Citrus Sinensis ID: 046124
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| 24461863 | 889 | NBS-LRR type disease resistance protein | 0.760 | 0.203 | 0.631 | 1e-69 | |
| 24461861 | 890 | NBS-LRR type disease resistance protein | 0.794 | 0.212 | 0.624 | 1e-67 | |
| 24461864 | 899 | NBS-LRR type disease resistance protein | 0.794 | 0.210 | 0.608 | 5e-66 | |
| 24461865 | 892 | NBS-LRR type disease resistance protein | 0.798 | 0.213 | 0.621 | 8e-66 | |
| 24461866 | 890 | NBS-LRR type disease resistance protein | 0.794 | 0.212 | 0.570 | 3e-59 | |
| 255553135 | 894 | Disease resistance protein RFL1, putativ | 0.781 | 0.208 | 0.446 | 3e-40 | |
| 359482676 | 896 | PREDICTED: probable disease resistance p | 0.789 | 0.209 | 0.441 | 2e-39 | |
| 225462595 | 897 | PREDICTED: probable disease resistance p | 0.789 | 0.209 | 0.449 | 5e-39 | |
| 359483035 | 897 | PREDICTED: probable disease resistance p | 0.789 | 0.209 | 0.445 | 2e-38 | |
| 147779772 | 910 | hypothetical protein VITISV_011527 [Viti | 0.785 | 0.205 | 0.451 | 5e-38 |
| >gi|24461863|gb|AAN62350.1|AF506028_17 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
Score = 268 bits (686), Expect = 1e-69, Method: Compositional matrix adjust.
Identities = 144/228 (63%), Positives = 163/228 (71%), Gaps = 47/228 (20%)
Query: 49 NILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQ 108
NILQI+IDGA+FNRC+DCFLGKAA IRNLQ+NVVALETELGKLIEAKNDV+ARVVN ERQ
Sbjct: 3 NILQIAIDGAVFNRCMDCFLGKAAYIRNLQENVVALETELGKLIEAKNDVMARVVNTERQ 62
Query: 109 QTMTRLNKVQGWLS-------------------------------------RFGKKVAKK 131
MTRLNKVQGWLS +FGK+VAKK
Sbjct: 63 PMMTRLNKVQGWLSGVDAVKAEADELIRHGSQEIEKLCLGGYCSKNWKSSYKFGKQVAKK 122
Query: 132 LRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGESVGIVGLYG 191
LRDAGTLMA G FEVVAERAPES A VG+Q +LE VWRCL E VGIVGLYG
Sbjct: 123 LRDAGTLMAEGVFEVVAERAPESAA---------VGMQSRLEPVWRCLVEEPVGIVGLYG 173
Query: 192 MGGVGKTTLLTHINNKFL-ESPTNFNYVIWVVMSKDSRLENIQETIGE 238
MGGVGKTTLLTH+NNKFL + +F+++IWVV+SKD ++E IQE IG+
Sbjct: 174 MGGVGKTTLLTHLNNKFLGQRDFHFDFLIWVVVSKDLQIEKIQEIIGK 221
|
Source: Citrus trifoliata Species: Citrus trifoliata Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|24461861|gb|AAN62348.1|AF506028_15 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461864|gb|AAN62351.1|AF506028_18 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461865|gb|AAN62352.1|AF506028_19 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|24461866|gb|AAN62353.1|AF506028_20 NBS-LRR type disease resistance protein [Citrus trifoliata] | Back alignment and taxonomy information |
|---|
| >gi|255553135|ref|XP_002517610.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543242|gb|EEF44774.1| Disease resistance protein RFL1, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359482676|ref|XP_002281742.2| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225462595|ref|XP_002270572.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359483035|ref|XP_003632886.1| PREDICTED: probable disease resistance protein At5g63020-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147779772|emb|CAN65731.1| hypothetical protein VITISV_011527 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 238 | ||||||
| TAIR|locus:2034765 | 884 | AT1G12290 [Arabidopsis thalian | 0.483 | 0.130 | 0.382 | 1.7e-22 | |
| TAIR|locus:2132741 | 892 | AT4G10780 [Arabidopsis thalian | 0.474 | 0.126 | 0.347 | 1.9e-22 | |
| TAIR|locus:2201996 | 889 | RPS5 "AT1G12220" [Arabidopsis | 0.487 | 0.130 | 0.396 | 4.2e-22 | |
| TAIR|locus:2034770 | 894 | SUMM2 "AT1G12280" [Arabidopsis | 0.483 | 0.128 | 0.391 | 1.2e-21 | |
| TAIR|locus:2166320 | 888 | AT5G63020 [Arabidopsis thalian | 0.483 | 0.129 | 0.370 | 1.2e-21 | |
| TAIR|locus:2008510 | 967 | AT1G61190 "AT1G61190" [Arabido | 0.483 | 0.118 | 0.336 | 1.1e-20 | |
| TAIR|locus:2170892 | 848 | AT5G43730 [Arabidopsis thalian | 0.462 | 0.129 | 0.385 | 2.1e-20 | |
| TAIR|locus:2203881 | 893 | AT1G62630 [Arabidopsis thalian | 0.483 | 0.128 | 0.344 | 2.4e-20 | |
| TAIR|locus:2008440 | 899 | AT1G61180 [Arabidopsis thalian | 0.483 | 0.127 | 0.353 | 3.1e-20 | |
| TAIR|locus:2170902 | 862 | AT5G43740 [Arabidopsis thalian | 0.466 | 0.128 | 0.362 | 5.7e-20 |
| TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 202 (76.2 bits), Expect = 1.7e-22, Sum P(2) = 1.7e-22
Identities = 44/115 (38%), Positives = 62/115 (53%)
Query: 124 FGKKVAKKLRDAGTLMANGAFEVVAERAPESVADERPIEPTVVGLQLQLEHVWRCLEGES 183
+G++V L L + G FE VA A +V +ERP++PT+VG + LE W L +
Sbjct: 115 YGRRVFLMLNIVEDLKSKGIFEEVAHPATRAVGEERPLQPTIVGQETILEKAWDHLMDDG 174
Query: 184 XXXXXXXXXXXXXKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE 238
KTTLLT INN+F ++ VIWVV+S D ++ IQ+ IGE
Sbjct: 175 TKIMGLYGMGGVGKTTLLTQINNRFCDTDDGVEIVIWVVVSGDLQIHKIQKEIGE 229
|
|
| TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008510 AT1G61190 "AT1G61190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203881 AT1G62630 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008440 AT1G61180 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170902 AT5G43740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00034584001 | SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (898 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 238 | |||
| pfam00931 | 285 | pfam00931, NB-ARC, NB-ARC domain | 5e-12 |
| >gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain | Back alignment and domain information |
|---|
Score = 63.9 bits (156), Expect = 5e-12
Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 3/69 (4%)
Query: 172 LEHVWRCL--EGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRL 229
+E + L +++G+VG+ GMGGVGKTTL I N +F+ V WVV+SK
Sbjct: 5 IEALIEKLLEMSDNLGVVGIVGMGGVGKTTLAKQIYNDD-SVGGHFDSVAWVVVSKTYTE 63
Query: 230 ENIQETIGE 238
+Q+ I +
Sbjct: 64 FRLQKDILQ 72
|
Length = 285 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 99.87 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 99.38 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.11 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.09 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.79 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.78 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 98.68 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 98.64 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.55 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 98.36 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.33 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.3 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 98.15 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.1 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 98.09 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 98.09 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.03 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 98.03 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 97.95 | |
| PTZ00202 | 550 | tuzin; Provisional | 97.94 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.93 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 97.92 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.77 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 97.75 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 97.7 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 97.7 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.68 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 97.68 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.67 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.67 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.66 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 97.66 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.66 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 97.65 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 97.65 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 97.65 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.65 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 97.63 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 97.63 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 97.63 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 97.63 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 97.63 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.62 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.62 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.62 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 97.61 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 97.61 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.61 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 97.61 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 97.6 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 97.6 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 97.6 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 97.59 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 97.59 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 97.59 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.59 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 97.59 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 97.58 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 97.58 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 97.58 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 97.58 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 97.58 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 97.57 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 97.57 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 97.57 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 97.57 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 97.57 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 97.56 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 97.56 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 97.56 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 97.56 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 97.55 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 97.55 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 97.55 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 97.54 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 97.54 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 97.54 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 97.53 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 97.53 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.53 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 97.53 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.53 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 97.52 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 97.52 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 97.52 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 97.52 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 97.51 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 97.51 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 97.51 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.5 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 97.5 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 97.5 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 97.5 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 97.49 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 97.49 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 97.49 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 97.48 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 97.48 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 97.48 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 97.48 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 97.48 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.47 | |
| PRK06696 | 223 | uridine kinase; Validated | 97.46 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 97.46 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 97.46 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 97.45 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 97.45 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.45 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 97.45 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 97.45 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 97.45 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 97.44 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 97.44 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.44 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.44 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.44 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 97.44 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 97.44 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 97.44 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 97.44 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 97.43 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 97.43 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.43 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 97.43 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 97.43 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.43 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 97.43 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.42 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 97.42 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 97.42 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 97.42 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 97.42 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 97.42 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.42 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 97.41 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 97.41 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.41 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 97.41 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 97.41 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 97.41 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.4 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 97.4 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 97.4 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 97.4 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.4 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 97.4 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 97.4 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 97.39 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 97.39 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 97.39 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 97.39 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 97.39 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.39 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.39 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 97.38 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 97.38 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.38 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 97.38 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 97.38 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 97.38 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.38 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 97.38 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 97.37 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 97.37 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 97.37 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.37 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 97.37 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 97.37 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.37 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 97.36 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 97.36 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 97.36 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 97.36 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 97.36 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.36 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 97.36 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 97.35 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 97.35 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 97.35 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 97.35 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.35 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.35 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 97.34 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 97.34 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.34 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 97.34 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 97.34 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 97.34 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.34 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 97.33 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 97.33 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.33 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 97.33 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.33 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 97.33 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 97.33 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 97.32 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.32 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 97.32 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.32 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.32 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 97.32 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.32 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.32 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 97.32 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 97.32 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 97.32 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 97.31 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.31 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.31 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.31 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 97.31 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.31 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.31 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.31 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.3 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 97.29 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.29 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 97.28 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 97.28 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.28 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 97.28 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 97.28 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 97.28 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.28 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.28 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 97.28 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.28 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 97.27 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 97.27 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.27 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 97.27 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 97.27 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.27 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 97.27 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 97.27 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.26 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 97.26 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 97.26 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 97.26 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 97.25 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 97.25 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 97.25 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.25 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.25 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 97.25 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.24 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 97.24 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 97.24 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 97.24 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 97.24 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 97.23 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 97.23 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.23 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 97.23 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 97.23 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 97.22 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 97.22 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.21 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.21 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 97.21 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 97.21 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.21 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.21 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.2 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 97.2 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.2 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 97.2 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 97.19 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 97.19 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.19 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 97.19 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.19 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 97.18 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.18 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 97.18 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.18 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.18 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 97.17 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 97.17 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 97.16 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 97.16 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 97.16 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.15 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 97.15 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 97.15 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 97.15 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 97.15 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 97.14 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 97.14 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 97.14 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 97.14 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 97.14 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.14 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.13 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.13 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 97.13 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 97.12 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 97.12 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 97.12 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.12 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 97.11 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 97.11 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 97.11 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 97.11 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 97.11 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 97.11 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 97.1 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 97.1 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 97.1 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 97.09 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 97.09 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.09 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.09 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.08 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 97.08 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 97.07 | |
| PRK07667 | 193 | uridine kinase; Provisional | 97.07 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 97.07 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 97.07 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 97.07 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 97.07 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.07 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 97.06 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 97.06 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 97.06 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 97.05 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.05 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 97.05 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 97.04 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 97.04 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 97.04 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.04 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.03 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.02 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 97.02 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 97.02 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 97.02 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.02 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 97.02 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 97.01 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 97.01 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 96.99 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.99 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.99 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 96.99 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 96.99 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 96.99 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 96.98 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.97 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 96.97 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.97 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 96.96 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 96.96 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 96.96 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 96.95 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.95 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 96.94 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 96.94 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.94 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 96.93 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 96.93 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.93 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 96.92 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 96.92 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.92 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 96.92 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 96.91 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 96.9 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 96.9 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 96.9 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 96.89 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 96.89 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 96.89 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 96.89 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 96.88 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 96.88 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.88 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 96.87 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.87 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.87 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 96.86 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 96.86 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 96.85 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 96.84 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 96.83 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 96.83 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 96.82 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.82 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 96.82 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 96.82 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 96.81 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 96.81 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 96.81 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 96.8 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 96.8 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.79 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 96.79 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 96.78 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 96.78 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.78 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 96.77 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.76 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.76 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.75 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.73 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 96.73 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 96.72 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.72 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.71 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 96.71 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 96.7 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.7 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 96.69 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 96.69 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.68 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.68 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.67 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.67 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.67 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.67 | |
| PF13476 | 202 | AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V | 96.66 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 96.66 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.65 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 96.65 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 96.65 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 96.64 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.64 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.63 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.63 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 96.62 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 96.61 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 96.6 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 96.6 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.6 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 96.59 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 96.59 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.59 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 96.58 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 96.58 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.58 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 96.57 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 96.57 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 96.56 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 96.56 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 96.54 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 96.54 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.54 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 96.54 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 96.54 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 96.54 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 96.54 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 96.53 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 96.52 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 96.52 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 96.51 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 96.51 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.51 | |
| PRK08181 | 269 | transposase; Validated | 96.51 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 96.5 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 96.49 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 96.49 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.49 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 96.49 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.48 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 96.48 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 96.47 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 96.47 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 96.47 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 96.47 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 96.47 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 96.46 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 96.45 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 96.45 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.45 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 96.44 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 96.44 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 96.44 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 96.44 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 96.44 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 96.44 | |
| TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 96.43 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.43 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 96.42 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 96.42 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 96.41 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 96.41 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 96.41 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 96.41 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 96.4 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 96.4 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.4 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 96.39 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.38 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 96.38 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 96.37 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.37 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 96.37 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 96.37 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 96.37 |
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=99.87 E-value=3.3e-21 Score=187.68 Aligned_cols=179 Identities=39% Similarity=0.593 Sum_probs=126.9
Q ss_pred HhhHHHHHHHHHhhhhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh-------cccccHHHHHHHHH---------
Q 046124 60 FNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVARVVNAERQQ-------TMTRLNKVQGWLSR--------- 123 (238)
Q Consensus 60 ~~~l~~~~~~e~~~~~~~~~~~~~L~~el~~l~~~l~d~~~~~~~a~~k~-------~~~~~~~~~~Wl~~--------- 123 (238)
+.++++++.++...+.+...++..|++++..++.+++|++++...-.... ..........|+.+
T Consensus 9 ~~~~~~~l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~~~v~~~~~~~~ 88 (889)
T KOG4658|consen 9 VEKLDQLLNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWLFLVEEIERKAN 88 (889)
T ss_pred hhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 56677788888888889999999999999999999999766532111110 01223344455544
Q ss_pred ----------------------------HHHHHHHHHHHHHHHHhcCCcccccc-cCCCCCCCCCCCCCcc-eecHHHHH
Q 046124 124 ----------------------------FGKKVAKKLRDAGTLMANGAFEVVAE-RAPESVADERPIEPTV-VGLQLQLE 173 (238)
Q Consensus 124 ----------------------------~~~~~~~~i~~i~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-vG~~~~~~ 173 (238)
+++++.+.+++++....++.|..... ..+...+..+|..+.. ||.+.+++
T Consensus 89 ~~l~~~~~~~~~~c~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~~~~~~~~~~~~~~~~e~~~~~~~~~VG~e~~~~ 168 (889)
T KOG4658|consen 89 DLLSTRSVERQRLCLCGFCSKNVSDSYKYGKRVSKVLREVESLGSKGVFEVVGESLDPREKVETRPIQSESDVGLETMLE 168 (889)
T ss_pred HHhhhhHHHHHHHhhhhhHhHhhhhhHhHHHHHHHHHHHHHHhccccceecccccccchhhcccCCCCccccccHHHHHH
Confidence 12223333333333333344444432 1222234444444333 99999999
Q ss_pred HHHHHhcCCcceEEEEEecCCCchhHHHHHHHhhhccCCCCCCEEEEEEeCCCCCHHHHHHHHhC
Q 046124 174 HVWRCLEGESVGIVGLYGMGGVGKTTLLTHINNKFLESPTNFNYVIWVVMSKDSRLENIQETIGE 238 (238)
Q Consensus 174 ~l~~~L~~~~~~vI~IvG~gGvGKTTLak~i~~~~~~v~~~Fd~~~wV~vs~~~~~~~i~~~Il~ 238 (238)
.++..|.+++..+|||+||||+||||||+.|+|+...+.++||.+|||+||++|+..+|+++|++
T Consensus 169 kl~~~L~~d~~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~Fd~~iWV~VSk~f~~~~iq~~Il~ 233 (889)
T KOG4658|consen 169 KLWNRLMEDDVGIVGIYGMGGVGKTTLARQIFNKFDEVGNHFDGVIWVVVSKEFTTRKIQQTILE 233 (889)
T ss_pred HHHHHhccCCCCEEEEECCCcccHHHHHHHHhcccchhcccCceEEEEEEcccccHHhHHHHHHH
Confidence 99999999887999999999999999999999999339999999999999999999999999974
|
|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 238 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-16 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 2e-08 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 4e-05 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 3e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 76.0 bits (186), Expect = 5e-16
Identities = 34/209 (16%), Positives = 82/209 (39%), Gaps = 45/209 (21%)
Query: 47 CRNILQISIDGAIFNRCLDCFLGKAASIRNLQKNVVALETELGKLIEAKNDVVAR----- 101
++IL + D F DC ++++ K++++ E E+ +I +K+ V
Sbjct: 18 YKDILSVFEDA--FVDNFDC-----KDVQDMPKSILSKE-EIDHIIMSKDAVSGTLRLFW 69
Query: 102 VVNAERQQTMTR-----LNKVQGWLSRFGKKVAKKLRDAGTLMA------NGAFEVVAER 150
+ +++++ + + L +L + + R + + +
Sbjct: 70 TLLSKQEEMVQKFVEEVLRINYKFLM---SPIKTEQRQPSMMTRMYIEQRDRLYNDNQVF 126
Query: 151 APESVADERPIEPTVVGLQLQLEHVWRCL-EGESVGIVGLYGMGGVGKTTL-LTHINNKF 208
A +V+ +P L+L+ + L E V + G+ G GKT + L +
Sbjct: 127 AKYNVSRLQPY------LKLR-----QALLELRPAKNVLIDGVLGSGKTWVALDVCLSYK 175
Query: 209 LESPTNFNYVIWVVMSK----DSRLENIQ 233
++ +F + W+ + ++ LE +Q
Sbjct: 176 VQCKMDFK-IFWLNLKNCNSPETVLEMLQ 203
|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 99.5 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 99.19 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 98.99 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 98.89 | |
| 3qfl_A | 115 | MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- | 98.38 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 98.25 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.22 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.12 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 98.1 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 98.09 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.07 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.99 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 97.99 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.97 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 97.97 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.97 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.82 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.81 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 97.8 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.73 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 97.73 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 97.72 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.71 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 97.71 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.7 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.7 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.67 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.67 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 97.67 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 97.66 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 97.66 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 97.65 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 97.65 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 97.64 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 97.64 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 97.64 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 97.64 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 97.63 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 97.63 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 97.63 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 97.62 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 97.61 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.61 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 97.61 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 97.6 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 97.6 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 97.6 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.59 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 97.58 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.58 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 97.58 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 97.58 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.57 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.56 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.56 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.56 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 97.56 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.55 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 97.55 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.5 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 97.48 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 97.47 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.46 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.46 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.45 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.45 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 97.44 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.44 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.43 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.43 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.43 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.43 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 97.42 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.42 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.42 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.42 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 97.41 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.41 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.41 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 97.41 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.39 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 97.39 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 97.38 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 97.38 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 97.37 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 97.36 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 97.36 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 97.36 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.35 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.35 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.35 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 97.34 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.34 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.33 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.33 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 97.33 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 97.32 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.32 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 97.31 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 97.31 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.31 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.3 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.3 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.3 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.3 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 97.29 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 97.29 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.27 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.27 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.26 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.26 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.25 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.25 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.23 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 97.22 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.21 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.21 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 97.21 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.21 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.2 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.2 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.2 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.19 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.19 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 97.17 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.17 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.17 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.17 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 97.17 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.17 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.16 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 97.15 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 97.15 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.14 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 97.13 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.13 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.12 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.12 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.11 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 97.1 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.09 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.08 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.08 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 97.08 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.07 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.07 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 97.07 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 97.06 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.05 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.04 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.03 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.02 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 97.02 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.01 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.0 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.0 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.0 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.99 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.99 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.99 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.99 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.97 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.97 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.97 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 96.96 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.96 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 96.95 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.92 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.91 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.9 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 96.9 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 96.9 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.89 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.88 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.87 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.87 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.87 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 96.86 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.85 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 96.85 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 96.83 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.82 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.81 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 96.81 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.81 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.81 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.8 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 96.8 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 96.77 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 96.76 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 96.76 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.76 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.75 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.75 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.75 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 96.74 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.74 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 96.73 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 96.72 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.72 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.72 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 96.71 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.7 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 96.7 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 96.7 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.68 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 96.66 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.65 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 96.65 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.65 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.65 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 96.64 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.64 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 96.63 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 96.62 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.62 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.62 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.62 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 96.6 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.6 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.6 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 96.58 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.58 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.57 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.57 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.53 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.53 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.53 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 96.53 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.53 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.53 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 96.52 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.51 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 96.5 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 96.5 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.47 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 96.46 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.46 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 96.45 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 96.45 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.43 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 96.43 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.43 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.42 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.37 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 96.37 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 96.36 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.35 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 96.35 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.35 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 96.35 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.34 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 96.34 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.33 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 96.33 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.33 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.32 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.32 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.32 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.31 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.3 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.3 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 96.29 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 96.28 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 96.27 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.26 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 96.25 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.24 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 96.24 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 96.24 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.23 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.23 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 96.22 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 96.22 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 96.22 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 96.2 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.18 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.18 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.17 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.16 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.16 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 96.16 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 96.16 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 96.16 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.15 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.15 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 96.15 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.14 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.13 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.13 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 96.13 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 96.12 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.1 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 96.09 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 96.09 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 96.09 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 96.09 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.09 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 96.08 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 96.07 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 96.07 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.06 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 96.06 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 96.05 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.04 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.04 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 96.04 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 96.03 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 96.02 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 96.02 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 96.02 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 96.0 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.0 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 95.99 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.99 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 95.98 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.97 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 95.97 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 95.96 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 95.96 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 95.95 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 95.94 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 95.93 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 95.92 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 95.92 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.91 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 95.91 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 95.88 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 95.88 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.88 | |
| 3fwy_A | 314 | Light-independent protochlorophyllide reductase I | 95.88 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.88 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.87 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 95.87 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 95.86 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 95.85 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 95.85 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 95.84 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 95.84 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 95.84 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.82 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.82 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 95.81 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 95.81 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.8 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.8 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 95.79 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 95.79 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 95.79 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 95.79 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 95.78 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 95.77 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 95.77 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 95.76 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 95.76 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 95.76 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 95.75 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.74 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 95.74 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.73 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 95.72 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 95.72 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 95.72 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 95.69 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 95.69 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 95.68 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.67 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 95.66 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 95.62 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 95.61 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.61 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 95.61 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.6 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.6 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 95.59 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.59 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 95.59 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 95.59 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 95.58 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 95.57 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 95.56 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.55 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 94.53 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 95.54 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 95.54 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.54 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 95.53 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.53 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 95.52 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.52 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 95.5 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 95.5 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 95.49 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 95.46 | |
| 3end_A | 307 | Light-independent protochlorophyllide reductase ir | 95.46 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 95.45 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 95.45 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 95.44 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 95.44 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 95.43 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 95.41 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 95.41 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 95.41 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.4 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 95.4 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.4 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 95.4 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 95.38 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 95.36 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 95.36 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 95.32 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 95.25 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 95.24 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.21 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 95.19 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 95.14 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 95.14 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 95.11 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.11 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 95.08 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 95.08 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 95.07 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.04 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 95.04 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.01 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 94.97 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 94.97 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 94.94 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 94.91 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 94.9 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 94.9 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 94.9 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 94.86 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 94.83 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 94.8 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 94.77 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 94.71 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 94.67 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 94.65 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 94.62 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 94.61 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 94.6 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 94.56 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.56 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 94.53 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 94.5 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.31 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 94.29 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 94.24 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.17 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.14 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 94.07 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 94.07 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 94.01 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 94.0 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 93.98 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 93.97 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 93.82 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 93.78 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 93.76 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 93.73 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 93.73 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 93.71 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 93.69 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 93.68 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 93.65 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 93.61 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 93.6 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 93.57 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 93.5 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 93.48 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 93.47 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 93.42 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.37 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 93.37 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 93.35 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 93.28 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 93.22 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 93.15 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 92.96 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 92.91 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 92.86 | |
| 3fkq_A | 373 | NTRC-like two-domain protein; RER070207001320, str | 92.63 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 92.62 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 92.61 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 92.59 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 92.59 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 92.55 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 92.5 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 92.48 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 92.38 | |
| 3io3_A | 348 | DEHA2D07832P; chaperone, membrane traffic, ATPase; | 92.37 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 92.3 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 92.23 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 92.15 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 92.12 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 92.11 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 92.06 | |
| 2oze_A | 298 | ORF delta'; para, walker type atpases, DNA segrega | 92.06 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 91.92 |
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
Probab=99.50 E-value=2.8e-14 Score=132.60 Aligned_cols=71 Identities=15% Similarity=0.187 Sum_probs=63.7
Q ss_pred eecHHHHHHHHHHhcCC---cceEEEEEecCCCchhHHHHHHHh--hhccCCCCCCEEEEEEeCCCC--CHHHHHHHHh
Q 046124 166 VGLQLQLEHVWRCLEGE---SVGIVGLYGMGGVGKTTLLTHINN--KFLESPTNFNYVIWVVMSKDS--RLENIQETIG 237 (238)
Q Consensus 166 vG~~~~~~~l~~~L~~~---~~~vI~IvG~gGvGKTTLak~i~~--~~~~v~~~Fd~~~wV~vs~~~--~~~~i~~~Il 237 (238)
||++.++++|..+|..+ +.++|+|+||||+||||||+.+|+ +. .+..+|+.++||++++.+ +...++++|+
T Consensus 131 ~GR~~~~~~l~~~L~~~~~~~~~vv~I~G~gGvGKTtLA~~v~~~~~~-~~~~~F~~~~wv~vs~~~~~~~~~~~~~il 208 (549)
T 2a5y_B 131 YIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQ-LIGINYDSIVWLKDSGTAPKSTFDLFTDIL 208 (549)
T ss_dssp CCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSS-TBTTTBSEEEEEECCCCSTTHHHHHHHHHH
T ss_pred CCchHHHHHHHHHHhcccCCCceEEEEEcCCCCCHHHHHHHHHHhhhH-HHhccCCcEEEEEECCCCCCCHHHHHHHHH
Confidence 69999999999999654 678999999999999999999998 45 678999999999999986 8888888876
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 238 | ||||
| d2a5yb3 | 277 | c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor | 2e-10 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Score = 56.7 bits (136), Expect = 2e-10
Identities = 12/83 (14%), Positives = 29/83 (34%), Gaps = 4/83 (4%)
Query: 160 PIEPTVVGLQLQLEHVWRCL---EGESVGIVGLYGMGGVGKTTLLTHI-NNKFLESPTNF 215
P + T + ++ V + L + L+G G GK+ + + + N+
Sbjct: 17 PKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINY 76
Query: 216 NYVIWVVMSKDSRLENIQETIGE 238
+ ++W+ S +
Sbjct: 77 DSIVWLKDSGTAPKSTFDLFTDI 99
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 238 | |||
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 99.6 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 98.18 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.99 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.98 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.97 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.97 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.93 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.88 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 97.86 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 97.84 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.81 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.79 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.65 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.63 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 97.63 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.62 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.61 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 97.61 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 97.6 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.59 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 97.59 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 97.57 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 97.56 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 97.56 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.56 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.55 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 97.54 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.53 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 97.52 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 97.52 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.51 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 97.51 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 97.5 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.49 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.49 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.49 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 97.49 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 97.48 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.47 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.41 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.41 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.37 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.37 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 97.37 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.36 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.34 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.33 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.31 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.22 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.18 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.17 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 97.16 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 97.09 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.08 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.94 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 96.91 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.9 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.86 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.85 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.78 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.78 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.77 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 96.76 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.75 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.72 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.71 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 96.69 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.65 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.59 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.5 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 96.48 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 96.47 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.47 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.4 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.37 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.35 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.35 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.33 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.32 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.3 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 96.29 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.25 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.25 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.24 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.21 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.2 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 96.2 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.18 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 96.17 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 96.17 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 96.16 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 96.16 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 96.15 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 96.15 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 96.15 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 96.13 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.11 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 96.1 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 96.1 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 96.08 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 96.07 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.07 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 96.04 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.03 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.01 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 96.0 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 95.99 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 95.98 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 95.97 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 95.97 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 95.94 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 95.9 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 95.87 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 95.86 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.8 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.79 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 95.78 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.76 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.74 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 95.73 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 95.73 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.72 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 95.72 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 95.7 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 95.69 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 95.69 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 95.64 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 95.64 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 95.51 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 95.39 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.37 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 95.37 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 95.34 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.28 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 95.27 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 95.14 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.1 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.02 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 94.93 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 94.81 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 94.62 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 94.48 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 94.44 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 94.43 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 94.38 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 94.11 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 93.89 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 93.84 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.74 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.57 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.49 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 93.41 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.41 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 93.37 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 93.11 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 93.0 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 92.21 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 92.02 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 91.95 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 91.9 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 91.79 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 91.16 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 91.15 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 90.75 | |
| d1fx0a3 | 276 | Central domain of alpha subunit of F1 ATP synthase | 90.46 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 89.89 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 89.81 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.23 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 89.17 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.13 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 88.92 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 86.47 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 85.74 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 85.67 | |
| d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 85.59 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 85.14 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 84.75 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 84.74 |
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: CED-4, NB-ARC domain species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.60 E-value=1.3e-15 Score=128.07 Aligned_cols=75 Identities=16% Similarity=0.164 Sum_probs=64.0
Q ss_pred CCcceecHHHHHHHHHHhcC---CcceEEEEEecCCCchhHHHHHHHhhhc-cCCCCCCEEEEEEeCCCCCHHHHHHHH
Q 046124 162 EPTVVGLQLQLEHVWRCLEG---ESVGIVGLYGMGGVGKTTLLTHINNKFL-ESPTNFNYVIWVVMSKDSRLENIQETI 236 (238)
Q Consensus 162 ~~~~vG~~~~~~~l~~~L~~---~~~~vI~IvG~gGvGKTTLak~i~~~~~-~v~~~Fd~~~wV~vs~~~~~~~i~~~I 236 (238)
.+.+|||+.+++.|+++|.+ .+..+|+|+||||+||||||+.+|++.. ....+|++++||++++.++...+...+
T Consensus 19 ~~~~~gR~~~~~~i~~~L~~~~~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~vs~~~~~~~l~~~~ 97 (277)
T d2a5yb3 19 QMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFT 97 (277)
T ss_dssp CCCSCCCHHHHHHHHHHHHHHTTSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEEEECCCCSTTHHHHHHH
T ss_pred CCceeCcHHHHHHHHHHHHhccCCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEEEEecCCCCHHHHHHHH
Confidence 45679999999999999853 4678999999999999999999998752 256789999999999999988776654
|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|