Citrus Sinensis ID: 046124


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
RQDVDAEKRHEQLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
ccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHHHHcccccEEccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHc
cccccHHHHHHHHHHHHHccccEEccccccEcEEEEEEcccccEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcccccccccccccccccEccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHc
RQDVDAEKRHEQLNLFLLGNynvnlssnaslnatfyiyqpentVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVaerapesvaderpieptvVGLQLQLEHVWRCLEGESVGIVGlygmggvgkTTLLTHINnkflesptnfNYVIWVVMSKDSRLENIQETIGE
rqdvdaekRHEQLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELgklieakndvvarvvnaerqqtmtrlnkvqgwlsrFGKKVAKKLRDAGTLMANGAFEVVAERApesvaderpiePTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLEniqetige
RQDVDAEKRHEQLNLFLLGNYNVnlssnaslnaTFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESvgivglygmggvgKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
************LNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAE**********PIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMS**************
***********QLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAG********************************QLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
********RHEQLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
****DAEKRHEQLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
RQDVDAEKRHEQLNLFLLGNYNVNLSSNASLNATFYIYQPENTVRICRNILQISIDGAIFNRCLDCFLGKAASxxxxxxxxxxxxxxxxxxxxxKNDVVARVVNAERQQTMTRLNKVQGWLSRFGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q8L3R3 885 Disease resistance protei yes no 0.705 0.189 0.375 1e-29
O82484 892 Putative disease resistan no no 0.773 0.206 0.351 2e-29
Q9LMP6 851 Probable disease resistan no no 0.768 0.215 0.376 7e-29
O64973 889 Disease resistance protei no no 0.710 0.190 0.359 1e-28
O64789 925 Probable disease resistan no no 0.777 0.2 0.351 3e-28
P60839 884 Probable disease resistan no no 0.781 0.210 0.337 1e-27
P60838 894 Probable disease resistan no no 0.693 0.184 0.376 3e-27
Q9C8T9 898 Putative disease resistan no no 0.701 0.185 0.364 8e-27
Q8RXS5 888 Probable disease resistan no no 0.777 0.208 0.333 1e-26
O22727 967 Probable disease resistan no no 0.785 0.193 0.342 2e-26
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function desciption
 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/205 (37%), Positives = 109/205 (53%), Gaps = 37/205 (18%)

Query: 71  AASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQTMTRLNKVQGWLSR------- 123
            + I+NL +N+ +L+  +G L   ++DV  R+   E      RL +VQ WL+R       
Sbjct: 26  GSYIQNLSENLASLQKAMGVLNAKRDDVQGRINREEFTGHRRRLAQVQVWLTRIQTIENQ 85

Query: 124 ------------------------------FGKKVAKKLRDAGTLMANGAFEVVAERAPE 153
                                         +GK+V   LR+   L + G F++V E AP 
Sbjct: 86  FNDLLSTCNAEIQRLCLCGFCSKNVKMSYLYGKRVIVLLREVEGLSSQGVFDIVTEAAPI 145

Query: 154 SVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPT 213
           +  +E PI+ T+VG    L+ VW CL  + V IVGLYGMGGVGKTTLLT INNKF +   
Sbjct: 146 AEVEELPIQSTIVGQDSMLDKVWNCLMEDKVWIVGLYGMGGVGKTTLLTQINNKFSKLGG 205

Query: 214 NFNYVIWVVMSKDSRLENIQETIGE 238
            F+ VIWVV+SK++ +  IQ++IGE
Sbjct: 206 GFDVVIWVVVSKNATVHKIQKSIGE 230




Disease resistance (R) protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q9LMP6|DRL3_ARATH Probable disease resistance protein At1g15890 OS=Arabidopsis thaliana GN=At1g15890 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description
>sp|O64789|DRL18_ARATH Probable disease resistance protein At1g61310 OS=Arabidopsis thaliana GN=At1g61310 PE=2 SV=1 Back     alignment and function description
>sp|P60839|DRL2_ARATH Probable disease resistance protein At1g12290 OS=Arabidopsis thaliana GN=At1g12290 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|O22727|DRL16_ARATH Probable disease resistance protein At1g61190 OS=Arabidopsis thaliana GN=At1g61190 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
24461863 889 NBS-LRR type disease resistance protein 0.760 0.203 0.631 1e-69
24461861 890 NBS-LRR type disease resistance protein 0.794 0.212 0.624 1e-67
24461864 899 NBS-LRR type disease resistance protein 0.794 0.210 0.608 5e-66
24461865 892 NBS-LRR type disease resistance protein 0.798 0.213 0.621 8e-66
24461866 890 NBS-LRR type disease resistance protein 0.794 0.212 0.570 3e-59
255553135 894 Disease resistance protein RFL1, putativ 0.781 0.208 0.446 3e-40
359482676 896 PREDICTED: probable disease resistance p 0.789 0.209 0.441 2e-39
225462595 897 PREDICTED: probable disease resistance p 0.789 0.209 0.449 5e-39
359483035 897 PREDICTED: probable disease resistance p 0.789 0.209 0.445 2e-38
147779772 910 hypothetical protein VITISV_011527 [Viti 0.785 0.205 0.451 5e-38
>gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 163/228 (71%), Gaps = 47/228 (20%)

Query: 49  NILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQ 108
           NILQI+IDGA+FNRC+DCFLGKAA IRNLQ+NVVALETELGKLIEAKNDV+ARVVN ERQ
Sbjct: 3   NILQIAIDGAVFNRCMDCFLGKAAYIRNLQENVVALETELGKLIEAKNDVMARVVNTERQ 62

Query: 109 QTMTRLNKVQGWLS-------------------------------------RFGKKVAKK 131
             MTRLNKVQGWLS                                     +FGK+VAKK
Sbjct: 63  PMMTRLNKVQGWLSGVDAVKAEADELIRHGSQEIEKLCLGGYCSKNWKSSYKFGKQVAKK 122

Query: 132 LRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYG 191
           LRDAGTLMA G FEVVAERAPES A         VG+Q +LE VWRCL  E VGIVGLYG
Sbjct: 123 LRDAGTLMAEGVFEVVAERAPESAA---------VGMQSRLEPVWRCLVEEPVGIVGLYG 173

Query: 192 MGGVGKTTLLTHINNKFL-ESPTNFNYVIWVVMSKDSRLENIQETIGE 238
           MGGVGKTTLLTH+NNKFL +   +F+++IWVV+SKD ++E IQE IG+
Sbjct: 174 MGGVGKTTLLTHLNNKFLGQRDFHFDFLIWVVVSKDLQIEKIQEIIGK 221




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] Back     alignment and taxonomy information
>gi|255553135|ref|XP_002517610.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543242|gb|EEF44774.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359482676|ref|XP_002281742.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225462595|ref|XP_002270572.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483035|ref|XP_003632886.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147779772|emb|CAN65731.1| hypothetical protein VITISV_011527 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
TAIR|locus:2034765 884 AT1G12290 [Arabidopsis thalian 0.483 0.130 0.382 1.7e-22
TAIR|locus:2132741 892 AT4G10780 [Arabidopsis thalian 0.474 0.126 0.347 1.9e-22
TAIR|locus:2201996 889 RPS5 "AT1G12220" [Arabidopsis 0.487 0.130 0.396 4.2e-22
TAIR|locus:2034770 894 SUMM2 "AT1G12280" [Arabidopsis 0.483 0.128 0.391 1.2e-21
TAIR|locus:2166320 888 AT5G63020 [Arabidopsis thalian 0.483 0.129 0.370 1.2e-21
TAIR|locus:2008510 967 AT1G61190 "AT1G61190" [Arabido 0.483 0.118 0.336 1.1e-20
TAIR|locus:2170892 848 AT5G43730 [Arabidopsis thalian 0.462 0.129 0.385 2.1e-20
TAIR|locus:2203881 893 AT1G62630 [Arabidopsis thalian 0.483 0.128 0.344 2.4e-20
TAIR|locus:2008440 899 AT1G61180 [Arabidopsis thalian 0.483 0.127 0.353 3.1e-20
TAIR|locus:2170902 862 AT5G43740 [Arabidopsis thalian 0.466 0.128 0.362 5.7e-20
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 202 (76.2 bits), Expect = 1.7e-22, Sum P(2) = 1.7e-22
 Identities = 44/115 (38%), Positives = 62/115 (53%)

Query:   124 FGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGES 183
             +G++V   L     L + G FE VA  A  +V +ERP++PT+VG +  LE  W  L  + 
Sbjct:   115 YGRRVFLMLNIVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDG 174

Query:   184 XXXXXXXXXXXXXKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE 238
                          KTTLLT INN+F ++      VIWVV+S D ++  IQ+ IGE
Sbjct:   175 TKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGE 229


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00034584001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (898 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 5e-12
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 63.9 bits (156), Expect = 5e-12
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 172 LEHVWRCL--EGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRL 229
           +E +   L    +++G+VG+ GMGGVGKTTL   I N       +F+ V WVV+SK    
Sbjct: 5   IEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-SVGGHFDSVAWVVVSKTYTE 63

Query: 230 ENIQETIGE 238
             +Q+ I +
Sbjct: 64  FRLQKDILQ 72


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.87
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.38
COG0488 530 Uup ATPase components of ABC transporters with dup 99.11
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.79
cd01128 249 rho_factor Transcription termination factor rho is 98.78
PRK09376 416 rho transcription termination factor Rho; Provisio 98.68
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.64
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.55
TIGR00767 415 rho transcription termination factor Rho. Members 98.36
PRK11147 635 ABC transporter ATPase component; Reviewed 98.33
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.3
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.15
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 98.1
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.09
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.09
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.03
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.03
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.95
PTZ00202 550 tuzin; Provisional 97.94
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 97.93
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.92
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.77
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.75
COG4559 259 ABC-type hemin transport system, ATPase component 97.7
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 97.7
PRK13342 413 recombination factor protein RarA; Reviewed 97.68
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.68
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.67
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.67
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.66
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 97.66
PLN03073 718 ABC transporter F family; Provisional 97.66
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 97.65
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.65
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 97.65
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.65
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.63
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.63
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.63
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.63
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 97.63
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.62
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.62
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.62
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 97.61
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 97.61
COG0488 530 Uup ATPase components of ABC transporters with dup 97.61
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 97.61
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 97.6
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 97.6
KOG2028 554 consensus ATPase related to the helicase subunit o 97.6
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.59
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 97.59
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.59
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.59
cd03269 210 ABC_putative_ATPase This subfamily is involved in 97.59
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 97.58
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.58
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.58
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 97.58
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 97.58
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 97.57
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 97.57
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 97.57
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 97.57
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 97.57
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 97.56
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 97.56
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 97.56
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.56
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.55
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 97.55
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.55
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 97.54
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 97.54
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 97.54
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 97.53
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 97.53
cd03238 176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.53
COG0410 237 LivF ABC-type branched-chain amino acid transport 97.53
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.53
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 97.52
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 97.52
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 97.52
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 97.52
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 97.51
TIGR00235 207 udk uridine kinase. Model contains a number of lon 97.51
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 97.51
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.5
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 97.5
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 97.5
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.5
PRK05480 209 uridine/cytidine kinase; Provisional 97.49
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 97.49
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 97.49
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 97.48
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 97.48
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 97.48
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 97.48
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 97.48
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 97.47
PRK06696 223 uridine kinase; Validated 97.46
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 97.46
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 97.46
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 97.45
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 97.45
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 97.45
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 97.45
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 97.45
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 97.45
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 97.44
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.44
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 97.44
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 97.44
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 97.44
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 97.44
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 97.44
PRK13537 306 nodulation ABC transporter NodI; Provisional 97.44
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 97.44
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 97.43
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 97.43
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.43
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 97.43
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 97.43
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.43
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 97.43
PLN03025 319 replication factor C subunit; Provisional 97.42
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 97.42
PRK10908 222 cell division protein FtsE; Provisional 97.42
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 97.42
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 97.42
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 97.42
cd03246173 ABCC_Protease_Secretion This family represents the 97.42
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 97.41
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 97.41
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 97.41
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.41
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 97.41
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 97.41
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 97.4
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 97.4
cd03215 182 ABC_Carb_Monos_II This family represents domain II 97.4
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 97.4
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.4
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 97.4
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 97.4
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 97.39
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 97.39
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 97.39
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 97.39
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 97.39
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 97.39
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.39
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 97.38
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 97.38
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 97.38
PRK11147 635 ABC transporter ATPase component; Reviewed 97.38
PRK13536 340 nodulation factor exporter subunit NodI; Provision 97.38
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 97.38
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 97.38
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 97.38
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 97.37
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 97.37
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 97.37
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 97.37
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 97.37
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 97.37
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 97.37
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, 97.36
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 97.36
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 97.36
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 97.36
cd03214 180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 97.36
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 97.36
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 97.36
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 97.35
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 97.35
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 97.35
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 97.35
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.35
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.35
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 97.34
PRK10938 490 putative molybdenum transport ATP-binding protein 97.34
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.34
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 97.34
PRK13546 264 teichoic acids export protein ATP-binding subunit; 97.34
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 97.34
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.34
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 97.33
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 97.33
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 97.33
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 97.33
PRK12402 337 replication factor C small subunit 2; Reviewed 97.33
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 97.33
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 97.33
TIGR03771 223 anch_rpt_ABC anchored repeat-type ABC transporter, 97.32
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
PRK06547 172 hypothetical protein; Provisional 97.32
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 97.32
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 97.32
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 97.32
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 97.32
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 97.32
PRK09984 262 phosphonate/organophosphate ester transporter subu 97.32
cd03234 226 ABCG_White The White subfamily represents ABC tran 97.32
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 97.31
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 97.31
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 97.31
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 97.31
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 97.31
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 97.31
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 97.31
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 97.31
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.3
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 97.29
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 97.29
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 97.28
PRK15455 644 PrkA family serine protein kinase; Provisional 97.28
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 97.28
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 97.28
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 97.28
COG1117 253 PstB ABC-type phosphate transport system, ATPase c 97.28
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 97.28
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 97.28
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 97.28
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.28
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.27
cd03217 200 ABC_FeS_Assembly ABC-type transport system involve 97.27
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 97.27
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 97.27
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 97.27
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 97.27
COG4555 245 NatA ABC-type Na+ transport system, ATPase compone 97.27
COG4133 209 CcmA ABC-type transport system involved in cytochr 97.27
smart00382148 AAA ATPases associated with a variety of cellular 97.26
COG2274 709 SunT ABC-type bacteriocin/lantibiotic exporters, c 97.26
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 97.26
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 97.26
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 97.25
COG4618 580 ArpD ABC-type protease/lipase transport system, AT 97.25
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 97.25
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 97.25
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.25
PRK13409 590 putative ATPase RIL; Provisional 97.25
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 97.24
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the 97.24
PRK15064 530 ABC transporter ATP-binding protein; Provisional 97.24
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 97.24
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 97.24
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 97.23
TIGR00968 237 3a0106s01 sulfate ABC transporter, ATP-binding pro 97.23
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 97.23
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 97.23
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 97.23
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 97.22
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 97.22
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 97.21
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 97.21
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 97.21
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 97.21
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 97.21
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 97.21
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.2
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 97.2
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.2
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 97.2
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.19
PLN03073 718 ABC transporter F family; Provisional 97.19
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.19
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 97.19
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 97.19
KOG0062 582 consensus ATPase component of ABC transporters wit 97.18
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 97.18
PRK03695 248 vitamin B12-transporter ATPase; Provisional 97.18
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.18
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 97.18
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 97.17
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 97.17
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.16
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 97.16
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 97.16
COG4619 223 ABC-type uncharacterized transport system, ATPase 97.15
cd03299 235 ABC_ModC_like Archeal protein closely related to M 97.15
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 97.15
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 97.15
PRK06762 166 hypothetical protein; Provisional 97.15
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 97.14
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 97.14
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.14
cd03274 212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 97.14
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 97.14
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.14
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.13
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.13
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 97.13
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 97.12
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 97.12
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 97.12
PF13173128 AAA_14: AAA domain 97.12
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 97.11
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.11
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 97.11
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 97.11
PRK10938 490 putative molybdenum transport ATP-binding protein 97.11
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 97.11
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 97.1
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 97.1
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 97.1
COG3638 258 ABC-type phosphate/phosphonate transport system, A 97.09
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.09
PRK04195 482 replication factor C large subunit; Provisional 97.09
PF00004132 AAA: ATPase family associated with various cellula 97.09
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 97.08
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 97.08
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 97.07
PRK07667 193 uridine kinase; Provisional 97.07
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 97.07
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 97.07
COG1127 263 Ttg2A ABC-type transport system involved in resist 97.07
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 97.07
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.07
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 97.06
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 97.06
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 97.06
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 97.05
TIGR01186 363 proV glycine betaine/L-proline transport ATP bindi 97.05
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 97.05
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.04
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 97.04
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 97.04
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 97.04
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 97.03
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.02
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.02
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 97.02
COG2884 223 FtsE Predicted ATPase involved in cell division [C 97.02
PHA02544 316 44 clamp loader, small subunit; Provisional 97.02
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 97.02
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.01
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 97.01
PRK13409 590 putative ATPase RIL; Provisional 96.99
PRK13531 498 regulatory ATPase RavA; Provisional 96.99
PRK13341 725 recombination factor protein RarA/unknown domain f 96.99
PRK05564 313 DNA polymerase III subunit delta'; Validated 96.99
PHA00729 226 NTP-binding motif containing protein 96.99
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 96.99
cd03240 204 ABC_Rad50 The catalytic domains of Rad50 are simil 96.98
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.97
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 96.97
CHL00181 287 cbbX CbbX; Provisional 96.97
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 96.96
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.96
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 96.96
PRK10751 173 molybdopterin-guanine dinucleotide biosynthesis pr 96.95
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.95
PRK09183 259 transposase/IS protein; Provisional 96.94
PRK09452 375 potA putrescine/spermidine ABC transporter ATPase 96.94
PRK05541 176 adenylylsulfate kinase; Provisional 96.94
PRK10261 623 glutathione transporter ATP-binding protein; Provi 96.93
CHL00095 821 clpC Clp protease ATP binding subunit 96.93
PRK12608 380 transcription termination factor Rho; Provisional 96.93
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.92
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 96.92
TIGR00073 207 hypB hydrogenase accessory protein HypB. HypB is i 96.92
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 96.92
cd03280 200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 96.91
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.9
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 96.9
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 96.9
PRK10261 623 glutathione transporter ATP-binding protein; Provi 96.89
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.89
cd03243 202 ABC_MutS_homologs The MutS protein initiates DNA m 96.89
COG0572 218 Udk Uridine kinase [Nucleotide transport and metab 96.89
PRK11607 377 potG putrescine transporter ATP-binding subunit; P 96.88
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.88
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 96.88
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 96.87
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 96.87
PRK08084 235 DNA replication initiation factor; Provisional 96.87
COG4525 259 TauB ABC-type taurine transport system, ATPase com 96.86
PRK05057 172 aroK shikimate kinase I; Reviewed 96.86
COG0411 250 LivG ABC-type branched-chain amino acid transport 96.85
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.84
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 96.83
PF1355562 AAA_29: P-loop containing region of AAA domain 96.83
cd04159 159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.82
PRK03992 389 proteasome-activating nucleotidase; Provisional 96.82
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 96.82
COG4987 573 CydC ABC-type transport system involved in cytochr 96.82
COG4167 267 SapF ABC-type antimicrobial peptide transport syst 96.81
cd03275 247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 96.81
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 96.81
PRK14257 329 phosphate ABC transporter ATP-binding protein; Pro 96.8
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 96.8
PRK08727 233 hypothetical protein; Validated 96.79
PRK03846 198 adenylylsulfate kinase; Provisional 96.79
PLN02796 347 D-glycerate 3-kinase 96.78
cd00464 154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.78
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.78
PRK10865 857 protein disaggregation chaperone; Provisional 96.77
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 96.76
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 96.76
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 96.75
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.73
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain 96.73
PRK11176 582 lipid transporter ATP-binding/permease protein; Pr 96.72
PLN02165 334 adenylate isopentenyltransferase 96.72
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.71
TIGR00176 155 mobB molybdopterin-guanine dinucleotide biosynthes 96.71
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 96.7
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 96.7
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 96.69
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.69
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.68
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 96.68
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.67
TIGR02237 209 recomb_radB DNA repair and recombination protein R 96.67
PRK09087 226 hypothetical protein; Validated 96.67
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 96.67
PF13476 202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 96.66
TIGR03797 686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 96.66
PRK06893 229 DNA replication initiation factor; Validated 96.65
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 96.65
TIGR01842 544 type_I_sec_PrtD type I secretion system ABC transp 96.65
PRK10789 569 putative multidrug transporter membrane\ATP-bindin 96.64
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.64
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 96.63
PRK10416 318 signal recognition particle-docking protein FtsY; 96.63
COG4586 325 ABC-type uncharacterized transport system, ATPase 96.62
PRK10522 547 multidrug transporter membrane component/ATP-bindi 96.61
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 96.6
COG4604 252 CeuD ABC-type enterochelin transport system, ATPas 96.6
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.6
TIGR00958 711 3a01208 Conjugate Transporter-2 (CT2) Family prote 96.59
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.59
PRK08903 227 DnaA regulatory inactivator Hda; Validated 96.59
cd04163 168 Era Era subfamily. Era (E. coli Ras-like protein) 96.58
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.58
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 96.58
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 96.57
KOG0057 591 consensus Mitochondrial Fe/S cluster exporter, ABC 96.57
TIGR02204 576 MsbA_rel ABC transporter, permease/ATP-binding pro 96.56
PLN02318 656 phosphoribulokinase/uridine kinase 96.56
KOG0927 614 consensus Predicted transporter (ABC superfamily) 96.54
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 96.54
COG3840 231 ThiQ ABC-type thiamine transport system, ATPase co 96.54
PLN03211 659 ABC transporter G-25; Provisional 96.54
TIGR02857 529 CydD thiol reductant ABC exporter, CydD subunit. U 96.54
cd03281 213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 96.54
TIGR03796 710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 96.54
COG1123 539 ATPase components of various ABC-type transport sy 96.53
PRK11160 574 cysteine/glutathione ABC transporter membrane/ATP- 96.52
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 96.52
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 96.51
PRK13657 588 cyclic beta-1,2-glucan ABC transporter; Provisiona 96.51
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 96.51
PRK08181 269 transposase; Validated 96.51
PRK10536 262 hypothetical protein; Provisional 96.5
KOG0062 582 consensus ATPase component of ABC transporters wit 96.49
TIGR01193 708 bacteriocin_ABC ABC-type bacteriocin transporter. 96.49
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.49
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.49
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 96.48
COG4136 213 ABC-type uncharacterized transport system, ATPase 96.48
COG4598 256 HisP ABC-type histidine transport system, ATPase c 96.47
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 96.47
TIGR03375 694 type_I_sec_LssB type I secretion system ATPase, Ls 96.47
COG1132 567 MdlB ABC-type multidrug transport system, ATPase a 96.47
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.47
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 96.46
PRK14738 206 gmk guanylate kinase; Provisional 96.45
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 96.45
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 96.45
TIGR00954 659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 96.44
TIGR01192 585 chvA glucan exporter ATP-binding protein. This mod 96.44
PRK10790 592 putative multidrug transporter membrane\ATP-bindin 96.44
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 96.44
PRK13765 637 ATP-dependent protease Lon; Provisional 96.44
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 96.44
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 96.43
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 96.43
TIGR02203 571 MsbA_lipidA lipid A export permease/ATP-binding pr 96.42
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 96.42
cd01394 218 radB RadB. The archaeal protein radB shares simila 96.41
KOG0058 716 consensus Peptide exporter, ABC superfamily [Intra 96.41
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 96.41
PRK09435 332 membrane ATPase/protein kinase; Provisional 96.41
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 96.4
cd04138 162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 96.4
PRK00454 196 engB GTP-binding protein YsxC; Reviewed 96.4
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 96.39
PRK14527 191 adenylate kinase; Provisional 96.38
TIGR00231 161 small_GTP small GTP-binding protein domain. This m 96.38
cd03116 159 MobB Molybdenum is an essential trace element in t 96.37
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 96.37
smart00178 184 SAR Sar1p-like members of the Ras-family of small 96.37
PRK08099 399 bifunctional DNA-binding transcriptional repressor 96.37
cd00154 159 Rab Rab family. Rab GTPases form the largest famil 96.37
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.87  E-value=3.3e-21  Score=187.68  Aligned_cols=179  Identities=39%  Similarity=0.593  Sum_probs=126.9

Q ss_pred             HhhHHHHHHHHHhhhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh-------cccccHHHHHHHHH---------
Q 046124           60 FNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQ-------TMTRLNKVQGWLSR---------  123 (238)
Q Consensus        60 ~~~l~~~~~~e~~~~~~~~~~~~~L~~el~~l~~~l~d~~~~~~~a~~k~-------~~~~~~~~~~Wl~~---------  123 (238)
                      +.++++++.++...+.+...++..|++++..++.+++|++++...-....       ..........|+.+         
T Consensus         9 ~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~   88 (889)
T KOG4658|consen    9 VEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN   88 (889)
T ss_pred             hhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            56677788888888889999999999999999999999766532111110       01223344455544         


Q ss_pred             ----------------------------HHHHHHHHHHHHHHHHhcCCcccccc-cCCCCCCCCCCCCCcc-eecHHHHH
Q 046124          124 ----------------------------FGKKVAKKLRDAGTLMANGAFEVVAE-RAPESVADERPIEPTV-VGLQLQLE  173 (238)
Q Consensus       124 ----------------------------~~~~~~~~i~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-vG~~~~~~  173 (238)
                                                  +++++.+.+++++....++.|..... ..+...+..+|..+.. ||.+.+++
T Consensus        89 ~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~VG~e~~~~  168 (889)
T KOG4658|consen   89 DLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLE  168 (889)
T ss_pred             HHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCccccccHHHHHH
Confidence                                        12223333333333333344444432 1222234444444333 99999999


Q ss_pred             HHHHHhcCCcceEEEEEecCCCchhHHHHHHHhhhccCCCCCCEEEEEEeCCCCCHHHHHHHHhC
Q 046124          174 HVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE  238 (238)
Q Consensus       174 ~l~~~L~~~~~~vI~IvG~gGvGKTTLak~i~~~~~~v~~~Fd~~~wV~vs~~~~~~~i~~~Il~  238 (238)
                      .++..|.+++..+|||+||||+||||||+.|+|+...+.++||.+|||+||++|+..+|+++|++
T Consensus       169 kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~  233 (889)
T KOG4658|consen  169 KLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILE  233 (889)
T ss_pred             HHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHH
Confidence            99999999887999999999999999999999999339999999999999999999999999974



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-16
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-08
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 4e-05
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 76.0 bits (186), Expect = 5e-16
 Identities = 34/209 (16%), Positives = 82/209 (39%), Gaps = 45/209 (21%)

Query: 47  CRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVAR----- 101
            ++IL +  D   F    DC       ++++ K++++ E E+  +I +K+ V        
Sbjct: 18  YKDILSVFEDA--FVDNFDC-----KDVQDMPKSILSKE-EIDHIIMSKDAVSGTLRLFW 69

Query: 102 VVNAERQQTMTR-----LNKVQGWLSRFGKKVAKKLRDAGTLMA------NGAFEVVAER 150
            + +++++ + +     L     +L      +  + R    +        +  +      
Sbjct: 70  TLLSKQEEMVQKFVEEVLRINYKFLM---SPIKTEQRQPSMMTRMYIEQRDRLYNDNQVF 126

Query: 151 APESVADERPIEPTVVGLQLQLEHVWRCL-EGESVGIVGLYGMGGVGKTTL-LTHINNKF 208
           A  +V+  +P       L+L+     + L E      V + G+ G GKT + L    +  
Sbjct: 127 AKYNVSRLQPY------LKLR-----QALLELRPAKNVLIDGVLGSGKTWVALDVCLSYK 175

Query: 209 LESPTNFNYVIWVVMSK----DSRLENIQ 233
           ++   +F  + W+ +      ++ LE +Q
Sbjct: 176 VQCKMDFK-IFWLNLKNCNSPETVLEMLQ 203


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.5
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.19
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 98.99
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.89
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 98.38
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.25
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.22
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.12
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.1
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 98.09
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.07
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.99
2fna_A 357 Conserved hypothetical protein; structural genomic 97.99
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 97.97
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.97
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 97.97
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.82
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.81
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 97.8
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 97.73
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 97.73
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 97.72
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.71
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 97.71
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.7
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 97.7
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 97.67
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.67
1b0u_A 262 Histidine permease; ABC transporter, transport pro 97.67
1ji0_A 240 ABC transporter; ATP binding protein, structural g 97.66
1g6h_A 257 High-affinity branched-chain amino acid transport 97.66
1sgw_A 214 Putative ABC transporter; structural genomics, P p 97.65
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 97.65
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.64
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.64
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 97.64
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 97.64
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 97.63
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 97.63
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 97.63
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 97.62
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 97.61
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.61
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 97.61
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 97.6
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 97.6
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 97.6
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.59
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 97.58
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.58
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 97.58
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.58
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.57
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 97.56
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.56
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 97.56
2ghi_A 260 Transport protein; multidrug resistance protein, M 97.56
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 97.55
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 97.55
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.5
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 97.48
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.47
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 97.46
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.46
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.45
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.45
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.44
2kjq_A149 DNAA-related protein; solution structure, NESG, st 97.44
3bos_A 242 Putative DNA replication factor; P-loop containing 97.43
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.43
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.43
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.43
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 97.42
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.42
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 97.42
1kag_A 173 SKI, shikimate kinase I; transferase, structural g 97.42
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 97.41
4a74_A 231 DNA repair and recombination protein RADA; hydrola 97.41
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 97.41
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 97.41
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.39
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.39
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.38
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 97.38
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 97.37
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 97.36
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 97.36
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 97.36
3pvs_A 447 Replication-associated recombination protein A; ma 97.35
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.35
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.35
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 97.34
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.34
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 97.33
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 97.33
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 97.33
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 97.32
2chq_A 319 Replication factor C small subunit; DNA-binding pr 97.32
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 97.31
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 97.31
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 97.31
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.3
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 97.3
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 97.3
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 97.3
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 97.29
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 97.29
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.27
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.27
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.26
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.26
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.25
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 97.25
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 97.23
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 97.22
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.21
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.21
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 97.21
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 97.21
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 97.2
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 97.2
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.2
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 97.19
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 97.19
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.17
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.17
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.17
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.17
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.17
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 97.17
2og2_A 359 Putative signal recognition particle receptor; nuc 97.16
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.15
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 97.15
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 97.14
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.13
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 97.13
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.12
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 97.12
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 97.11
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 97.1
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.09
3kta_A 182 Chromosome segregation protein SMC; structural mai 97.08
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 97.08
2hf9_A 226 Probable hydrogenase nickel incorporation protein 97.08
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.07
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.07
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.07
3co5_A143 Putative two-component system transcriptional RES 97.06
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 97.05
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.04
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 97.03
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 97.02
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 97.02
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 97.01
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 97.0
1p9r_A 418 General secretion pathway protein E; bacterial typ 97.0
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.0
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.99
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 96.99
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.99
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 96.99
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.97
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.97
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.97
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 96.96
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.96
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.95
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 96.92
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.91
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.9
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 96.9
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.9
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 96.89
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.88
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.87
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.87
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.87
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 96.86
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 96.85
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.85
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 96.83
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 96.82
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.81
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 96.81
2wji_A 165 Ferrous iron transport protein B homolog; membrane 96.81
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.81
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 96.8
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 96.8
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 96.77
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 96.76
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 96.76
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.76
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 96.75
2ewv_A 372 Twitching motility protein PILT; pilus retraction 96.75
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 96.75
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 96.74
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.74
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 96.73
2wjg_A 188 FEOB, ferrous iron transport protein B homolog; me 96.72
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 96.72
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.72
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 96.71
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 96.7
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.7
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 96.7
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 96.68
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 96.66
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.65
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.65
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.65
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.65
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.64
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 96.64
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 96.63
1xjc_A 169 MOBB protein homolog; structural genomics, midwest 96.62
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 96.62
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.62
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.62
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 96.6
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.6
2gj8_A 172 MNME, tRNA modification GTPase TRME; G-domain dime 96.6
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 96.58
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 96.58
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 96.57
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.57
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.53
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.53
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.53
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.53
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 96.53
2dyk_A 161 GTP-binding protein; GTPase, ribosome-binding prot 96.53
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.52
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.51
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.5
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 96.5
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 96.47
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.46
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.46
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.45
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.45
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.43
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 96.43
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 96.43
2ce2_X 166 GTPase HRAS; signaling protein, guanine nucleotide 96.42
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.37
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.37
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 96.36
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 96.35
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 96.35
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 96.35
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 96.35
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 96.34
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 96.34
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.33
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.33
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 96.33
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 96.32
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.32
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 96.32
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.31
2ged_A193 SR-beta, signal recognition particle receptor beta 96.3
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.3
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.29
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.28
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 96.27
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.26
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 96.25
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 96.24
1e69_A 322 Chromosome segregation SMC protein; structural mai 96.24
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 96.24
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 96.23
3q72_A 166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.23
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 96.22
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 96.22
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.22
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 96.2
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 96.18
1c1y_A 167 RAS-related protein RAP-1A; GTP-binding proteins, 96.18
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.17
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 96.16
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 96.16
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 96.16
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.16
1ek0_A 170 Protein (GTP-binding protein YPT51); vesicular tra 96.16
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.15
1kao_A 167 RAP2A; GTP-binding protein, small G protein, GDP, 96.15
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 96.15
3d3q_A 340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.14
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 96.13
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 96.13
1g16_A 170 RAS-related protein SEC4; G protein RAB, signaling 96.13
1m7b_A 184 RND3/RHOE small GTP-binding protein; small GTPase, 96.12
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.1
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 96.09
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.09
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.09
3ice_A 422 Transcription termination factor RHO; transcriptio 96.09
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.09
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 96.08
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 96.07
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 96.07
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.06
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.06
2hxs_A 178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.05
1nrj_B 218 SR-beta, signal recognition particle receptor beta 96.04
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.04
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.04
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.03
2z43_A 324 DNA repair and recombination protein RADA; archaea 96.02
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.02
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 96.02
2qgz_A 308 Helicase loader, putative primosome component; str 96.0
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 96.0
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 95.99
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.99
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 95.98
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.97
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 95.97
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 95.96
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 95.96
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 95.95
3clv_A 208 RAB5 protein, putative; malaria, GTPase, structura 95.94
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 95.93
3t5g_A 181 GTP-binding protein RHEB; immunoglobulin-like beta 95.92
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 95.92
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 95.91
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.91
3llu_A 196 RAS-related GTP-binding protein C; structural geno 95.88
2iwr_A 178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 95.88
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 95.88
3fwy_A 314 Light-independent protochlorophyllide reductase I 95.88
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 95.88
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 95.87
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 95.87
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 95.86
2cjw_A 192 GTP-binding protein GEM; nucleotide-binding, small 95.85
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.85
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 95.84
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.84
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 95.84
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.82
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 95.82
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 95.81
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.81
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 95.8
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 95.8
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 95.79
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 95.79
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 95.79
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 95.79
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 95.78
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 95.77
2fh5_B 214 SR-beta, signal recognition particle receptor beta 95.77
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 95.76
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 95.76
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 95.76
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 95.75
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.74
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 95.74
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.73
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 95.72
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 95.72
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 95.72
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 95.69
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 95.69
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 95.68
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 95.67
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 95.66
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 95.62
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 95.61
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.61
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.61
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 95.6
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.6
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 95.59
1tue_A212 Replication protein E1; helicase, replication, E1E 95.59
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 95.59
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 95.59
1wf3_A 301 GTP-binding protein; GTPase, riken structural geno 95.58
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 95.57
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 95.56
2xxa_A 433 Signal recognition particle protein; protein trans 95.55
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 94.53
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 95.54
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 95.54
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 95.54
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 95.53
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.53
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 95.52
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 95.52
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 95.5
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.5
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 95.49
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.46
3end_A 307 Light-independent protochlorophyllide reductase ir 95.46
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.45
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 95.45
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 95.44
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 95.44
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.43
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 95.41
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 95.41
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 95.41
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.4
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 95.4
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.4
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.4
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 95.38
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 95.36
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 95.36
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 95.32
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.25
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 95.24
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.21
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 95.19
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.14
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 95.14
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.11
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 95.11
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 95.08
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 95.08
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 95.07
2r6a_A 454 DNAB helicase, replicative helicase; replication, 95.04
4edh_A 213 DTMP kinase, thymidylate kinase; structural genomi 95.04
1u94_A 356 RECA protein, recombinase A; homologous recombinat 95.01
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 94.97
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 94.97
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 94.94
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.91
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 94.9
3l0o_A 427 Transcription termination factor RHO; helicase, RH 94.9
3fdi_A 201 Uncharacterized protein; cytidylate kinase like pr 94.9
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 94.86
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 94.83
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 94.8
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 94.77
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 94.71
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.67
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 94.65
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 94.62
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.61
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.6
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.56
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.56
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.53
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 94.5
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 94.31
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 94.29
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 94.24
3io5_A 333 Recombination and repair protein; storage dimer, i 94.17
1xp8_A 366 RECA protein, recombinase A; recombination, radior 94.14
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 94.07
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 94.07
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 94.01
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 94.0
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 93.98
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 93.97
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 93.82
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 93.78
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 93.76
2r8r_A 228 Sensor protein; KDPD, PFAM02702, MCSG, structural 93.73
3ch4_B 202 Pmkase, phosphomevalonate kinase; parallel beta-sh 93.73
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 93.71
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 93.69
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.68
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 93.65
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 93.61
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 93.6
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 93.57
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 93.5
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 93.48
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.47
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 93.42
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.37
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 93.37
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 93.35
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 93.28
4i1u_A 210 Dephospho-COA kinase; structural genomics, niaid, 93.22
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 93.15
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 92.96
1p6x_A 334 Thymidine kinase; P-loop, LID, transferase; HET: T 92.91
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 92.86
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 92.63
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 92.62
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 92.61
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 92.59
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 92.59
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.55
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.5
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 92.48
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 92.38
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 92.37
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 92.3
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 92.23
3cio_A 299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 92.15
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 92.12
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 92.11
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 92.06
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 92.06
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.92
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.50  E-value=2.8e-14  Score=132.60  Aligned_cols=71  Identities=15%  Similarity=0.187  Sum_probs=63.7

Q ss_pred             eecHHHHHHHHHHhcCC---cceEEEEEecCCCchhHHHHHHHh--hhccCCCCCCEEEEEEeCCCC--CHHHHHHHHh
Q 046124          166 VGLQLQLEHVWRCLEGE---SVGIVGLYGMGGVGKTTLLTHINN--KFLESPTNFNYVIWVVMSKDS--RLENIQETIG  237 (238)
Q Consensus       166 vG~~~~~~~l~~~L~~~---~~~vI~IvG~gGvGKTTLak~i~~--~~~~v~~~Fd~~~wV~vs~~~--~~~~i~~~Il  237 (238)
                      ||++.++++|..+|..+   +.++|+|+||||+||||||+.+|+  +. .+..+|+.++||++++.+  +...++++|+
T Consensus       131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~-~~~~~F~~~~wv~vs~~~~~~~~~~~~~il  208 (549)
T 2a5y_B          131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQ-LIGINYDSIVWLKDSGTAPKSTFDLFTDIL  208 (549)
T ss_dssp             CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSS-TBTTTBSEEEEEECCCCSTTHHHHHHHHHH
T ss_pred             CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhH-HHhccCCcEEEEEECCCCCCCHHHHHHHHH
Confidence            69999999999999654   678999999999999999999998  45 678999999999999986  8888888876



>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 2e-10
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 56.7 bits (136), Expect = 2e-10
 Identities = 12/83 (14%), Positives = 29/83 (34%), Gaps = 4/83 (4%)

Query: 160 PIEPTVVGLQLQLEHVWRCL---EGESVGIVGLYGMGGVGKTTLLTHI-NNKFLESPTNF 215
           P + T    +  ++ V + L          + L+G  G GK+ + +   +        N+
Sbjct: 17  PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINY 76

Query: 216 NYVIWVVMSKDSRLENIQETIGE 238
           + ++W+  S  +           
Sbjct: 77  DSIVWLKDSGTAPKSTFDLFTDI 99


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.6
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.18
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.99
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.98
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.97
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.97
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.93
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.88
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.86
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 97.84
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 97.81
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 97.79
d2awna2 232 Maltose transport protein MalK, N-terminal domain 97.65
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.63
d1g2912 240 Maltose transport protein MalK, N-terminal domain 97.63
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.62
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 97.61
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 97.61
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.6
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.59
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.59
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 97.57
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.56
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 97.56
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.56
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.55
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 97.54
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.53
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.52
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.52
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.51
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 97.51
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 97.5
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.49
d1xjca_ 165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.49
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.49
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 97.49
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 97.48
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.47
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.41
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.41
d1y63a_ 174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.37
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.37
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 97.37
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 97.36
d2iyva1 165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.34
d1viaa_ 161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.33
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 97.31
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.22
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.18
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 97.17
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 97.16
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 97.09
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 97.08
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.94
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.91
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.9
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.86
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.85
d1r8sa_ 160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.78
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.78
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.77
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.76
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.75
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.72
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.71
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 96.69
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 96.65
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.59
d1ksha_ 165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.5
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.48
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.47
d2qy9a2 211 GTPase domain of the signal recognition particle r 96.47
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.4
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.37
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.35
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.35
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 96.33
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.32
d1ls1a2 207 GTPase domain of the signal sequence recognition p 96.3
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 96.29
d1z2aa1 164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.25
d1okkd2 207 GTPase domain of the signal recognition particle r 96.25
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.24
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.21
d1g16a_ 166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.2
d1z06a1 165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 96.2
d1j8yf2 211 GTPase domain of the signal sequence recognition p 96.18
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 96.17
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.17
d1ctqa_ 166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 96.16
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 96.16
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.15
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 96.15
d2gj8a1 161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.13
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.11
d1kaoa_ 167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.1
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 96.1
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1z08a1 167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.07
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.07
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 96.04
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.03
d1zd9a1 164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.01
d2bmea1 174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.0
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.99
d2atva1 168 Ras-like estrogen-regulated growth inhibitor, RERG 95.98
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 95.97
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 95.97
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.94
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.9
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.87
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.86
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.8
d1ek0a_ 170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.79
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.76
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.74
d1c1ya_ 167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 95.73
d1xzpa2 160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 95.73
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 95.72
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 95.72
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 95.7
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.69
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.69
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 95.64
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.64
d1x1ra1 169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 95.51
d1i2ma_ 170 Ran {Human (Homo sapiens) [TaxId: 9606]} 95.51
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.39
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 95.37
d2bmja1 175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.37
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.34
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 95.28
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 95.27
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 95.14
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.1
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.02
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 94.93
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.81
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 94.62
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 94.48
d1xpua3 289 Transcription termination factor Rho, ATPase domai 94.44
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 94.43
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 94.38
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 94.11
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 93.89
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.84
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 93.74
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 93.57
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 93.49
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.41
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.41
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 93.37
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 93.11
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 93.0
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.21
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 92.02
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 91.95
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 91.9
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 91.79
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.16
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 91.15
d1tuea_205 Replication protein E1 helicase domain {Human papi 90.75
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 90.46
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 89.89
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 89.81
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 89.23
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 89.17
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 89.13
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 88.92
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 86.47
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 85.74
d1jwyb_ 306 Dynamin G domain {Dictyostelium discoideum [TaxId: 85.67
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 85.59
d1f60a3 239 Elongation factor eEF-1alpha, N-terminal (G) domai 85.14
d1r5ba3 245 Eukaryotic peptide chain release factor ERF2, G do 84.75
d2akab1 299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 84.74
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.60  E-value=1.3e-15  Score=128.07  Aligned_cols=75  Identities=16%  Similarity=0.164  Sum_probs=64.0

Q ss_pred             CCcceecHHHHHHHHHHhcC---CcceEEEEEecCCCchhHHHHHHHhhhc-cCCCCCCEEEEEEeCCCCCHHHHHHHH
Q 046124          162 EPTVVGLQLQLEHVWRCLEG---ESVGIVGLYGMGGVGKTTLLTHINNKFL-ESPTNFNYVIWVVMSKDSRLENIQETI  236 (238)
Q Consensus       162 ~~~~vG~~~~~~~l~~~L~~---~~~~vI~IvG~gGvGKTTLak~i~~~~~-~v~~~Fd~~~wV~vs~~~~~~~i~~~I  236 (238)
                      .+.+|||+.+++.|+++|.+   .+..+|+|+||||+||||||+.+|++.. ....+|++++||++++.++...+...+
T Consensus        19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~   97 (277)
T d2a5yb3          19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFT   97 (277)
T ss_dssp             CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHH
T ss_pred             CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHH
Confidence            45679999999999999853   4678999999999999999999998752 256789999999999999988776654



>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure