVKRSKIDSKMTIIGNHVV 197 (1624)
Q Consensus 118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~ 197 (1624)
+|+..+++. +.. -....+.|- ..+ +.+.
T Consensus 82 ~~k~v~~~~------~~~--s~~~~~~d~-----------------~e~--~~~~------------------------- 109 (1713)
T PLN02976 82 PKKGVGSVS------ARM--SQGALLENQ-----------------EEV--DTVL------------------------- 109 (1713)
T ss_pred ccccccchh------ccc--ccccccccc-----------------chh--cccc-------------------------
Confidence 999999771 111 000001110 000 0000
Q ss_pred ccCCCCccccccccccc-hhhhhhhhhhhcCCCCcccccccccCccccccccccccCCCCCCCCCcc-cccccc------
Q 046008 198 CDDDSKCLCCRGDSLED-QKEEELSTFFQRTPSGLLRKSRTNSGSKQNIKEWSLRDGSIPSSEGDSK-SLMRSQ------ 269 (1624)
Q Consensus 198 ~~~~s~~s~~~~~~i~k-~~~~~l~~~f~~~~~~~l~~s~~~~s~~~~~~~~~l~~~~~~~~~~~~~-d~~R~~------ 269 (1624)
.+.++ .+++ .+|..++++++.+|.|+.++++++++++++++...|...+++.+..... ..+|..
T Consensus 110 -~~gs~-------~s~d~~~e~~~~~~~~~~~a~~~~~s~~~~~~~~~~r~~~~ea~~~~~~~~~~~~~~~~~~~~~~~~ 181 (1713)
T PLN02976 110 -NEGSK-------RSLDGNLEDSLSAFLREAQAGLSRKSCANSCGKQLNRVQGLEAGLSPGSEKVKTVSNEREGNGFHQI 181 (1713)
T ss_pred -ccCcc-------cccccchHHHHHHHHHHhhcccccCccccccccccccccccccccCCCcccccchhccccccccccc
Confidence 00111 1223 5666789999999999999999999999999999999999987754321 112221
Q ss_pred ---cccc-------cccccCCCCCCCCcccccccccccccccccccCCCccccccccccCCCCCCccccCCCCccccCCC
Q 046008 270 ---SVSA-------SKLSRKDPKSDDNSNTVSNLRTLELDSDQCKKVGPMLETYHSNVQDPCSSNKVCDSDGKAHTCLPV 339 (1624)
Q Consensus 270 ---s~s~-------~~l~~~~~k~~~~~~~~s~~~~~~lk~~k~~~~~~~~~~~~e~~~~~~ss~~~~~~~~~~~~~~~~ 339 (1624)
.+.+ +--..-++++.+.++..|+.+-+..- .+++..++.||+++|+.+..|.+.-|+ ||..+
T Consensus 182 ~~~~~~~~~~~~~~~~~~~~~~~s~~~~~g~s~~~~~p~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~ 253 (1713)
T PLN02976 182 SYHTEEAEDGISEVAATKDRVSKSSDDRHGESSEVNHPAL------ESHSGVIEDENMVDPSIAPTQEEPLGE--PCSED 253 (1713)
T ss_pred cccccccccccccccccccccccccccccCccccccCccc------cccccccccccccCCccccccccccCC--cCccc
Confidence 0111 11122333555657776665533322 467778888999999999999888887 66666
Q ss_pred ccccccccccccccccccccccccccccccceeeccccCCCCCccccccccccccCCcccccccccccCccccccccCCC
Q 046008 340 GHASASGQKARSDTQTLDELKLSSMEKASTLILDVVEVPDPASCSKAMEEFHEFDGESDRGFTDALDLQSNSISAMNVSS 419 (1624)
Q Consensus 340 ~~~~~s~~~~~~~~~~~~~~k~~~~~~~~~~~~~~v~~~~~~~~~t~~~~~~~~~~e~~~~l~~~~~~~~~~~~~~~~s~ 419 (1624)
.++. -++++.|++++... ..+.....++|..+.++|+++
T Consensus 254 ~~~~------------~~~l~~cs~g~~~~-----------------------------~~~~~~~~~~~~~v~~kc~~~ 292 (1713)
T PLN02976 254 RICD------------KKGLVLCSCGKQPT-----------------------------FEIKSALSQQSKGVSTKCISS 292 (1713)
T ss_pred cccc------------cccccccccCCCCC-----------------------------ccccchhhccccccccchhcc
Confidence 6544 24778999877652 222344557788888999999
Q ss_pred CCCCCCCCCCCccccCCCCCchhhhhcccccccccccccccchhccccccccccCCCccccccccccCCCCCC-CCC-CC
Q 046008 420 PDPEISSSSTGKEVSLPCAEDELASKSCKTASKQIHVSASEKILQATSKLLTQKSLGAEKSESWFNFDQCPAD-SSN-KE 497 (1624)
Q Consensus 420 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~K~~~~~~s~~~s~~~s~~~~~kss~~~~~~s~~~~~~~~~~-~~~-s~ 497 (1624)
..++++.++..+.+++. .+|++.-.|-|++--.+ ... ..
T Consensus 293 ~~~~~~~~~~~k~~~~~---------------------------------------~~~~~~~~~~~~~n~~~~~~~~~~ 333 (1713)
T PLN02976 293 AEQQASVSSDNKETSST---------------------------------------EVHKANFTMQMNHNGGSLEVNTLE 333 (1713)
T ss_pred ccccccccccccccccc---------------------------------------chhcccceeeeccCCCCccccCCC
Confidence 99998887666554421 11222111111111111 000 00
Q ss_pred CC----CCCCccccCCCCCCCCCCCCCCCCccCcCCCCCccccccchhHHHHHhhhhhhhccCCCcccCCcchhHHhhhc
Q 046008 498 NA----IPSDDEYANGGSPSSVAPDENGSFTEDTLSMPDYENRDTKLSAVQRAVRNAKKRRLGDMAYEGDADWEVLINEQ 573 (1624)
Q Consensus 498 ~s----~~sk~~~~~~~s~~S~~~~~~~~~~~d~~s~s~~~~~~~~~s~~~rk~rk~k~r~~~d~~~e~d~~~e~~~~~~ 573 (1624)
++ .+-.+..-+|.|+.|++|++|..+.+|+.+.+++++..++.++.+|..|++|||+||||+||||+|||+||++|
T Consensus 334 ~~~~~~~~~~~~~~~ga~~~s~~p~~~e~~~~davs~pd~e~~~~~~s~~~R~~r~~kk~~~~d~~~egd~~w~~l~~~~ 413 (1713)
T PLN02976 334 DSPSHDIVGSHPVCNGASPVSITPEENESYVEDAVSLPDSEIKDGKLSKLQRVTRKAKKRKLGDMAYEGDADWETLINEQ 413 (1713)
T ss_pred cCccccccccCccccccCcccCCCccccccccccccCCCchhhcccchhhcccccccccccccccccccCccHHHHhccc
Confidence 00 01122356889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCccccchhhhhccccccCCCCCccccccccccccceeccCcccccCchhhcchhHHHhcCCCccchhhhhhHHHHhh
Q 046008 574 GFLENHQVMDYEQALRTRDKFDSSSTTLTEAENTGAAAVAVGLKARAAGPIERIKFKEILKRRGGLQEYLECRNQILSLW 653 (1624)
Q Consensus 574 ~~~~~~~~~~~d~~~~~r~k~d~~~~~~~~~~~~~~aa~~~~l~~~~~~~~e~~~~~~~~~~~~~~~~~l~~rn~~l~~w 653 (1624)
+||.++++.+.|+++++|+|+|+++ .+++++++++|||++||||+++||+|+|||+|||||+|||||||+|||+||+||
T Consensus 414 ~~~~~~~~~~~d~~~~~~~~~~~~~-~~~~~~~~~~aav~~gl~a~~~~~~e~~~~k~~lkr~~~~q~yl~cr~~~l~~w 492 (1713)
T PLN02976 414 GFLENPSACDSDRSFKTRDKSDSSS-VSKEGENGGAAAVSAGLKARAVGPIEKIKFKEVLKRKGGLQEYLECRNMILGLW 492 (1713)
T ss_pred ccccccccccccccccccccccccc-ccccccCccHhhhhccccccccChHHHHHHHHHHHhccchHHHHHHHHHHHHHh
Confidence 9999999999999999999999999 567899999999999999999999999999999999999999999999999999
Q ss_pred cCCCccCCcccccCCCCCCCCCCCChhhHHHHHHHhhcccCceeeecCCCCcccCCCCcchhhHHhhhhhccccCCcccc
Q 046008 654 SGDVGRILPLTECGVSDTPLGDEPSRASLIREIYKFLDQSGYINVGIASTKEKADHNAKHSYKLLKEERLEKSSGASIAD 733 (1624)
Q Consensus 654 ~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~g~in~g~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 733 (1624)
.||++++||+++|++.++|+.+|+|+++|||+||.||||+||||.||++.|+++++.++|+|+++++++|||++++++||
T Consensus 493 ~k~~~~~l~~~~c~v~~~~~~~e~~~~~l~r~~~~fld~~gyin~g~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 572 (1713)
T PLN02976 493 SKDVSRILPLADCGVTDTPSEDESPRASLIREVYLFLDQRGYINAGIASEKEKAEPSTNHNYKLVEEKTLEESSGASVAD 572 (1713)
T ss_pred hhhhhhcccHhhccccCCcccccCchhhHHHHHHHHhhccCceecccccccccCCCCCCcchhhhhccccccCCcccccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccceeeeecccccccccccccCccccCCCCcccccccCCCCCCCCCchhhhhhhhhhhhccccCCCccccccccccccc
Q 046008 734 SEDGVAFILGQIKSSETTTEAKHGVECNDGNQQIGIKTGGSMTPELPNEIRQKESVVDDCQQRVDSDPKASNRLVGVDVS 813 (1624)
Q Consensus 734 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~~~d~~ 813 (1624)
+||||+||+||++..+++.|+++|+..++.++... ++.+...|.++.+..+++.........|.....|+.
T Consensus 573 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 643 (1713)
T PLN02976 573 SEDGVSFILGQVKSSESSTEGKDCVLVDDENDASG---------DLPNVCECSELLASDIQQCGASNEKLNNGLVSLDAL 643 (1713)
T ss_pred cccchhhhhhcccccccccccccccccccchhhhc---------cccccccHhhhcccchhhcchhhhhhhccccchhhh
Confidence 99999999999999999999999999988876655 456667788888888888777777788888888888
Q ss_pred cCCCCccccccCCC-cC-ChhcccccchhhhhhhhhcCCCCccccCCCCCCcEEEECCCHHHHHHHHHHHHCCCcEEEEc
Q 046008 814 CDDPSCGMVDGGTV-PL-TIEERSESERVQSASCDDAGENHYLRCDIDVKKRIIVIGAGPAGLTAARHLQRQGFSVTVLE 891 (1624)
Q Consensus 814 ~~~~~c~~v~~~r~-~l-~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~IiGaG~aGl~aA~~L~~~g~~v~vlE 891 (1624)
...+.|.+....+. .+ .|+..+.+.-..++.|++++..+..+.+....++|+|||||++||+||++|+++|++|+|||
T Consensus 644 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dV~IIGAG~AGLaAA~~L~~~G~~V~VlE 723 (1713)
T PLN02976 644 SASPSSSVLDSPETLSVIKPELRNELQSVQSNSCIEMGGNHCVLCDSVDRKKIIVVGAGPAGLTAARHLQRQGFSVTVLE 723 (1713)
T ss_pred ccCCccccccCcccccccchhhhcccccchhhhHHhcCCCCCccCCcCCCCcEEEECchHHHHHHHHHHHHCCCcEEEEe
Confidence 77788887777644 34 99999999999999999999888888888888999999999999999999999999999999
Q ss_pred ccccCCCcccccccCCCccccccceeecccccchhhhccCCcHHHHHHHhCCceeeecCCCCeeeccCCcccCcchHHHH
Q 046008 892 ARNRIGGRVYTDRTSLSVPVDLGASIITGVEADVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEAL 971 (1624)
Q Consensus 892 ~~~~~GG~~~s~~~~~g~~~d~Ga~~I~g~~~~v~~~~~~nPl~~LlkeLGLel~~l~~~~~~yd~~~Gk~vp~~l~~~l 971 (1624)
+++++||++++.....|+++|+|++|+++...+....+.++|+..|+.++|+.+..+...++.|+..+|..++......+
T Consensus 724 a~~~vGGri~t~~~~~g~pvDlGas~i~G~~~nv~~~r~~np~~~la~qlGl~l~~~~~~~~~yd~~~G~~V~~e~~~~v 803 (1713)
T PLN02976 724 ARSRIGGRVYTDRSSLSVPVDLGASIITGVEADVATERRPDPSSLICAQLGLELTVLNSDCPLYDVVTGEKVPADLDEAL 803 (1713)
T ss_pred eccCCCCceeeccccCCceeccCcEEEecccccccccccccHHHHHHHhcCCccccccCCCceeEccCCcCCCHHHHHHH
Confidence 99999999999876568999999999999887777777789999999999999887777788898889999999988888
Q ss_pred HHHHHHHHHHHHHHHHHhhhhhhhccHHHHHHHHHHHHHHhhccCCcccccccchhh-Hhhc-ccCCCCCCCCcccchhc
Q 046008 972 EAEFNSLLDDMVLLVAQKGEHAMKMSLEDGLEYALKRRRMARLGRGREDASMHNSMD-VYSK-TSSVDSRVPDKDCSRED 1049 (1624)
Q Consensus 972 ~~~~~slld~l~~~~~~~g~~a~~~sled~Le~~lk~~r~~~~~~~~~~~~~~~a~d-~fs~-~~~i~~~~p~~d~l~e~ 1049 (1624)
...|+.+++.+.....+.+.....+++.++|++.+...........++......+.+ .+.. ...+.....++ .....
T Consensus 804 ~~~fn~lld~~~~~~~~~g~~a~d~SLgd~Le~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~v~G~~~er-~s~~~ 882 (1713)
T PLN02976 804 EAEYNSLLDDMVLLVAQKGEHAMKMSLEDGLEYALKRRRMPRPGVDIDETELGNAADDLYDSASTGVDGGHCEK-ESKED 882 (1713)
T ss_pred HHHHHHHHHHHHHHHhhcccCccCCCHHHHHHHHHhhhhccccccccchhhcccchhhhhhhhhhcccccchhh-hhHHH
Confidence 899999988876655554445557889999987664432211111111111111111 1110 01122222222 34567
Q ss_pred cCCHHHHHHHHHHHHhhhhhcccccccccccccccccccCCCCCccccccchHHHHHHHHhhhccccccceEEEEEecCC
Q 046008 1050 ILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCMIKGGYSTVVEALGKELLIHHNHVVTDISYSFK 1129 (1624)
Q Consensus 1050 ~Lsp~~r~lL~~~~a~ley~~ga~l~~vSl~~~~~~~~y~g~~G~~~~VkGGm~sLveALAe~L~IrLNt~VtrI~~~~~ 1129 (1624)
++++..+++|+|++..++++++..+..+|+.+|.++..|..++|.++++.|||++|+++|++.+.|+||++|++|.+...
T Consensus 883 ~Ls~~er~lL~w~~~~lE~~~aa~L~eVSl~~~~qd~~y~~fgG~~~rIkGGYqqLIeALAe~L~IrLNtpVtrId~s~~ 962 (1713)
T PLN02976 883 VLSPLERRVMNWHFAHLEYGCAALLKEVSLPYWNQDDVYGGFGGAHCMIKGGYSNVVESLAEGLDIHLNHVVTDVSYGSK 962 (1713)
T ss_pred hhCHHHHHHHHHHHHhhcccccCCHHHhhhhhhhcccccccCCCceEEeCCCHHHHHHHHHhhCCeecCCeEEEEEecCC
Confidence 88999999999999999899999999999999998878888889999999999999999999999999999999998411
Q ss_pred CCCCC-CCCCcEEEEeCCCcEEEcCEEEEccChhhhhhhcccCCCCCcHHHHHHHHhcCCccEEEEEEEeCCccccCCCc
Q 046008 1130 DSDLS-DGQSRVKVSTSNGSEFSGDAVLITVPLGCLKAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDDTVD 1208 (1624)
Q Consensus 1130 ~~~~s-~~~~~V~V~TadGeti~AD~VIsAiP~~vLk~~~I~F~P~LP~~k~qAI~~L~yg~l~KV~L~F~~~fW~~~~~ 1208 (1624)
+.+.. ..+++|.|+|.+|++|.||+||+|+|+++|+...|.|.|+||.+++++|++++||.++||+|.|+++||+....
T Consensus 963 d~~~~~s~~dGVtVtTsDGetftADaVIVTVPLGVLKag~I~FsPPLPe~KqaAIqrLgfG~lnKV~LeFdrpFW~~d~d 1042 (1713)
T PLN02976 963 DAGASGSSRKKVKVSTSNGSEFLGDAVLITVPLGCLKAETIKFSPPLPDWKYSSIQRLGFGVLNKVVLEFPEVFWDDSVD 1042 (1713)
T ss_pred cccccccCCCcEEEEECCCCEEEeceEEEeCCHHHhhhcccccCCcccHHHHHHHHhhccccceEEEEEeCCccccCCCC
Confidence 10000 12467999999999999999999999999987779999999999999999999999999999999999998888
Q ss_pred cccccccccCCCCceeEEeccccCCCCcEEEEEEeCccccccCCCCHHHHHHHHHHHHHHHhCCCCCCCCceEEEeecCC
Q 046008 1209 YFGATAKETDLRGRCFMFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAVMVLRQIFGAASVPDPVASVVTDWGR 1288 (1624)
Q Consensus 1209 ~fG~~~~~~~~rg~~~~~~n~~ap~G~~vLvayv~G~~A~~~e~lSdEElie~aL~~L~kIfG~~~vpdPi~ivvtrW~~ 1288 (1624)
+||........++.+|++|+...+.+.++|++|++|..+..+..++++++++.++..|+++||...+|+|..+++++|..
T Consensus 1043 ~FG~s~edtdlrG~~~~~wnlr~psG~pVLVafv~G~aAreiEsLSDEE~Ve~ALe~LrKlFG~~~iPdPv~~vvTrWss 1122 (1713)
T PLN02976 1043 YFGATAEETDLRGQCFMFWNVKKTVGAPVLIALVVGKAAIDGQSMSSSDHVNHALMVLRKLFGEALVPDPVASVVTDWGR 1122 (1713)
T ss_pred ccccccccCCCCceEEEeccCCCCCCCCEEEEEeccHhHHHHhhCCHHHHHHHHHHHHHHHcCcccccCcceeEEecCCC
Confidence 89877655556778889998877778889999999999999999999999999999999999977678999999999999
Q ss_pred CCCCcccccccCCCCCCchhhhhCCccCCeEEEecCCccCCCCCcHHHHHHHHHHHHHHHHHHHccCCCCchhHHHHHHh
Q 046008 1289 DPFSYGAYSYVATGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMLSGLREAVRIIDILTTGNDFTAEVEAMEAA 1368 (1624)
Q Consensus 1289 dp~s~GsYs~~~pG~~~~~~d~L~tPV~grLyFAGEaTs~~~~GtVEGAi~SGiRAA~~IL~~L~~~~~~~~~~~~l~~~ 1368 (1624)
+||++|+|+|++||+.+.+++.+++|++++||||||+|+..|+|||+||+.||+|||.+|+..|+.|.++..++++|+++
T Consensus 1123 DPySrGSYSy~~PGs~~~d~d~LAePVggRLFFAGEATS~~~pGTVHGAIeSG~RAA~eIL~~L~~G~~~~~~~~~~~~~ 1202 (1713)
T PLN02976 1123 DPFSYGAYSYVAIGASGEDYDILGRPVENCLFFAGEATCKEHPDTVGGAMMSGLREAVRIIDILNTGNDYTAEVEALETA 1202 (1713)
T ss_pred CCCcCccccCCCCCCCchHHHHHhCCCCCcEEEEehhhhCCCcchHHHHHHHHHHHHHHHHHHHHccCccccHHHHHHHh
Confidence 99999999999999998899999999998999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCCcchhhhhhhhHhHhhhhhhhhcccchhhhhHhHHHHHHHHHhhccccchhHHHHHHhcCCChhhccccccccc
Q 046008 1369 QMQSESEGDEVRDITRRLEAVELSNVLYKNSLDRALILTRESLLQDMFFNAKTTAGRLHLAKELLNLPVATLKSFAGTRE 1448 (1624)
Q Consensus 1369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~ 1448 (1624)
|+++++||+||+|+++|++++|++++||+++++++++++||+||++||++++||+||||||++|++||+++||+|||+||
T Consensus 1203 ~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~gr~~~~~~~~~~~~~~~~~~a~~~~ 1282 (1713)
T PLN02976 1203 QRHSESERDEVRDITKRLEAVELSNVLYKNSLDADPILTREALLQEMFFSAKTTAGRLHLAKELLNLPVETLKSFAGTKE 1282 (1713)
T ss_pred hhhhhhhHHHHHHHHHhhcccccchhhhhcccccccchhHHHHHHHHHHhhcccccHHHHHHHHHhCCHHHHHHHhcccc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccchhhhhhccCCchhHHHHHHHHhhhhhcchhhHHHhccccccccccccccCchhHHHHHHHHHHHHHHHHHHHhhh
Q 046008 1449 GLTTLNSWILDSMGKDGTQLLRHCVRLLVRVSTDLLAVRLSGIGKTVREKVCVHTSRDIRAIASQLVSVWLEVFRKEKAS 1528 (1624)
Q Consensus 1449 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1528 (1624)
||++||+||||||||||||||||||||||+|+|||+|||+||||||||||||+||+||||+|||||||+|+|+|||+||+
T Consensus 1283 gl~~l~~w~~~~~~~~~~~l~~~~~~ll~~~~~d~~a~r~sg~~~~~k~~~~~h~~~~~r~~a~~~~~~w~~~~~~~~~~ 1362 (1713)
T PLN02976 1283 GLATLNSWILDSMGKDGTQLLRHCVRLLVLVSTDLLAVRLSGIGKTVKEKVCVHTSRDIRAIASQLVSVWLEVFRREKAS 1362 (1713)
T ss_pred hHHHHHHHHHHHhcccHHHHHHHHHHHHhhcchhHHHHHhccchHHHHhhhhhcccHHHHHHHHHHHHHHHHHHHHhhhc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred h-hhhhhccccccccccccc
Q 046008 1529 S-RLKLLKQSTAVDSIKRKS 1547 (1624)
Q Consensus 1529 ~-~~~~~~~~~~~~~~~~~~ 1547 (1624)
| |+||+|++++.+++|+.-
T Consensus 1363 ~~~~~~~~~~~~~~~~~~~~ 1382 (1713)
T PLN02976 1363 NGGLKLLRQATANESSKRRK 1382 (1713)
T ss_pred ccchhhhhhccccccccccc
Confidence 8 999999999999999843
|
|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PF04433 SWIRM: SWIRM domain; InterPro: IPR007526 The SWIRM domain is a small alpha-helical domain of about 85 amino acid residues found in eukaryotic chromosomal proteins | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PF08711 Med26: TFIIS helical bundle-like domain; InterPro: IPR017923 Transcription factor IIS (TFIIS) is a transcription elongation factor that increases the overall transcription rate of RNA polymerase II by reactivating transcription elongation complexes that have arrested transcription | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >cd00183 TFIIS_I N-terminal domain (domain I) of transcription elongation factor S-II (TFIIS); similar to a domain found in elongin A and CRSP70; likely to be involved in transcription; domain I from TFIIS interacts with RNA polymerase II holoenzyme | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >smart00509 TFS2N Domain in the N-terminus of transcription elongation factor S-II (and elsewhere) | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1624 | ||||
| 2xaf_A | 852 | Crystal Structure Of Lsd1-Corest In Complex With Pa | 5e-67 | ||
| 2x0l_A | 734 | Crystal Structure Of A Neuro-Specific Splicing Vari | 1e-66 | ||
| 2v1d_A | 730 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 1e-66 | ||
| 2hko_A | 664 | Crystal Structure Of Lsd1 Length = 664 | 2e-66 | ||
| 2iw5_A | 666 | Structural Basis For Corest-dependent Demethylation | 2e-66 | ||
| 2h94_A | 664 | Crystal Structure And Mechanism Of Human Lysine-Spe | 2e-66 | ||
| 2ejr_A | 662 | Lsd1-Tranylcypromine Complex Length = 662 | 2e-66 | ||
| 2dw4_A | 660 | Crystal Structure Of Human Lsd1 At 2.3 A Resolution | 2e-66 | ||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 2e-61 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 4e-61 | ||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 5e-61 | ||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 1e-15 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 5e-15 | ||
| 3rha_A | 482 | The Crystal Structure Of Oxidoreductase From Arthro | 1e-09 | ||
| 2yg3_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 4e-08 | ||
| 2yg7_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 4e-08 | ||
| 2yg5_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 4e-08 | ||
| 2bxr_A | 527 | Human Monoamine Oxidase A In Complex With Clorgylin | 7e-08 | ||
| 2bxr_A | 527 | Human Monoamine Oxidase A In Complex With Clorgylin | 1e-04 | ||
| 2z5y_A | 513 | Crystal Structure Of Human Monoamine Oxidase A (G11 | 7e-08 | ||
| 2z5y_A | 513 | Crystal Structure Of Human Monoamine Oxidase A (G11 | 2e-04 | ||
| 2z5x_A | 513 | Crystal Structure Of Human Monoamine Oxidase A With | 7e-08 | ||
| 2z5x_A | 513 | Crystal Structure Of Human Monoamine Oxidase A With | 2e-04 | ||
| 2jae_A | 489 | The Structure Of L-Amino Acid Oxidase From Rhodococ | 7e-08 | ||
| 2yg6_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 8e-07 | ||
| 1o5w_A | 534 | The Structure Basis Of Specific Recognitions For Su | 9e-07 | ||
| 1o5w_A | 534 | The Structure Basis Of Specific Recognitions For Su | 8e-05 | ||
| 2vvm_A | 495 | The Structure Of Mao-N-D5, A Variant Of Monoamine O | 7e-06 | ||
| 2vvl_G | 495 | The Structure Of Mao-N-D3, A Variant Of Monoamine O | 7e-06 | ||
| 2vvl_A | 495 | The Structure Of Mao-N-D3, A Variant Of Monoamine O | 7e-06 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 7e-06 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 2e-04 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 8e-06 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 2e-04 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 8e-06 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 2e-04 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 8e-06 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 2e-04 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 8e-06 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 2e-04 | ||
| 2c75_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 8e-06 | ||
| 1gos_A | 520 | Human Monoamine Oxidase B Length = 520 | 9e-06 | ||
| 2xfu_A | 519 | Human Monoamine Oxidase B With Tranylcypromine Leng | 9e-06 | ||
| 2xfo_A | 520 | Tranylcypromine-Inhibited Human Monoamine Oxidase B | 1e-05 | ||
| 2c72_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 1e-05 | ||
| 2bk4_A | 520 | Human Monoamine Oxidase B: I199f Mutant In Complex | 1e-05 | ||
| 2c73_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 1e-05 | ||
| 2c76_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 1e-05 | ||
| 3kve_A | 486 | Structure Of Native L-Amino Acid Oxidase From Viper | 3e-05 | ||
| 3kve_A | 486 | Structure Of Native L-Amino Acid Oxidase From Viper | 4e-05 | ||
| 3zyx_A | 519 | Crystal Structure Of Human Monoamine Oxidase B In C | 3e-05 | ||
| 3zyx_A | 519 | Crystal Structure Of Human Monoamine Oxidase B In C | 5e-05 | ||
| 2e1m_A | 376 | Crystal Structure Of L-Glutamate Oxidase From Strep | 6e-05 | ||
| 4e0v_A | 497 | Structure Of L-Amino Acid Oxidase From The B. Jarar | 7e-05 | ||
| 4e0v_A | 497 | Structure Of L-Amino Acid Oxidase From The B. Jarar | 4e-04 | ||
| 3k7m_X | 431 | Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase F | 7e-05 | ||
| 3k7t_A | 425 | Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine | 7e-05 | ||
| 1f8r_A | 498 | Crystal Structure Of L-Amino Acid Oxidase From Call | 7e-05 | ||
| 1reo_A | 486 | L-Amino Acid Oxidase From Agkistrodon Halys Pallas | 1e-04 | ||
| 1reo_A | 486 | L-Amino Acid Oxidase From Agkistrodon Halys Pallas | 4e-04 | ||
| 1sez_A | 504 | Crystal Structure Of Protoporphyrinogen Ix Oxidase | 5e-04 | ||
| 3k30_A | 690 | Histamine Dehydrogenase From Nocardiodes Simplex Le | 8e-04 |
| >pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 | Back alignment and structure |
|
| >pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 | Back alignment and structure |
| >pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 | Back alignment and structure |
| >pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 | Back alignment and structure |
| >pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 | Back alignment and structure |
| >pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 | Back alignment and structure |
| >pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 | Back alignment and structure |
| >pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 | Back alignment and structure |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|3RHA|A Chain A, The Crystal Structure Of Oxidoreductase From Arthrobacter Aurescens Length = 482 | Back alignment and structure |
| >pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 | Back alignment and structure |
| >pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 | Back alignment and structure |
| >pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 | Back alignment and structure |
| >pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 | Back alignment and structure |
| >pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 | Back alignment and structure |
| >pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 | Back alignment and structure |
| >pdb|2JAE|A Chain A, The Structure Of L-Amino Acid Oxidase From Rhodococcus Opacus In The Unbound State Length = 489 | Back alignment and structure |
| >pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 | Back alignment and structure |
| >pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 | Back alignment and structure |
| >pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 | Back alignment and structure |
| >pdb|2VVM|A Chain A, The Structure Of Mao-N-D5, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 | Back alignment and structure |
| >pdb|2VVL|G Chain G, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger Length = 495 | Back alignment and structure |
| >pdb|2VVL|A Chain A, The Structure Of Mao-N-D3, A Variant Of Monoamine Oxidase From Aspergillus Niger. Length = 495 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 | Back alignment and structure |
| >pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 | Back alignment and structure |
| >pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 | Back alignment and structure |
| >pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 | Back alignment and structure |
| >pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 | Back alignment and structure |
| >pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 | Back alignment and structure |
| >pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 | Back alignment and structure |
| >pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 | Back alignment and structure |
| >pdb|2E1M|A Chain A, Crystal Structure Of L-Glutamate Oxidase From Streptomyces Sp. X-119-6 Length = 376 | Back alignment and structure |
| >pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 | Back alignment and structure |
| >pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 | Back alignment and structure |
| >pdb|3K7M|X Chain X, Crystal Structure Of 6-Hydroxy-L-Nicotine Oxidase From Arthrobacter Nicotinovorans Length = 431 | Back alignment and structure |
| >pdb|3K7T|A Chain A, Crystal Structure Of Apo-Form 6-Hydroxy-L-Nicotine Oxidase, Crystal Form P3121 Length = 425 | Back alignment and structure |
| >pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From Calloselasma Rhodostoma Complexed With Citrate Length = 498 | Back alignment and structure |
| >pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 | Back alignment and structure |
| >pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 | Back alignment and structure |
| >pdb|1SEZ|A Chain A, Crystal Structure Of Protoporphyrinogen Ix Oxidase Length = 504 | Back alignment and structure |
| >pdb|3K30|A Chain A, Histamine Dehydrogenase From Nocardiodes Simplex Length = 690 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Score = 405 bits (1041), Expect = e-127
Identities = 117/509 (22%), Positives = 192/509 (37%), Gaps = 69/509 (13%)
Query: 860 VKKRIIVIGAGPAGLTAARHLQRQGFS-VTVLEARNRIGGRVYTDRTSLSVPVDLGASII 918
V R+IV+GAG +G++AA+ L G + + +LEA + IGGR++ + V+LGA+ +
Sbjct: 3 VGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTN-FAGINVELGANWV 61
Query: 919 TGVEADVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNSL 978
GV L+L SD ++ DE + L
Sbjct: 62 EGVNGGKMNPIWPI------VNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIEL 115
Query: 979 LDDMVLLVAQKGEHAMKMSLEDGLEYALKRRRMARLGRGREDASMHNSMDVYSKTSSVDS 1038
D + + + +D A++R ++
Sbjct: 116 ADSVEEMGEKLSATLHASGRDDMSILAMQR---------------------------LNE 148
Query: 1039 RVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCMI 1098
P+ + V+D++ + E+ + SL + FG +
Sbjct: 149 HQPNGPATPV-------DMVVDYYKFDYEFAEPP--RVTSLQNTVPLATFSDFGDDVYFV 199
Query: 1099 --KGGYSTVVEALGKELL-------------IHHNHVVTDISYSFKDSDLSDGQSRVKVS 1143
+ GY VV L + L + N VV +I YS V V
Sbjct: 200 ADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYS---------PGGVTVK 250
Query: 1144 TSNGSEFSGDAVLITVPLGCLKAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFW 1203
T + S +S D V+++ LG L+++ I F P LP WK AI + V K+ L+F FW
Sbjct: 251 TEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFW 310
Query: 1204 DDTVDYFGATAKETDLRGRCFMFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAV 1263
+ + ++ A VL+ V + + + S +
Sbjct: 311 PEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIM 370
Query: 1264 MVLRQIFGAASVPDPVASVVTDWGRDPFSYGAYSYVATGASGEDYDILGRPVENCLFFAG 1323
VLR++F VPD +V W D F G +S G + +YD L PV ++F G
Sbjct: 371 QVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGR-VYFTG 429
Query: 1324 EATCKEHPDTVGGAMLSGLREAVRIIDIL 1352
E T + + V GA LSG+ A +I+
Sbjct: 430 EHTSEHYNGYVHGAYLSGIDSAEILINCA 458
|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 Length = 104 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
| >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 | Back alignment and structure |
|---|
| >1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Length = 409 | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Length = 408 | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Length = 431 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1624 | |||
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 100.0 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 100.0 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 100.0 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 100.0 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 100.0 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 100.0 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 100.0 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 100.0 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 100.0 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 100.0 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 100.0 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 100.0 | |
| 3ayj_A | 721 | Pro-enzyme of L-phenylalanine oxidase; amino acid | 100.0 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 100.0 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 100.0 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 100.0 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 99.97 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 99.97 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 99.97 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 99.97 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 99.96 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 99.96 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 99.95 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 99.94 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.92 | |
| 1v0j_A | 399 | UDP-galactopyranose mutase; flavoprotein, isomeras | 99.86 | |
| 1i8t_A | 367 | UDP-galactopyranose mutase; rossman fold, FAD, con | 99.79 | |
| 2bi7_A | 384 | UDP-galactopyranose mutase; FAD, flavoprotein, iso | 99.78 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 99.75 | |
| 3hdq_A | 397 | UDP-galactopyranose mutase; substrate and inhibito | 99.73 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.67 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 99.67 | |
| 2e1m_C | 181 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.67 | |
| 2e1m_A | 376 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.62 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 99.47 | |
| 2dce_A | 111 | KIAA1915 protein; swirm domain, structural genomic | 99.43 | |
| 2fq3_A | 104 | Transcription regulatory protein SWI3; four-helix | 99.4 | |
| 1vg0_A | 650 | RAB proteins geranylgeranyltransferase component A | 99.3 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 99.29 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 99.25 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 99.08 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 99.08 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 99.03 | |
| 2e1m_B | 130 | L-glutamate oxidase; L-amino acid oxidase, FAD, L- | 99.01 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.97 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 98.96 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 98.86 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 98.85 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 98.84 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 98.83 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 98.79 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 98.76 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.76 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 98.75 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.72 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.68 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.65 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 98.65 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.63 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 98.61 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 98.6 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 98.6 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 98.58 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 98.57 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 98.56 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 98.54 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 98.53 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 98.52 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.45 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 98.36 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 98.34 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 98.32 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 98.31 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 98.28 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 98.28 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 98.27 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 98.25 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 98.25 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 98.22 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 98.21 | |
| 3fpz_A | 326 | Thiazole biosynthetic enzyme; FAD, mitochondrion, | 98.19 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 98.16 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 98.16 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 98.15 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 98.12 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 98.08 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 97.99 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.97 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 97.95 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 97.92 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 97.91 | |
| 4fk1_A | 304 | Putative thioredoxin reductase; structural genomic | 97.82 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 97.82 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 97.78 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 97.76 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 97.73 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 97.7 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 97.7 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 97.7 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 97.68 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 97.67 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 97.61 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 97.61 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 97.59 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 97.59 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 97.58 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 97.57 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 97.57 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 97.56 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 97.56 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 97.56 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 97.54 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.54 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 97.54 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 97.53 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 97.53 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 97.53 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 97.52 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 97.5 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 97.5 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 97.48 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 97.48 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 97.47 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 97.47 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 97.46 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 97.45 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 97.45 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 97.45 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 97.43 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 97.43 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 97.42 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 97.4 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 97.4 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 97.4 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 97.38 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 97.37 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 97.35 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 97.35 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 97.35 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 97.34 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 97.34 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 97.34 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 97.33 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 97.32 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 97.31 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 97.31 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 97.29 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 97.29 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 97.28 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 97.28 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 97.26 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 97.25 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 97.24 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 97.24 | |
| 1lqt_A | 456 | FPRA; NADP+ derivative, oxidoreductase, structural | 97.21 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 97.21 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 97.18 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 97.18 | |
| 2gag_A | 965 | Heterotetrameric sarcosine oxidase alpha-subunit; | 97.18 | |
| 3g5s_A | 443 | Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy | 97.16 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 97.14 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 97.13 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 97.13 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 97.12 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 97.12 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 97.12 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 97.09 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 97.08 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 97.08 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 97.07 | |
| 3pl8_A | 623 | Pyranose 2-oxidase; substrate complex, H167A mutan | 97.06 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 97.05 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 97.05 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 97.02 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 97.02 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 96.98 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 96.96 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 96.96 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 96.95 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 96.95 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 96.94 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 96.92 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 96.92 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 96.92 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 96.91 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 96.87 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 96.81 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 96.79 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 96.78 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 96.76 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 96.76 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 96.73 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 96.73 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 96.73 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 96.66 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 96.65 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 96.64 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 96.61 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 96.59 | |
| 3gyx_A | 662 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.57 | |
| 1jnr_A | 643 | Adenylylsulfate reductase; oxidoreductase; HET: FA | 96.56 | |
| 3sx6_A | 437 | Sulfide-quinone reductase, putative; sulfide:quino | 96.55 | |
| 1kdg_A | 546 | CDH, cellobiose dehydrogenase; GMC oxidoreductase, | 96.51 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 96.51 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 96.47 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 96.43 | |
| 4g6h_A | 502 | Rotenone-insensitive NADH-ubiquinone oxidoreducta | 96.36 | |
| 3t37_A | 526 | Probable dehydrogenase; BET alpha beta fold, ADP b | 96.12 | |
| 1ju2_A | 536 | HydroxynitrIle lyase; flavin, GMC oxidoreductase, | 95.91 | |
| 3q9t_A | 577 | Choline dehydrogenase and related flavoproteins; g | 95.83 | |
| 1n4w_A | 504 | CHOD, cholesterol oxidase; flavoenzyme, steroid me | 95.78 | |
| 1coy_A | 507 | Cholesterol oxidase; oxidoreductase(oxygen recepto | 95.24 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 95.09 | |
| 3qvp_A | 583 | Glucose oxidase; oxidoreductase; HET: NAG BMA MAN | 95.07 | |
| 3fim_B | 566 | ARYL-alcohol oxidase; AAO, lignin degradation, oxi | 94.94 | |
| 2jbv_A | 546 | Choline oxidase; alcohol oxidation, flavoenyzme ox | 94.76 | |
| 1gpe_A | 587 | Protein (glucose oxidase); oxidoreductase(flavopro | 94.58 | |
| 4gcm_A | 312 | TRXR, thioredoxin reductase; FAD/NAD-linked reduct | 94.56 | |
| 2xpp_A | 145 | IWS1, ECU08_0440; transcription, elongation, histo | 94.24 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 94.19 | |
| 3nfq_A | 170 | Transcription factor IWS1; SPN1, RNA polymerase II | 94.02 | |
| 3klj_A | 385 | NAD(FAD)-dependent dehydrogenase, NIRB-family (N- | 94.01 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 93.93 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 93.72 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 93.47 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 93.45 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 93.33 | |
| 4a5l_A | 314 | Thioredoxin reductase; oxidoreductase, redox metab | 93.25 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 93.19 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 93.19 | |
| 1xhc_A | 367 | NADH oxidase /nitrite reductase; southe collaborat | 93.15 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 93.14 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 92.96 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 92.9 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 92.75 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 92.68 | |
| 1wjt_A | 103 | Transcription elongation factor S-II protein 3; fo | 92.55 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 92.54 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 92.44 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 92.26 | |
| 3cgb_A | 480 | Pyridine nucleotide-disulfide oxidoreductase, CLA; | 92.2 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 92.15 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 91.96 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 91.89 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 91.79 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 91.72 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 91.66 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 91.65 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 91.55 | |
| 3kd9_A | 449 | Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o | 91.37 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 91.26 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 91.22 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 91.08 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 91.05 | |
| 4eqs_A | 437 | Coenzyme A disulfide reductase; oxidoreductase; HE | 91.04 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 91.02 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 90.83 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 90.76 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 90.75 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 90.61 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 90.57 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 90.33 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 90.06 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 90.01 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 90.0 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 89.92 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 89.85 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 89.83 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 89.82 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 89.79 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 89.72 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 89.72 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 89.64 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 89.55 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 89.53 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 89.52 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 89.49 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 89.24 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 89.22 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 89.09 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 89.02 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 88.9 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 88.78 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 88.55 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 88.53 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 88.49 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 88.49 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 88.44 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 88.44 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 88.35 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 88.35 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 88.34 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 88.31 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 88.27 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 88.26 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 88.25 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 88.2 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 88.19 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 88.14 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 88.1 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 87.89 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 87.76 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 87.76 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 87.65 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 87.59 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 87.56 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 87.55 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 87.54 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 87.47 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 87.43 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 87.36 | |
| 2vdc_G | 456 | Glutamate synthase [NADPH] small chain; oxidoreduc | 87.34 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 87.31 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 87.23 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 87.11 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 87.05 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 86.83 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 86.73 | |
| 3dgz_A | 488 | Thioredoxin reductase 2; oxidoreductase, rossmann, | 86.71 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 86.57 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 86.52 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 86.44 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 86.39 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 86.35 | |
| 3qfa_A | 519 | Thioredoxin reductase 1, cytoplasmic; protein-prot | 86.33 | |
| 1pqv_S | 309 | STP-alpha, transcription elongation factor S-II, D | 86.26 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 86.04 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 85.92 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 85.84 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 85.83 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 85.63 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 85.59 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 85.58 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 85.55 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 85.42 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 85.35 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 85.33 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 85.31 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 85.15 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 85.1 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 85.1 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 85.03 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 85.02 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 84.7 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 84.68 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 84.58 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 84.56 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 84.55 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 84.51 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 84.45 | |
| 1cjc_A | 460 | Protein (adrenodoxin reductase); flavoenzyme, MAD | 84.44 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 84.25 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 84.15 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 84.03 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 83.9 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 83.79 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 83.52 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 83.51 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 83.29 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 83.26 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 83.15 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 83.06 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 83.03 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 82.85 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 82.19 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 82.03 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 82.01 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 82.0 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 81.66 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 81.62 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 81.45 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 81.42 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 81.27 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 81.08 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 81.01 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 81.01 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 80.9 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 80.62 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 80.61 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 80.59 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 80.49 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 80.49 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 80.35 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 80.35 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 80.12 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 80.07 |
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-62 Score=625.95 Aligned_cols=571 Identities=39% Similarity=0.646 Sum_probs=439.5
Q ss_pred ccccccceeccCcccccCchhhcchhHHHhcCCCc-cchhhhhhHHHHhhcCCCccCCcccccCCCCCCCCCCCChhhHH
Q 046008 605 ENTGAAAVAVGLKARAAGPIERIKFKEILKRRGGL-QEYLECRNQILSLWSGDVGRILPLTECGVSDTPLGDEPSRASLI 683 (1624)
Q Consensus 605 ~~~~~aa~~~~l~~~~~~~~e~~~~~~~~~~~~~~-~~~l~~rn~~l~~w~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~ 683 (1624)
.++|+||+++||++++|+++|..+|||++++.+.. ..||+|||+||+||.+||...++.+.|.++...+.+ .....|
T Consensus 1 ~~~~~aa~~~~l~~~~l~~~E~~~~~~~~~~~~~~~~~yl~irn~~~~~w~~~~~~~~~~~~~~~~~~r~~~--~~~~~i 78 (662)
T 2z3y_A 1 SGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYN--SDTVLV 78 (662)
T ss_dssp CHHHHHHHHTTCCTTSCCHHHHHHCHHHHTSCHHHHHHHHHHHHHHHHHHHTCTTBCCCHHHHHHHSCTTGG--GCHHHH
T ss_pred ChHHHHHHHcCCCCCCCCHHHHHHhHHHHcCchHHHHHHHHHHHHHHHHHHHCCCcccCHHHHHHhcCCCcc--CChHHH
Confidence 36899999999999999999999999999997655 489999999999999999999999999988876655 344689
Q ss_pred HHHHHhhcccCceeeecCCCCcccCCCCcchhhHHhhhhhccccCCcccccccceeeeecccccccccccccCccccCCC
Q 046008 684 REIYKFLDQSGYINVGIASTKEKADHNAKHSYKLLKEERLEKSSGASIADSEDGVAFILGQIKSSETTTEAKHGVECNDG 763 (1624)
Q Consensus 684 ~~~~~~l~~~g~in~g~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 763 (1624)
+.++.|+.++|+||+|+..+. .
T Consensus 79 ~~~~~~~~~~~~~~~~~~~~~-------------------------------------------------------~--- 100 (662)
T 2z3y_A 79 HRVHSYLERHGLINFGIYKRI-------------------------------------------------------K--- 100 (662)
T ss_dssp HHHHHHHHHTTSSSCSSCBCS-------------------------------------------------------S---
T ss_pred HHHHHHHHHHHHHhcCCcccc-------------------------------------------------------C---
Confidence 999999999999998874211 0
Q ss_pred CcccccccCCCCCCCCCchhhhhhhhhhhhccccCCCccccccccccccccCCCCccccccCCCcCChhcccccchhhhh
Q 046008 764 NQQIGIKTGGSMTPELPNEIRQKESVVDDCQQRVDSDPKASNRLVGVDVSCDDPSCGMVDGGTVPLTIEERSESERVQSA 843 (1624)
Q Consensus 764 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~~~~~~~~~~~d~~~~~~~c~~v~~~r~~l~p~~~~~~~~~~~~ 843 (1624)
|
T Consensus 101 ------------------------------------~------------------------------------------- 101 (662)
T 2z3y_A 101 ------------------------------------P------------------------------------------- 101 (662)
T ss_dssp ------------------------------------C-------------------------------------------
T ss_pred ------------------------------------C-------------------------------------------
Confidence 0
Q ss_pred hhhhcCCCCccccCCCCCCcEEEECCCHHHHHHHHHHHHCCCcEEEEcccccCCCcccccccCCCccccccceeeccccc
Q 046008 844 SCDDAGENHYLRCDIDVKKRIIVIGAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTSLSVPVDLGASIITGVEA 923 (1624)
Q Consensus 844 ~~~~~~~~~~~~~~~~~~~~v~IiGaG~aGl~aA~~L~~~g~~v~vlE~~~~~GG~~~s~~~~~g~~~d~Ga~~I~g~~~ 923 (1624)
.+....++|+|||||++||+||++|+++|++|+|||+++++||+++++.. .++.+|+|++|+++...
T Consensus 102 ------------~~~~~~~~v~viG~G~~gl~~a~~l~~~g~~v~~~e~~~~~gg~~~~~~~-~~~~~~~G~~~~~~~~~ 168 (662)
T 2z3y_A 102 ------------LPTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRK-GNYVADLGAMVVTGLGG 168 (662)
T ss_dssp ------------CCSSCCCEEEEECCBHHHHHHHHHHHHTTCEEEEECSSSSSBTTCCEEEE-TTEEEESSCCEECCSBT
T ss_pred ------------CcccCCCeEEEECcCHHHHHHHHHHHHCCCeEEEEecCCCCCCccccccc-cCchhhcCcEEEeCCCC
Confidence 00123578999999999999999999999999999999999999999886 48899999999987632
Q ss_pred chhhhccCCcHHHHHHHhCCceeeecCCCCeeeccCCcccCcchHHHHHHHHHHHHHHHHHHHHHhhh---hhhhccHHH
Q 046008 924 DVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNSLLDDMVLLVAQKGE---HAMKMSLED 1000 (1624)
Q Consensus 924 ~v~~~~~~nPl~~LlkeLGLel~~l~~~~~~yd~~~Gk~vp~~l~~~l~~~~~slld~l~~~~~~~g~---~a~~~sled 1000 (1624)
+++..+.+++|+++..+...+..|. .+|..++..........+..++..+..+...... .....++.+
T Consensus 169 --------~~~~~l~~~l~~~~~~~~~~~~~~~-~~G~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ 239 (662)
T 2z3y_A 169 --------NPMAVVSKQVNMELAKIKQKCPLYE-ANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQ 239 (662)
T ss_dssp --------CHHHHHHHHHTCCEEECCSCCCEEC-TTSCBCCHHHHHHHHHHHHHHHHHHHHHHTTSCCCEETTEECBHHH
T ss_pred --------chHHHHHHHhCcchhcccccceEEe-CCCcCCCcchhhhhhHHHHHHHHHHHHHHhcccccccCCCCCCHHH
Confidence 5677899999998776655554444 4666666554444444555544444322211000 000111222
Q ss_pred HHHHHH----------------H--------------H----HHHhhccCCccccc-----ccc---------------h
Q 046008 1001 GLEYAL----------------K--------------R----RRMARLGRGREDAS-----MHN---------------S 1026 (1624)
Q Consensus 1001 ~Le~~l----------------k--------------~----~r~~~~~~~~~~~~-----~~~---------------a 1026 (1624)
.++... . . ..+......+..+. ... .
T Consensus 240 ~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~~~s~~~~~~~l~~~ 319 (662)
T 2z3y_A 240 ALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTAL 319 (662)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTCCC--------CCTHHHHHHHHHHHHTTT
T ss_pred HHHHHHHhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhcchhhhHHHHhhhhhhhhhcccccccchhhhhhhhhhhHHHH
Confidence 111100 0 0 00000000000000 000 0
Q ss_pred hhHhhcc-----------cCCCCCCCCcccchhccCCHHHHHHHHHHHHhhhhhcccccccccccccccccccCCCCCcc
Q 046008 1027 MDVYSKT-----------SSVDSRVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAH 1095 (1624)
Q Consensus 1027 ~d~fs~~-----------~~i~~~~p~~d~l~e~~Lsp~~r~lL~~~~a~ley~~ga~l~~vSl~~~~~~~~y~g~~G~~ 1095 (1624)
...|... ..+... .....++++..+.+++|++.+++++++..+..+++..|.++..| .+.|.+
T Consensus 320 ~~~~~~l~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~ls~~~~~~~~~~-~~~g~~ 393 (662)
T 2z3y_A 320 CKEYDELAETQGKLEEKLQELEAN-----PPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDF-EFTGSH 393 (662)
T ss_dssp HHHHHHHTHHHHHHHHHHHHHTTS-----CCCSCSSCHHHHHHHHHHHHHHHHHTTSCGGGBBTTTTTTTGGG-CCBSCC
T ss_pred HhhhhhhhhhhhhHHHHHHHhhcc-----CcccccccHHHHHHHHHHHHHHHHhcCCChhhcCHhhcCCCccc-ccCCce
Confidence 0000000 000000 00112367888899999999999988889999999888766444 356788
Q ss_pred ccccchHHHHHHHHhhhccccccceEEEEEecCCCCCCCCCCCcEEEEeCC------CcEEEcCEEEEccChhhhhh--h
Q 046008 1096 CMIKGGYSTVVEALGKELLIHHNHVVTDISYSFKDSDLSDGQSRVKVSTSN------GSEFSGDAVLITVPLGCLKA--E 1167 (1624)
Q Consensus 1096 ~~VkGGm~sLveALAe~L~IrLNt~VtrI~~~~~~~~~s~~~~~V~V~Tad------Geti~AD~VIsAiP~~vLk~--~ 1167 (1624)
+.++|||++|+++|+++++|++|++|++|.+. +++|.|++.+ |.++.||+||+|+|+++|+. .
T Consensus 394 ~~~~gG~~~l~~~La~~l~I~l~~~V~~I~~~---------~~~v~V~~~~~~~~~~~~~~~Ad~VI~tvP~~vL~~l~~ 464 (662)
T 2z3y_A 394 LTVRNGYSCVPVALAEGLDIKLNTAVRQVRYT---------ASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPP 464 (662)
T ss_dssp EEETTCTTHHHHHHTTTCEEETTEEEEEEEEE---------TTEEEEEEEESSCTTCEEEEEESEEEECCCHHHHHCSSC
T ss_pred eeecCcHHHHHHHHHhcCceecCCeEEEEEEC---------CCcEEEEEeecccCCCCeEEEeCEEEECCCHHHHhcccC
Confidence 99999999999999999999999999999983 5578888766 67899999999999999986 4
Q ss_pred cccCCCCCcHHHHHHHHhcCCccEEEEEEEeCCccccCCCccccccccccCCCCceeEEeccccCCCCcEEEEEEeCccc
Q 046008 1168 SIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDDTVDYFGATAKETDLRGRCFMFWNVRKTVGAPVLIALVVGKAA 1247 (1624)
Q Consensus 1168 ~I~F~P~LP~~k~qAI~~L~yg~l~KV~L~F~~~fW~~~~~~fG~~~~~~~~rg~~~~~~n~~ap~G~~vLvayv~G~~A 1247 (1624)
.|.|.|+||+++.++|++++|++++||+|.|+++||+.+..+||........++.++++|+.. +.++|++|+.|..+
T Consensus 465 ~i~f~P~LP~~k~~Ai~~l~~g~~~KV~l~f~~~fW~~~~~~~G~l~~~~~~~~~~~~~~~~~---~~~vL~~~~~G~~a 541 (662)
T 2z3y_A 465 AVQFVPPLPEWKTSAVQRMGFGNLNKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLY---KAPILLALVAGEAA 541 (662)
T ss_dssp SSEEESCCCHHHHHHHHHSEECCCEEEEEECSSCCSCTTCSEEEECCSSSTTTTEEEEEECCS---SSSEEEEEECTHHH
T ss_pred ceEEcCCCCHHHHHHHHhCCccceeEEEEEcCcccccCCCCceeeecCCCCCCCceeEEEeCC---CCCEEEEEeccHhH
Confidence 578999999999999999999999999999999999987778887654444556677888764 56799999999999
Q ss_pred cccCCCCHHHHHHHHHHHHHHHhCCCCCCCCceEEEeecCCCCCCcccccccCCCCCCchhhhhCCccC-----------
Q 046008 1248 VDGQNVSPSDHVNHAVMVLRQIFGAASVPDPVASVVTDWGRDPFSYGAYSYVATGASGEDYDILGRPVE----------- 1316 (1624)
Q Consensus 1248 ~~~e~lSdEElie~aL~~L~kIfG~~~vpdPi~ivvtrW~~dp~s~GsYs~~~pG~~~~~~d~L~tPV~----------- 1316 (1624)
..+..++++++++.++++|+++||....++|..+.+++|.++||++|+|++++||+...+++.+++|+.
T Consensus 542 ~~~~~lsdee~~~~~l~~L~~~~g~~~~~~p~~~~v~~W~~dp~~~Gsys~~~pg~~~~~~~~l~~p~~~~~~~~~~~~~ 621 (662)
T 2z3y_A 542 GIMENISDDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQPITPGPSIPGAPQP 621 (662)
T ss_dssp HHHTTSCHHHHHHHHHHHHHHHHCTTSSCCCSEEEECCTTTCTTTSSSCEECBTTCCTHHHHHHHCCBCC---------C
T ss_pred HHHHhCCHHHHHHHHHHHHHHHhCCcccCCCceeEEEEECCCCCCCcccccCCCCCchhhHHHHhCcCccccccccccCC
Confidence 999999999999999999999999876789999999999999999999999999998888888888873
Q ss_pred -CeEEEecCCccCCCCCcHHHHHHHHHHHHHHHHHHHcc
Q 046008 1317 -NCLFFAGEATCKEHPDTVGGAMLSGLREAVRIIDILTT 1354 (1624)
Q Consensus 1317 -grLyFAGEaTs~~~~GtVEGAi~SGiRAA~~IL~~L~~ 1354 (1624)
+|||||||||+..|+||||||+.||+|||.+|+..+.+
T Consensus 622 ~grl~FAGe~ts~~~~g~v~GAi~SG~raA~~i~~~~~g 660 (662)
T 2z3y_A 622 IPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLG 660 (662)
T ss_dssp CCCEEECSGGGCTTSTTSHHHHHHHHHHHHHHHHHHHTC
T ss_pred CCcEEEEeccccCCCCcCHHHHHHHHHHHHHHHHHHccC
Confidence 46999999999989999999999999999999999874
|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2dce_A KIAA1915 protein; swirm domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fq3_A Transcription regulatory protein SWI3; four-helix bundle; 1.40A {Saccharomyces cerevisiae} SCOP: a.4.1.18 | Back alignment and structure |
|---|
| >1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} | Back alignment and structure |
|---|
| >1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* | Back alignment and structure |
|---|
| >1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* | Back alignment and structure |
|---|
| >3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* | Back alignment and structure |
|---|
| >3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* | Back alignment and structure |
|---|
| >1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* | Back alignment and structure |
|---|
| >3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} | Back alignment and structure |
|---|
| >2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* | Back alignment and structure |
|---|
| >1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 | Back alignment and structure |
|---|
| >4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2xpp_A IWS1, ECU08_0440; transcription, elongation, histone chaperone, RNA polymerase mRNA export; 1.74A {Encephalitozoon cuniculi} PDB: 2xpo_A 2xpn_A 2xpl_A | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >3nfq_A Transcription factor IWS1; SPN1, RNA polymerase II; 1.85A {Saccharomyces cerevisiae} PDB: 3o8z_A 3oak_A | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1wjt_A Transcription elongation factor S-II protein 3; four-helix bundle, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.48.3.1 | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* | Back alignment and structure |
|---|
| >1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 1624 | ||||
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 1e-51 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 1e-41 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 6e-35 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 1e-05 | |
| d2dw4a3 | 109 | d.16.1.5 (A:655-763) Lysine-specific histone demet | 8e-32 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 3e-28 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 2e-27 | |
| d1b5qa2 | 112 | d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea | 2e-26 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 6e-25 | |
| d2v5za2 | 112 | d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H | 7e-25 | |
| d2iida2 | 113 | d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan | 5e-23 | |
| d2dw4a1 | 102 | a.4.1.18 (A:172-273) Lysine-specific histone demet | 3e-21 | |
| d2bi7a1 | 314 | c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu | 2e-16 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 4e-16 | |
| d2fq3a1 | 85 | a.4.1.18 (A:311-395) Transcription regulatory prot | 5e-16 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 2e-15 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 6e-15 | |
| d2gv8a1 | 335 | c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox | 1e-12 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 4e-12 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 3e-10 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 5e-10 | |
| d1cjca2 | 230 | c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase | 7e-10 | |
| d1gtea4 | 196 | c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de | 1e-09 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 1e-09 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 2e-09 | |
| d1c0pa1 | 268 | c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida | 2e-09 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 2e-09 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 3e-09 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 3e-09 | |
| d1lqta2 | 239 | c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct | 3e-09 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 8e-09 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 1e-08 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 3e-08 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 3e-08 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 4e-08 | |
| d1kifa1 | 246 | c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N | 6e-08 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 7e-08 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 1e-07 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 1e-07 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 2e-07 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 2e-07 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 2e-07 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 3e-07 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 4e-07 | |
| d1vdca1 | 192 | c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase | 6e-07 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 7e-07 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 7e-07 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 8e-07 | |
| d1trba1 | 190 | c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase | 8e-07 | |
| d1fcda1 | 186 | c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf | 8e-07 | |
| d1fl2a1 | 184 | c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide | 1e-06 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 1e-06 | |
| d1xdia1 | 233 | c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd | 2e-06 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 3e-06 | |
| d1d7ya1 | 183 | c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo | 3e-06 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 4e-06 | |
| d1ps9a3 | 179 | c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu | 9e-06 | |
| d1q1ra1 | 185 | c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas | 9e-06 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 1e-05 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 3e-05 | |
| d1xhca1 | 167 | c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite | 3e-05 | |
| d1nhpa1 | 198 | c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter | 3e-05 | |
| d1n4wa1 | 367 | c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of | 4e-05 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 4e-05 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 5e-05 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 8e-05 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 1e-04 | |
| d1aoga1 | 238 | c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas | 2e-04 | |
| d1m6ia1 | 213 | c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f | 3e-04 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 4e-04 | |
| d2cula1 | 230 | c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T | 4e-04 | |
| d1djqa2 | 156 | c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, | 5e-04 | |
| d1kdga1 | 360 | c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain | 5e-04 | |
| d1d7ya2 | 121 | c.3.1.5 (A:116-236) NADH-dependent ferredoxin redu | 8e-04 | |
| d1gpea1 | 391 | c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic | 0.002 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 0.002 | |
| d1e5qa1 | 182 | c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase | 0.002 | |
| d2hmva1 | 134 | c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [T | 0.003 | |
| d1cf3a1 | 385 | c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper | 0.003 | |
| d2jfga1 | 93 | c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D- | 0.003 | |
| d1djqa3 | 233 | c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd | 0.003 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 187 bits (473), Expect = 1e-51
Identities = 107/505 (21%), Positives = 174/505 (34%), Gaps = 79/505 (15%)
Query: 861 KKRIIVIGAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTSLSVPVDLGASIITG 920
++I+IG+G +GL AAR LQ G VT+LEAR+R+GGRV T R + DLGA ++TG
Sbjct: 5 TGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFR-KGNYVADLGAMVVTG 63
Query: 921 VEADVATERRADPSSLVCAQLGLELTVLNSDCPLYDIVSGQKVPANVDEALEAEFNSLLD 980
+ + V Q+ +EL + CPLY+ +GQ VP DE +E EFN LL+
Sbjct: 64 LGGNPMAV--------VSKQVNMELAKIKQKCPLYE-ANGQAVPKEKDEMVEQEFNRLLE 114
Query: 981 DMVLLVAQKGEHAMK---MSLEDGLEYALKRRRMARLGRGREDASMHNSMDVYSKTSSVD 1037
L Q + + +SL LE ++ +
Sbjct: 115 ATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQE--------------------------- 147
Query: 1038 SRVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPFWNQDDVYGGFGGAHCM 1097
K E I + L L +++ +
Sbjct: 148 -----KHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDIT 202
Query: 1098 IKGGYSTVVEALGKELLIHHNHVVTDISYSFKDSDLSDGQSRVKVSTSNGSEFSGDAVLI 1157
+ + L + + +L++ Q +++ V +
Sbjct: 203 AEFLVKSKHRDL--------------TALCKEYDELAETQGKLEEKLQELEANPPSDVYL 248
Query: 1158 TVPLGCLKAESIMFSPPLPQWKYSAIQRLGFGVLNKVVLEFAEVFWDDTVDYFGATAKET 1217
+ + S + + + + + + E
Sbjct: 249 SSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEG 308
Query: 1218 DLRGRCFMFWNVRKTVGAPVLIALVVGKAAVDGQNVSPSDHVNHAVMVLRQIFGAASVPD 1277
VR T +IA+ + + + VL+Q A
Sbjct: 309 LDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPA----V 364
Query: 1278 PVASVVTDWGRDPFSYGAYSYVATGASGEDYDILGRPV------------ENCLFFAGEA 1325
+ +W + G+SG DYD++ +P+ LFFAGE
Sbjct: 365 QFVPPLPEWKTSAVQRMVAA----GSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEH 420
Query: 1326 TCKEHPDTVGGAMLSGLREAVRIID 1350
T + +P TV GA+LSGLREA RI D
Sbjct: 421 TIRNYPATVHGALLSGLREAGRIAD 445
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 85 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 156 | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Length = 134 | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Length = 93 | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1624 | |||
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.95 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.95 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.94 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.93 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 99.87 | |
| d2dw4a1 | 102 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.85 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.82 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.74 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.65 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 99.54 | |
| d2fq3a1 | 85 | Transcription regulatory protein swi3 {Baker's yea | 99.46 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.43 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.42 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 99.37 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.36 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.15 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 99.08 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 99.04 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 98.92 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 98.87 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 98.85 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 98.83 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 98.81 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 98.76 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 98.71 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 98.65 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.51 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.42 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.41 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.28 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.25 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.23 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.19 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.16 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.1 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.07 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.05 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.03 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 97.96 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 97.95 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 97.93 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 97.9 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 97.89 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 97.84 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 97.82 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 97.81 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 97.81 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 97.8 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 97.79 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 97.76 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.75 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 97.74 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 97.73 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 97.72 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 97.72 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 97.66 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 97.66 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 97.62 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 97.57 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.55 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 97.5 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 97.46 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.44 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 97.43 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 97.43 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 97.38 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 97.33 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 97.32 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 97.26 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 97.25 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 97.24 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 97.21 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.2 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 97.15 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 97.14 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 97.08 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 97.06 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 97.06 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 96.93 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 96.9 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 96.9 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 96.89 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 96.74 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.68 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 96.66 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 96.64 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 96.59 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 96.47 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 96.39 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.38 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.22 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.13 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.08 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 96.08 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 96.04 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.03 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 95.93 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 95.77 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 95.41 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 95.14 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 95.0 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 94.7 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 94.69 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 94.08 | |
| d1wjta_ | 103 | Transcription elongation factor S-II protein 3 {Mo | 94.02 | |
| d1eo0a_ | 77 | Transcription elongation factor TFIIS N-domain {Ba | 93.95 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 93.76 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 93.48 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 93.39 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 93.37 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 93.27 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 93.09 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 92.98 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 92.49 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.29 | |
| d1wjta_ | 103 | Transcription elongation factor S-II protein 3 {Mo | 92.1 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 91.89 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 91.7 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 91.66 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 91.63 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.33 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 90.93 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 90.77 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 90.69 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 90.09 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 89.79 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 89.74 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 88.86 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 88.74 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 88.62 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 88.32 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 87.92 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 87.83 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 87.77 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 87.75 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 87.64 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 87.54 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 87.38 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 87.26 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 87.14 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 86.46 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 86.36 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 86.33 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 86.03 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 86.0 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 85.97 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 85.82 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 85.81 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 85.45 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 85.42 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 84.86 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 84.31 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 83.81 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 83.55 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 82.93 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 82.78 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 82.51 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 82.21 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 82.16 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 81.83 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 81.68 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 81.19 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 81.19 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 81.12 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 80.96 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 80.37 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 80.37 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 80.36 |
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Monoamine oxidase B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=5.3e-27 Score=267.09 Aligned_cols=263 Identities=24% Similarity=0.269 Sum_probs=156.0
Q ss_pred cEEEECCCHHHHHHHHHHHHCCCcEEEEcccccCCCcccccccCCCccccccceeecccccchhhhccCCcHHHHHHHhC
Q 046008 863 RIIVIGAGPAGLTAARHLQRQGFSVTVLEARNRIGGRVYTDRTSLSVPVDLGASIITGVEADVATERRADPSSLVCAQLG 942 (1624)
Q Consensus 863 ~v~IiGaG~aGl~aA~~L~~~g~~v~vlE~~~~~GG~~~s~~~~~g~~~d~Ga~~I~g~~~~v~~~~~~nPl~~LlkeLG 942 (1624)
||||||||++||+||++|+++|++|+|||+++++||+++|.....|+.+|+|++|+...+. ++..+++++|
T Consensus 1 DViVIGaG~aGL~aA~~L~~~G~~V~VlE~~~~~GGr~~t~~~~~g~~~d~G~~~~~~~~~---------~~~~l~~~lg 71 (383)
T d2v5za1 1 DVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQN---------RILRLAKELG 71 (383)
T ss_dssp SEEEECCBHHHHHHHHHHHHTTCCEEEEESSSSSBTTCCEECCTTTSCEESSCCEECTTCH---------HHHHHHHHTT
T ss_pred CEEEECCCHHHHHHHHHHHhCCCCEEEEecCCCCcceeeEEECCCCcEEeCCceEeCCCCh---------HHHHHHHHcC
Confidence 6999999999999999999999999999999999999999886678999999999986543 3456899999
Q ss_pred CceeeecCCCCeeeccCCcc------cCcchHHHHHHHHHHHHHHHHHHHHHhhhh--hhhccHHHHHHHHHHHHHHhhc
Q 046008 943 LELTVLNSDCPLYDIVSGQK------VPANVDEALEAEFNSLLDDMVLLVAQKGEH--AMKMSLEDGLEYALKRRRMARL 1014 (1624)
Q Consensus 943 Lel~~l~~~~~~yd~~~Gk~------vp~~l~~~l~~~~~slld~l~~~~~~~g~~--a~~~sled~Le~~lk~~r~~~~ 1014 (1624)
++..........+....... .+.............+...+.......... ........+.
T Consensus 72 l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------ 139 (383)
T d2v5za1 72 LETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWRTMDDMGREIPSDAPWKAPLAEEWD------------ 139 (383)
T ss_dssp CCEEECCCSSEEEEEETTEEEEECSSSCCCCSHHHHHHHHHHHHHHHHHHTTSCTTCGGGSTTHHHHH------------
T ss_pred CcceeccCccceEEecCcccccccccccchhhhhhhhhHHHHHHHHHHhhhhcccccccchhhhhhhh------------
Confidence 98776554433332222211 111111111111111111111000000000 0000000000
Q ss_pred cCCcccccccchhhHhhcccCCCCCCCCcccchhccCCHHHHHHHHHHHHhhhhhcccccccccccc---------cccc
Q 046008 1015 GRGREDASMHNSMDVYSKTSSVDSRVPDKDCSREDILSPVERRVMDWHFANLEYGCAALLKEVSLPF---------WNQD 1085 (1624)
Q Consensus 1015 ~~~~~~~~~~~a~d~fs~~~~i~~~~p~~d~l~e~~Lsp~~r~lL~~~~a~ley~~ga~l~~vSl~~---------~~~~ 1085 (1624)
.....+ ++......+....++........ +..+...++.. ....
T Consensus 140 --------~~~~~~----------------~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~ 192 (383)
T d2v5za1 140 --------NMTMKE----------------LLDKLCWTESAKQLATLFVNLCV---TAETHEVSALWFLWYVKQCGGTTR 192 (383)
T ss_dssp --------TSBHHH----------------HHHHHCSSHHHHHHHHHHHHHHH---SSCTTTSBHHHHHHHHHTTTCHHH
T ss_pred --------hhHHHH----------------HHHHhccchHHHHHHHHhhhhhh---ccccchhhHHHHHHHHHhhccccc
Confidence 000000 11111122222222222111110 01111111100 0000
Q ss_pred cccCCCCCccccccchHHHHHHHHhhhc--cccccceEEEEEecCCCCCCCCCCCcEEEEeCCCcEEEcCEEEEccChhh
Q 046008 1086 DVYGGFGGAHCMIKGGYSTVVEALGKEL--LIHHNHVVTDISYSFKDSDLSDGQSRVKVSTSNGSEFSGDAVLITVPLGC 1163 (1624)
Q Consensus 1086 ~~y~g~~G~~~~VkGGm~sLveALAe~L--~IrLNt~VtrI~~~~~~~~~s~~~~~V~V~TadGeti~AD~VIsAiP~~v 1163 (1624)
.......+..+.+.+|++.++++|++.. +|++|++|++|.. ++++|.|++.+|+++.||+||+|+|+.+
T Consensus 193 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~g~~i~~~~~v~~I~~---------~~~~v~v~~~~g~~~~ad~vI~a~p~~~ 263 (383)
T d2v5za1 193 IISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ---------TRENVLVETLNHEMYEAKYVISAIPPTL 263 (383)
T ss_dssp HHCSTTSTTSEEETTCTHHHHHHHHHHHGGGEEESCCEEEEEC---------SSSSEEEEETTSCEEEESEEEECSCGGG
T ss_pred ccccccCcceeeeccchhHHHHHHHHHcCCeEEecCcceEEEe---------cCCeEEEEECCCCEEECCEEEECCCHHH
Confidence 0111123455678999999999998855 8999999999988 5678999999999999999999999998
Q ss_pred hhhhcccCCCCCcHHHHHHHH
Q 046008 1164 LKAESIMFSPPLPQWKYSAIQ 1184 (1624)
Q Consensus 1164 Lk~~~I~F~P~LP~~k~qAI~ 1184 (1624)
+. .+.|.|+||.++.+++.
T Consensus 264 ~~--~~~~~p~l~~~~~~~~~ 282 (383)
T d2v5za1 264 GM--KIHFNPPLPMMRNQMIT 282 (383)
T ss_dssp GG--GSEEESCCCHHHHHHTT
T ss_pred Hh--hCccCCCCCHHHHHHHH
Confidence 86 47789999988777653
|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1wjta_ a.48.3.1 (A:) Transcription elongation factor S-II protein 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eo0a_ a.48.3.1 (A:) Transcription elongation factor TFIIS N-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1wjta_ a.48.3.1 (A:) Transcription elongation factor S-II protein 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|