Citrus Sinensis ID: 046116
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 604 | ||||||
| 225438918 | 636 | PREDICTED: uncharacterized protein LOC10 | 0.907 | 0.861 | 0.686 | 0.0 | |
| 255567973 | 632 | heat shock protein 70 (HSP70)-interactin | 0.945 | 0.903 | 0.632 | 0.0 | |
| 224074227 | 607 | predicted protein [Populus trichocarpa] | 0.938 | 0.934 | 0.657 | 0.0 | |
| 225458780 | 645 | PREDICTED: uncharacterized protein LOC10 | 0.892 | 0.835 | 0.638 | 0.0 | |
| 147838438 | 1000 | hypothetical protein VITISV_028488 [Viti | 0.892 | 0.539 | 0.638 | 0.0 | |
| 356540650 | 606 | PREDICTED: uncharacterized protein LOC10 | 0.899 | 0.896 | 0.643 | 0.0 | |
| 296087357 | 565 | unnamed protein product [Vitis vinifera] | 0.807 | 0.863 | 0.621 | 0.0 | |
| 302142229 | 622 | unnamed protein product [Vitis vinifera] | 0.854 | 0.829 | 0.606 | 0.0 | |
| 255538118 | 574 | heat shock protein 70 (HSP70)-interactin | 0.867 | 0.912 | 0.644 | 0.0 | |
| 449448474 | 587 | PREDICTED: uncharacterized protein LOC10 | 0.869 | 0.894 | 0.604 | 0.0 |
| >gi|225438918|ref|XP_002279273.1| PREDICTED: uncharacterized protein LOC100242317 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 808 bits (2086), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 389/567 (68%), Positives = 461/567 (81%), Gaps = 19/567 (3%)
Query: 1 MELHRQRNTTSCSRMPQKVTCTKPYCFFCSMNEQPPSLRRAKVAQCFKELPLSRLRDDQE 60
ME Q+NTT KV CT P CFFC+MNE PSLRRA +A+CFKE+PL RDDQE
Sbjct: 1 MESQHQKNTT---HKNVKVLCTNPCCFFCAMNEADPSLRRAGIAKCFKEMPL---RDDQE 54
Query: 61 HVLVLSGLFNIAIKQPDDPEFPSLGIFECMTKLIHKGITDKEWLLRDQNIYIPYYAAHII 120
HVL LSGL+NIA+ QPDDPEFP LGIFEC LI +GI+DKEWLLRDQNIYIPYYAAHII
Sbjct: 55 HVLALSGLWNIAMTQPDDPEFPLLGIFECAANLIRRGISDKEWLLRDQNIYIPYYAAHII 114
Query: 121 GSYTMNKAHFAEKAVKSGVVLPLMELLRGKISWVEERVAVRALGHLASHDKTFEAVALYE 180
GSYTMNK FAE+AVKSGV+ LMELLRGK+SWVE+RVAVRALGHLASH++TFEA+A++E
Sbjct: 115 GSYTMNKVQFAERAVKSGVISSLMELLRGKMSWVEKRVAVRALGHLASHERTFEAIAVHE 174
Query: 181 VEIIELAKNIACNCFEVVYEKFVGLKEKKRVKYHCDLLTRGLGGFELENRKAEEWASQLQ 240
EII + A C + VY +FVG++ +R+KYHCDLLTRG GG E+ENRKAEEWASQLQ
Sbjct: 175 AEIIHESMETASTCLDEVYVEFVGVEHTRRLKYHCDLLTRGTGGLEIENRKAEEWASQLQ 234
Query: 241 CWSLYLLNCFACRERSSFDLICSQDFLKIVCGMWGGLANHTSPAGIGLIR---------- 290
CWSLYLLNCFAC+ERS + IC+++FLK +CGMWGGLAN +SPAGIGLIR
Sbjct: 235 CWSLYLLNCFACKERS-LNRICNKEFLKKLCGMWGGLANGSSPAGIGLIRNLCYTKTGRR 293
Query: 291 --AFLKNVIESVCNVSRSSDDWQYAAIDSLLLLLKDPDTRYEVIDIAALFLVDLVELKSL 348
A K VIES+CN SRSSD+WQY AID LLL+LKDPDTRY+V++ A LFLVDLVEL+SL
Sbjct: 294 SVADSKEVIESLCNTSRSSDEWQYMAIDCLLLILKDPDTRYKVLNTAVLFLVDLVELRSL 353
Query: 349 NGRERVGEAITQTLLQDYHKVKYGNLKLKSKKAGRALDEIWDLKVQKRKKEKLMSDEEMK 408
GR +VGEAITQTLLQDY+++KYGNL LKSK+A R L+EIWDLKV+++K+E +M++EE +
Sbjct: 354 RGRTKVGEAITQTLLQDYNQLKYGNLDLKSKRAERTLEEIWDLKVERKKRENIMTEEEAR 413
Query: 409 ENELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYLMLKK 468
E L ++KQ+GNQ FW+G IE AV KY++AL+LCPLKMRKER+VL+SNRAQC+L+L+
Sbjct: 414 ERRLLAGVMKQEGNQLFWSGDIEAAVLKYTEALELCPLKMRKERVVLHSNRAQCHLLLRD 473
Query: 469 PEAAISDTTRALSLSKTMSSHSKSLWRRSQAYDMMGLAKESLMDALTFIGSRMKCKHTNR 528
E+AISD+TRAL+LS +S HSKSLWRRSQAYDM GLAKESLMD L FI R+K TN
Sbjct: 474 TESAISDSTRALNLSSVLSPHSKSLWRRSQAYDMKGLAKESLMDCLMFINDRIKSLDTNG 533
Query: 529 VKIPYYAAVMINKQMNATWPFIHAKSK 555
VKIPYYAA MI KQMN TW F A+SK
Sbjct: 534 VKIPYYAARMITKQMNTTWIFATARSK 560
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255567973|ref|XP_002524964.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223535799|gb|EEF37461.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224074227|ref|XP_002304309.1| predicted protein [Populus trichocarpa] gi|222841741|gb|EEE79288.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225458780|ref|XP_002283265.1| PREDICTED: uncharacterized protein LOC100267728 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147838438|emb|CAN63254.1| hypothetical protein VITISV_028488 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356540650|ref|XP_003538799.1| PREDICTED: uncharacterized protein LOC100803448 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296087357|emb|CBI33731.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302142229|emb|CBI19432.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255538118|ref|XP_002510124.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223550825|gb|EEF52311.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449448474|ref|XP_004141991.1| PREDICTED: uncharacterized protein LOC101214245 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 604 | ||||||
| TAIR|locus:2167796 | 588 | AT5G43120 [Arabidopsis thalian | 0.917 | 0.942 | 0.512 | 5.4e-150 | |
| TAIR|locus:2083068 | 501 | AT3G50030 [Arabidopsis thalian | 0.483 | 0.582 | 0.588 | 1.4e-142 | |
| TAIR|locus:2184073 | 631 | AT5G10200 [Arabidopsis thalian | 0.854 | 0.817 | 0.489 | 3.9e-131 | |
| UNIPROTKB|Q99614 | 292 | TTC1 "Tetratricopeptide repeat | 0.183 | 0.380 | 0.359 | 5.9e-10 | |
| UNIPROTKB|Q3ZBR5 | 292 | TTC1 "Tetratricopeptide repeat | 0.183 | 0.380 | 0.359 | 3.9e-09 | |
| UNIPROTKB|F1RR38 | 292 | TTC1 "Uncharacterized protein" | 0.183 | 0.380 | 0.350 | 5e-09 | |
| MGI|MGI:1914077 | 292 | Ttc1 "tetratricopeptide repeat | 0.210 | 0.434 | 0.325 | 8.6e-09 | |
| RGD|1359604 | 292 | Ttc1 "tetratricopeptide repeat | 0.210 | 0.434 | 0.318 | 1.1e-08 | |
| UNIPROTKB|E1BWM0 | 296 | TTC1 "Uncharacterized protein" | 0.134 | 0.273 | 0.407 | 2e-08 | |
| ZFIN|ZDB-GENE-041114-80 | 330 | ttc1 "tetratricopeptide repeat | 0.197 | 0.360 | 0.327 | 3.6e-08 |
| TAIR|locus:2167796 AT5G43120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1464 (520.4 bits), Expect = 5.4e-150, P = 5.4e-150
Identities = 298/581 (51%), Positives = 401/581 (69%)
Query: 1 MELHRQRNTTSCSRMPQKVTCTKPYCFFCSMNEQPPSLRRAKVAQCFKELPLSRLRDDQE 60
M+ RNT R V ++P CF C+M E+ P +R+A + +++ + +RDD E
Sbjct: 1 MDHFSYRNTNKMVRT-HVVVGSRPCCFSCAMEEKDPCVRKAWLELSLRDMHM--IRDDTE 57
Query: 61 HVLVLSGLFNIAIKQPDDPEFPSLGIFECMTKLIHKGITDKEWLLRDQNIYIPYYAAHII 120
L LS ++ A+ P++PE PSLG+FECMT+L+ KG+ D EW++ QN+Y+PYYAAHII
Sbjct: 58 LALTLSFIWRYAMADPENPELPSLGVFECMTRLMKKGLEDVEWVMTGQNVYVPYYAAHII 117
Query: 121 GSYTMNKAHFAEKAVKSGVVLPLMELLRGKISWVEERVAVRALGHLASHDKTFEAVALYE 180
GSYTM K FA KAV+SGV+ PL+EL+R K+SWVE+RV VRALGHLAS++ TFEAVA YE
Sbjct: 118 GSYTMKKPDFATKAVESGVIAPLLELMRRKMSWVEQRVVVRALGHLASYETTFEAVAAYE 177
Query: 181 VEIIELAKNIACNCFEVVYEKFVGLKEKK-RVKYHCDLLTRGLGGFELENRKAEEWASQL 239
E++ LA IA C +VVYE+FV ++EK+ RV+YH DLLTRGLGG E+E+RKAEEWASQL
Sbjct: 178 DEVVRLAMEIAMTCVDVVYEEFVSVQEKEGRVRYHSDLLTRGLGGLEMEDRKAEEWASQL 237
Query: 240 QCWSLYLLNCFACRERSSFDLICSQDFLKIVCGMWGGLANHTSPAGIGLIRAFL------ 293
QCWSL+LLNCFA +++ LIC++ FLK + MWGGL NHTSP+GIGLIR
Sbjct: 238 QCWSLHLLNCFAYKQKC-ISLICNKTFLKELSQMWGGLVNHTSPSGIGLIRILCYSKQGR 296
Query: 294 ------KNVIESVCNVSRSSDDWQYAAIDSLLLLLKDPDTRYEVIDIAALFLVDLVELKS 347
+ +I S+CN+SRSSDDWQY ID LLLLLKD TRY V++++ +LVDLVE+K+
Sbjct: 297 RHVSGSREMILSLCNLSRSSDDWQYMGIDCLLLLLKDQATRYNVLEMSLFYLVDLVEVKA 356
Query: 348 LNGRERVGEAITQTLLQDYHKVKYGNLKLKSKKAGRALDEIWDLKVQKRKKE-KLMSDEE 406
LN R+ +G+ IT+ LL Y K K G S KA +AL E+W KV++R++E K MS +
Sbjct: 357 LNVRKNLGDRITKVLLMHYCKTKKGCAY--SHKAQKALKELWRNKVERRRRERKFMSKNQ 414
Query: 407 --MKENELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYL 464
++E + V+++KQQ NQ G IE A+K Y++A+ LCPLK+R++R+ LYS R +CYL
Sbjct: 415 DFLRETSVVVYLIKQQANQLLHVGDIEGAIKCYTEAIGLCPLKLRRKRMNLYSERGECYL 474
Query: 465 MLKKPEAAISDTTRAXXXXXXXXXXXXXXWRRSQAYDMMGLAKESLMDALTFIGSRMKCK 524
+L +AAISD TRA W RS+AYD+ GL++ESLMD + F+ R C
Sbjct: 475 LLGDVDAAISDCTRALCLSEPVNSHGKSLWTRSRAYDIKGLSRESLMDCIMFVNGR--CF 532
Query: 525 HTNRVKIPYYAAVMINKQMNATWPFIHAKSKMCKPSIIEEK 565
N IPYYAA MI+KQM ATW F A++ +++EK
Sbjct: 533 RGN---IPYYAAQMISKQMEATWLFEKARASKLGRMMLKEK 570
|
|
| TAIR|locus:2083068 AT3G50030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2184073 AT5G10200 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q99614 TTC1 "Tetratricopeptide repeat protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBR5 TTC1 "Tetratricopeptide repeat protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RR38 TTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914077 Ttc1 "tetratricopeptide repeat domain 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359604 Ttc1 "tetratricopeptide repeat domain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWM0 TTC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041114-80 ttc1 "tetratricopeptide repeat domain 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00019622001 | SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (620 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 604 | |||
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 4e-11 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 2e-10 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 6e-10 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 5e-04 |
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
Score = 65.8 bits (160), Expect = 4e-11
Identities = 43/119 (36%), Positives = 63/119 (52%), Gaps = 14/119 (11%)
Query: 402 MSDEEMKENELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQ 461
+S+EE K+ LK++GN+ + +A+K YSKA++ K V YSNRA
Sbjct: 118 LSEEERKKYAAK---LKEKGNKAYRNKDFNKAIKLYSKAIEC------KPDPVYYSNRAA 168
Query: 462 CYLMLKKPEAAISDTTRALSLSKTMSSHSKSLWRRSQAYDMMGLAKESLMD--ALTFIG 518
C+ L E + DTT AL L +SK+L RR+ AYD +G ++L+D A I
Sbjct: 169 CHNALGDWEKVVEDTTAALELD---PDYSKALNRRANAYDGLGKYADALLDLTASCIID 224
|
[Transport and binding proteins, Amino acids, peptides and amines]. Length = 615 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 604 | |||
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.78 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.78 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.76 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.67 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.66 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.66 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.6 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.56 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.5 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 99.49 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.45 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.45 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.36 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.36 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 99.35 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.29 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.28 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 99.22 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.22 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.22 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.2 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.17 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.12 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.06 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.06 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.03 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 99.0 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.98 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.97 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.97 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.93 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.91 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.91 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.88 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.88 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.87 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.84 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.8 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.8 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.79 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.77 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.77 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.74 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.72 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.72 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.72 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.71 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.71 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.69 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.69 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.64 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.63 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.63 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.63 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.62 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.61 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.58 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.57 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.57 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.56 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.56 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.54 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.53 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.53 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.52 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.51 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.5 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.49 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.49 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.47 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.47 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.46 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.46 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.45 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.45 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.42 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.42 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.42 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.41 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.37 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.37 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.36 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.3 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.28 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.27 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.25 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.23 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 98.19 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.19 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.19 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.18 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.16 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.15 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.14 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.13 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.12 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.11 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.08 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.07 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.07 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.05 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.05 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.04 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.01 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.0 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.99 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 97.99 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.98 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.98 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.96 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 97.95 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.93 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.88 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.88 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 97.86 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.8 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.8 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.79 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.75 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.73 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.71 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.71 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 97.7 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 97.7 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 97.69 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.68 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.63 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.62 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.62 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.61 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.6 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.59 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 97.56 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.56 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.54 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.54 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.49 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.48 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 97.47 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.43 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.43 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.41 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.41 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.4 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.34 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.34 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.27 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 97.27 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 97.25 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.24 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.23 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.22 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.21 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 97.21 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.2 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.2 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.17 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.17 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.17 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.16 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.12 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.11 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.08 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.06 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.06 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.06 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.02 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.99 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.88 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.81 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 96.81 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.7 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 96.69 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 96.67 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.66 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 96.65 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 96.65 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.65 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 96.64 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 96.58 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 96.51 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 96.49 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.35 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 96.32 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.32 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 96.25 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.25 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 96.24 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 96.2 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 96.17 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 96.16 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.08 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 95.99 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 95.85 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 95.61 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.58 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.57 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 95.56 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 95.54 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 95.47 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 95.39 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 95.36 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 95.27 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 95.27 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 95.19 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 95.17 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 95.09 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 94.98 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 94.86 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 94.85 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 94.79 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 94.77 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 94.75 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 94.74 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 94.73 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 94.72 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 94.7 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 94.7 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.61 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 94.55 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 94.55 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 94.55 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 94.42 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 94.26 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 94.23 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 94.18 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 94.1 | |
| PF00514 | 41 | Arm: Armadillo/beta-catenin-like repeat; InterPro: | 94.08 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 93.94 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 93.9 | |
| cd00020 | 120 | ARM Armadillo/beta-catenin-like repeats. An approx | 93.69 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 93.4 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 93.33 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 93.17 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 93.11 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 93.08 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 93.05 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 92.78 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 92.78 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 92.56 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 92.54 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 92.44 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 91.79 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 91.63 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 91.51 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 91.48 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 91.44 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 91.28 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 91.08 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 91.02 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 90.8 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 90.74 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 90.45 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 90.39 | |
| smart00185 | 41 | ARM Armadillo/beta-catenin-like repeats. Approx. 4 | 90.05 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 89.71 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 89.68 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 89.39 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 89.37 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 89.12 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 89.03 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 88.82 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 88.75 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 88.32 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 87.8 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 87.45 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 87.38 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 87.18 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 86.85 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 86.37 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 85.32 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 84.9 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 84.83 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 84.68 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 83.49 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 83.35 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 82.39 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 82.37 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 82.3 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 81.52 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 81.4 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 81.32 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 80.63 |
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.78 E-value=9.8e-19 Score=179.76 Aligned_cols=124 Identities=27% Similarity=0.297 Sum_probs=113.2
Q ss_pred HhHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCcccchHHHHHHHHHHHHHcCCcHHHHHHHHHHHhcCCCCCC
Q 046116 409 ENELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYLMLKKPEAAISDTTRALSLSKTMSS 488 (604)
Q Consensus 409 e~~~~A~~lk~~GN~lfk~GdyeeAIe~YtkALel~P~~~~~~~a~l~~NRA~~ylkLgdy~eAI~D~~rALeLdPd~~~ 488 (604)
+....++.+|.+||.+++.++|++|+.+|++||+++|. ++++|+|||++|.+||.|+.|++||..||++||.
T Consensus 76 e~~~~AE~LK~eGN~~m~~~~Y~eAv~kY~~AI~l~P~-----nAVyycNRAAAy~~Lg~~~~AVkDce~Al~iDp~--- 147 (304)
T KOG0553|consen 76 EDKALAESLKNEGNKLMKNKDYQEAVDKYTEAIELDPT-----NAVYYCNRAAAYSKLGEYEDAVKDCESALSIDPH--- 147 (304)
T ss_pred hHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHhcCCC-----cchHHHHHHHHHHHhcchHHHHHHHHHHHhcChH---
Confidence 57778999999999999999999999999999999999 9999999999999999999999999999999999
Q ss_pred CHHHHHHHHHHHHHcCCHHHHHHHHHHHHhchhhcCCCCCCCHHHHHHHHHHHHHhc
Q 046116 489 HSKSLWRRSQAYDMMGLAKESLMDALTFIGSRMKCKHTNRVKIPYYAAVMINKQMNA 545 (604)
Q Consensus 489 n~KA~~rrG~a~~~LGd~dEAL~d~~kALkl~~~~~d~~~~~i~~~l~rlikKqk~~ 545 (604)
+.|+|-|+|.+|+.+|++++|+..|+++|++ +|.+......+...-++..+.
T Consensus 148 yskay~RLG~A~~~~gk~~~A~~aykKaLel-----dP~Ne~~K~nL~~Ae~~l~e~ 199 (304)
T KOG0553|consen 148 YSKAYGRLGLAYLALGKYEEAIEAYKKALEL-----DPDNESYKSNLKIAEQKLNEP 199 (304)
T ss_pred HHHHHHHHHHHHHccCcHHHHHHHHHhhhcc-----CCCcHHHHHHHHHHHHHhcCC
Confidence 9999999999999999999999999999999 455556666666655555444
|
|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd00020 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00185 ARM Armadillo/beta-catenin-like repeats | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 604 | ||||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 4e-05 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 6e-05 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 2e-04 |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
|
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 604 | |||
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 3e-24 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 8e-22 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 6e-21 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 2e-20 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 3e-20 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 4e-20 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 8e-20 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 1e-19 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 2e-19 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 2e-19 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 4e-19 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 7e-19 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 9e-19 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 1e-17 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 4e-17 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 8e-16 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 3e-04 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 2e-15 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 1e-14 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 2e-14 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 2e-14 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-13 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 4e-08 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 3e-04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 8e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-11 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 9e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 1e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-04 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-11 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 9e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-11 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 4e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-04 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 5e-09 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-07 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 2e-06 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 3e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 8e-06 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 4e-05 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 1e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-05 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 5e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 3e-05 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 5e-04 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 8e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 6e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 5e-04 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 8e-05 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 9e-05 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 1e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 7e-04 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 2e-04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 2e-04 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 4e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 5e-04 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 7e-04 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 9e-04 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 9e-04 |
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
Score = 98.2 bits (245), Expect = 3e-24
Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 5/110 (4%)
Query: 403 SDEEMKENELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQC 462
SV L+++GN+ F G A+ Y++AL L +++ VL+ NRA C
Sbjct: 17 EPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATP--QDQAVLHRNRAAC 74
Query: 463 YLMLKKPEAAISDTTRALSLSKTMSSHSKSLWRRSQAYDMMGLAKESLMD 512
+L L+ + A ++ ++A+ K+L+RRSQA + +G ++++D
Sbjct: 75 HLKLEDYDKAETEASKAIEKD---GGDVKALYRRSQALEKLGRLDQAVLD 121
|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 604 | |||
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.78 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.77 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.72 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.69 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.66 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.62 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.6 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.57 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.57 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.56 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.56 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.55 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.55 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.55 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.52 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.51 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.5 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.47 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.45 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.44 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.44 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.43 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.43 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.41 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.41 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.39 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.38 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.37 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.37 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.37 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.36 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.36 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.36 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.35 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.35 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.34 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.31 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.31 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.29 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.27 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.26 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.26 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.26 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.25 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.24 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.24 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.22 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.21 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.21 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.21 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.2 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.19 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.18 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.18 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.17 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.17 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.16 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.15 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.15 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.15 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.14 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.14 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.14 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.14 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.13 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.11 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.11 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.11 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.11 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.1 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.1 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.1 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.1 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.1 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.1 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.1 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.09 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.09 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.09 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.08 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.08 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.08 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.06 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.05 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.04 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.03 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.03 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.03 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.02 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 98.99 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 98.99 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.99 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.98 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 98.98 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 98.97 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.97 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 98.96 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 98.96 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.95 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.95 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 98.94 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.93 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.92 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.89 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.89 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.89 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.88 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.88 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.88 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.88 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.88 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.87 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 98.87 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.86 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.86 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.86 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.85 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.85 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.84 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.83 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.83 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.82 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.82 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 98.81 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.81 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.81 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.8 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.8 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.8 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.79 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.79 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.79 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 98.79 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.78 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.78 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.77 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.76 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.75 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.74 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.74 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.73 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.73 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.72 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.69 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.69 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.69 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.68 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.67 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.67 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.66 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.65 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.63 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.62 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.61 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.6 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.59 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.59 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.58 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.58 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.58 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.58 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.58 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.56 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.56 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.55 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.55 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.53 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.52 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.5 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.48 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.48 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.46 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.45 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.45 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.41 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.4 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.4 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 98.4 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.34 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.29 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.26 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.23 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.22 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.21 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.19 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.17 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.13 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.1 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.08 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 97.99 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.94 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.93 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.93 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.83 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 97.81 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 97.76 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.69 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.65 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.65 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.62 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.52 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.43 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.31 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 97.31 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.31 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 97.29 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.28 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 97.27 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.25 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.1 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.09 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.0 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 96.97 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 96.64 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 96.63 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 96.22 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 95.69 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 95.64 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 95.55 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 95.35 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 95.17 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 95.16 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 95.11 | |
| 4db8_A | 252 | Armadillo-repeat protein; solenoid repeat, de novo | 94.93 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 94.81 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 94.81 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 94.75 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 94.75 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 94.61 | |
| 4db6_A | 210 | Armadillo repeat protein; solenoid repeat, armadil | 94.52 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 94.38 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 94.26 | |
| 4hxt_A | 252 | De novo protein OR329; structural genomics, PSI-bi | 94.22 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 93.98 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 93.95 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 93.93 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 93.62 | |
| 2z6h_A | 644 | Catenin beta-1, beta-catenin; C-terminal domain, a | 93.57 | |
| 1xm9_A | 457 | Plakophilin 1; armadillo repeat, cell adhesion; 2. | 93.41 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 93.4 | |
| 2z6g_A | 780 | B-catenin; FULL-length, beta-catenin, cell adhesio | 93.04 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 93.03 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 92.61 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 92.19 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 91.8 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 91.64 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 91.62 | |
| 3l6x_A | 584 | Catenin delta-1; catenin, armadillo, ARM, JMD, CE | 91.34 | |
| 4b8j_A | 528 | Importin subunit alpha-1A; transport protein, nucl | 90.82 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 90.46 | |
| 1wa5_B | 530 | Importin alpha subunit; nuclear transport/complex, | 88.54 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 88.51 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 88.12 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 87.65 | |
| 3nmw_A | 354 | APC variant protein; ARMADIILO repeats domain, cel | 87.65 | |
| 1xqr_A | 296 | HSPBP1 protein; armadillo repeat, superhelical twi | 87.4 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 87.07 | |
| 2jdq_A | 450 | Importin alpha-1 subunit; transport, PB2 subunit, | 86.48 | |
| 3tpo_A | 529 | Importin subunit alpha-2; nuclear import, protein | 86.24 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 85.05 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 84.47 | |
| 3now_A | 810 | UNC-45 protein, SD10334P; armadillo repeat, HSP90, | 84.45 | |
| 3ul1_B | 510 | Importin subunit alpha-2; arm repeat, armadillo re | 84.03 | |
| 1jdh_A | 529 | Beta-catenin; beta-catenin, protein-protein comple | 83.4 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 82.49 | |
| 3nmz_A | 458 | APC variant protein; protein-protein complex, arma | 82.34 | |
| 3tt9_A | 233 | Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | 81.7 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 80.79 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 80.56 |
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
Probab=99.78 E-value=1.6e-18 Score=154.39 Aligned_cols=115 Identities=21% Similarity=0.200 Sum_probs=105.2
Q ss_pred hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCcccchHHHHHHHHHHHHHcCCcHHHHHHHHHHHhcCCCCCCC
Q 046116 410 NELSVFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYLMLKKPEAAISDTTRALSLSKTMSSH 489 (604)
Q Consensus 410 ~~~~A~~lk~~GN~lfk~GdyeeAIe~YtkALel~P~~~~~~~a~l~~NRA~~ylkLgdy~eAI~D~~rALeLdPd~~~n 489 (604)
+|+.++.++++|+.+|++|+|++|++.|++||+++|. ++.+|.++|.||.++|++++|+.++++|++++|+ +
T Consensus 9 nP~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~-----~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~---~ 80 (126)
T 4gco_A 9 NPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPE-----NAILYSNRAACLTKLMEFQRALDDCDTCIRLDSK---F 80 (126)
T ss_dssp CHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-----CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT---C
T ss_pred CHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-----CHHHHHHHhhHHHhhccHHHHHHHHHHHHHhhhh---h
Confidence 3457899999999999999999999999999999999 8999999999999999999999999999999999 9
Q ss_pred HHHHHHHHHHHHHcCCHHHHHHHHHHHHhchhhcCCCCCCCHHHHHHH
Q 046116 490 SKSLWRRSQAYDMMGLAKESLMDALTFIGSRMKCKHTNRVKIPYYAAV 537 (604)
Q Consensus 490 ~KA~~rrG~a~~~LGd~dEAL~d~~kALkl~~~~~d~~~~~i~~~l~r 537 (604)
.++|+++|.++..+|++++|+.+|++++++.| .+..+...+.+
T Consensus 81 ~~a~~~lg~~~~~~~~~~~A~~~~~~al~l~P-----~~~~a~~~l~~ 123 (126)
T 4gco_A 81 IKGYIRKAACLVAMREWSKAQRAYEDALQVDP-----SNEEAREGVRN 123 (126)
T ss_dssp HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-----TCHHHHHHHHH
T ss_pred hHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCc-----CCHHHHHHHHH
Confidence 99999999999999999999999999999944 44444444433
|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A | Back alignment and structure |
|---|
| >4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A | Back alignment and structure |
|---|
| >1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A | Back alignment and structure |
|---|
| >3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... | Back alignment and structure |
|---|
| >1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 604 | ||||
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-04 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 6e-05 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 1e-04 | |
| d1hz4a_ | 366 | a.118.8.2 (A:) Transcription factor MalT domain II | 6e-04 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 0.001 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 0.002 | |
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 0.002 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.4 bits (111), Expect = 3e-06
Identities = 12/141 (8%), Positives = 40/141 (28%), Gaps = 8/141 (5%)
Query: 417 LKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYLMLKKPEAAISDT 476
+ ++E+ AG E A + + P + + + + ++ + + +
Sbjct: 2 PMELAHREYQAGDFEAAERHCMQLWRQEP-----DNTGVLLLLSSIHFQCRRLDRSAHFS 56
Query: 477 TRALSLSKTMSSHSKSLWRRSQAYDMMGLAKESLMDALTFIGSRMKCKHTNRVKIPYYAA 536
T A+ + +++ Y G +E++ + + A
Sbjct: 57 TLAIKQN---PLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVA 113
Query: 537 VMINKQMNATWPFIHAKSKMC 557
+ + +
Sbjct: 114 AGDMEGAVQAYVSALQYNPDL 134
|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 604 | |||
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.76 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.76 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.75 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.75 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.75 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.72 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.68 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.64 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.5 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.46 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.45 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.43 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.37 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.35 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.31 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.3 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.28 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.22 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.22 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.18 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.16 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.12 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.11 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.09 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.04 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.01 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.99 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.93 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.91 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.88 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.83 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.68 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.68 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.66 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.61 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.57 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.56 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.56 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.52 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.49 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.45 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.42 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.31 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.27 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.22 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.53 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.46 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.39 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.34 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.2 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.13 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.1 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 96.4 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 95.98 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 94.51 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 93.58 | |
| d1jdha_ | 529 | beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | 91.34 | |
| d1xm9a1 | 457 | Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | 88.87 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 86.78 | |
| d1xqra1 | 264 | Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi | 86.29 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 84.57 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 81.85 | |
| d1q1sc_ | 434 | Importin alpha {Mouse (Mus musculus) [TaxId: 10090 | 81.69 | |
| d1wa5b_ | 503 | Karyopherin alpha {Baker's yeast (Saccharomyces ce | 81.22 |
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: STIP1 homology and U box-containing protein 1, STUB1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76 E-value=6.8e-18 Score=155.08 Aligned_cols=103 Identities=31% Similarity=0.396 Sum_probs=100.1
Q ss_pred HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCcccchHHHHHHHHHHHHHcCCcHHHHHHHHHHHhcCCCCCCCHHHH
Q 046116 414 VFMLKQQGNQEFWAGYIEEAVKKYSKALDLCPLKMRKERIVLYSNRAQCYLMLKKPEAAISDTTRALSLSKTMSSHSKSL 493 (604)
Q Consensus 414 A~~lk~~GN~lfk~GdyeeAIe~YtkALel~P~~~~~~~a~l~~NRA~~ylkLgdy~eAI~D~~rALeLdPd~~~n~KA~ 493 (604)
++.++++||.+|+.|+|++|+..|++||+++|. ++.+|.|+|.||+++|+|++|+.+|++|++++|+ ++++|
T Consensus 4 a~~l~~~Gn~~~~~g~~~~Ai~~~~kal~~~p~-----~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~---~~~a~ 75 (201)
T d2c2la1 4 AQELKEQGNRLFVGRKYPEAAACYGRAITRNPL-----VAVYYTNRALCYLKMQQPEQALADCRRALELDGQ---SVKAH 75 (201)
T ss_dssp HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSC-----CHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTT---CHHHH
T ss_pred HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCC-----CHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCC---cHHHH
Confidence 778999999999999999999999999999999 9999999999999999999999999999999999 99999
Q ss_pred HHHHHHHHHcCCHHHHHHHHHHHHhchhhcC
Q 046116 494 WRRSQAYDMMGLAKESLMDALTFIGSRMKCK 524 (604)
Q Consensus 494 ~rrG~a~~~LGd~dEAL~d~~kALkl~~~~~ 524 (604)
+++|.+|..+|++++|+.+|++++++.|+..
T Consensus 76 ~~lg~~~~~l~~~~~A~~~~~~al~l~p~~~ 106 (201)
T d2c2la1 76 FFLGQCQLEMESYDEAIANLQRAYSLAKEQR 106 (201)
T ss_dssp HHHHHHHHHTTCHHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHCCCHHHHHHHHHHHHHhCcccH
Confidence 9999999999999999999999999987654
|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|