Citrus Sinensis ID: 046202

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
GDLGDEQDATNSQNKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQSIHEVGG
ccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHcccccccccccccEEEEccEEEEEEcHHHHHHHHccHHHHHHcccccccccEEEEEEccccccccccHHHHHHHHHHHccccccccEEEEEEEEEEccccEEEEEEEEccccccccccccccccccccEEEEccccccEEEEEEEEEEccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccc
ccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHccHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccEEEcHHHHHHHccccccccccccEEEEccccEEEEEcHHHHHHHHccHHHHHHHcHHHHHHHcHHHHHccccccccccHEHHHHHHEEccccccccHHEEEEEEHHccccccEEEEEEEcccccccccccccccccccEEEEEcccccEEEEEEEEEEEcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccc
gdlgdeqdatnsqnkgkitchrhtTHQIQTLEAffkdcphpdenqRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKnvicpscggppfgiEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIgkpicqmnsslmpslpgsailehqnvlpppilpvhqemdigldlnlqfkgINDLEQSLMMETATNAMDELIRLMRineplwikppsstnieryvihpesyekvfpranhfktssarvesskysgmvtMNGMQLVEMLLdsdkwvdlFPTIVSKARTiqvlepgingnrngCLQLMHEQMHilsplvspreyYFLRHCQQIELGLWVIVDVsyewpkdnissshcwrlpsgfmiqdmtngcsnvtwlehvevddktqtHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQSIHEVGG
gdlgdeqdatnsqnkgkitchrHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFqnkrtqtkaqnerannsvlraenervHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEplwikppsstNIERYVIHPESYEKvfpranhfktssarvesskysGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKArtiqvlepginGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLlaensqsihevgg
GDLGDEQDATNSQNKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQSIHEVGG
******************TCHRHTTHQIQTLEAFFKDC**************LGLDLKQIKFWFQN*********************ERVHCENLAIREALKNVICPSCGGPPFG**************************NLLAKYIGKPICQMNSSLM**LPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRAN*************YSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLL************
*************************HQIQTLEAFFKDCPHPDE**RRQLSKELGLDLKQIKFWFQNKRTQT*******************************************************************************************************************DIGLDLNL***************TATNAMDELIRLMRIN**************RYVIHPESYEKVFP*************SSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWP*********WRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQS******
***************GKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFK*********KYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAE**********
*********************RHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQS******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GDLGDEQDATNSQNKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKxxxxxxxxxxxxxxxxxxxxxRVHCENLAIREALKNVICPSCGGPPFGxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAKYIGKPICQMNSSLMPSLPGSAILEHQNVLPPPILPVHQEMDIGLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCERLLAENSQSIHEVGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query448 2.2.26 [Sep-21-2011]
Q9FX31 722 Homeobox-leucine zipper p yes no 0.953 0.591 0.480 1e-117
Q69T58 710 Homeobox-leucine zipper p yes no 0.986 0.622 0.467 1e-114
Q9M9P4 699 Homeobox-leucine zipper p no no 0.953 0.610 0.451 1e-107
Q9LMT8 687 Homeobox-leucine zipper p no no 0.946 0.617 0.442 1e-106
A2YR02 749 Homeobox-leucine zipper p N/A no 0.928 0.555 0.428 4e-98
A3BPF2 749 Homeobox-leucine zipper p yes no 0.926 0.554 0.428 1e-97
Q0J9X2 784 Homeobox-leucine zipper p yes no 0.953 0.544 0.425 6e-96
Q6ZAR0 784 Homeobox-leucine zipper p no no 0.939 0.536 0.411 5e-94
Q93V99 743 Homeobox-leucine zipper p no no 0.962 0.580 0.416 2e-93
Q9FFI0 718 Homeobox-leucine zipper p no no 0.946 0.590 0.417 1e-92
>sp|Q9FX31|HDG11_ARATH Homeobox-leucine zipper protein HDG11 OS=Arabidopsis thaliana GN=HDG11 PE=1 SV=1 Back     alignment and function desciption
 Score =  422 bits (1086), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 217/452 (48%), Positives = 307/452 (67%), Gaps = 25/452 (5%)

Query: 14  NKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKA 73
           ++ K   HRHT  QIQ LE+ FK+CPHPDE QR QLS+ELGL  +QIKFWFQN+RTQ KA
Sbjct: 30  DRKKKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLKA 89

Query: 74  QNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQKLQLENSQL 133
           Q+ERA+NS L+AEN+++ CEN+AIREALK+ ICP+CGGPP   E+     QKL++EN+ L
Sbjct: 90  QHERADNSALKAENDKIRCENIAIREALKHAICPNCGGPPVS-EDPYFDEQKLRIENAHL 148

Query: 134 KEEHEKVSNLLAKYIGKPICQMNSSLMP-----------SLPGSAILEHQNVLPPPILPV 182
           +EE E++S + +KY+G+PI Q+ S+L P           SL G     H   L   +LP 
Sbjct: 149 REELERMSTIASKYMGRPISQL-STLHPMHISPLDLSMTSLTGCGPFGHGPSLDFDLLP- 206

Query: 183 HQEMDIGLDLNLQFK---GINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIE 239
              M +G + NLQ +    I+D+++ +M   A  AM+EL+RL++ NEPLW +    T+  
Sbjct: 207 GSSMAVGPNNNLQSQPNLAISDMDKPIMTGIALTAMEELLRLLQTNEPLWTR----TDGC 262

Query: 240 RYVIHPESYEKVFPR-ANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTI 298
           R +++  SYE VFPR +N  K  + RVE+S+ SG+V MN M LV+M +D  KW +LFP+I
Sbjct: 263 RDILNLGSYENVFPRSSNRGKNQNFRVEASRSSGIVFMNAMALVDMFMDCVKWTELFPSI 322

Query: 299 VSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDV 358
           ++ ++T+ V+  G+ G   G L L++E+M +LSPLV+ RE+  LR+CQQ E G W++V+V
Sbjct: 323 IAASKTLAVISSGMGGTHEGALHLLYEEMEVLSPLVATREFCELRYCQQTEQGSWIVVNV 382

Query: 359 SYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCA 418
           SY+ P+  +S S  +R PSG +IQDM NG S VTW+EH+E ++K   H LYR++I    A
Sbjct: 383 SYDLPQ-FVSHSQSYRFPSGCLIQDMPNGYSKVTWVEHIETEEKELVHELYREIIHRGIA 441

Query: 419 YGAERWVVTLQRTCERL--LAENSQSIHEVGG 448
           +GA+RWV TLQR CER   L+  + S  ++GG
Sbjct: 442 FGADRWVTTLQRMCERFASLSVPASSSRDLGG 473
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q69T58|ROC8_ORYSJ Homeobox-leucine zipper protein ROC8 OS=Oryza sativa subsp. japonica GN=ROC8 PE=2 SV=2 Back     alignment and function description
>sp|Q9M9P4|HDG8_ARATH Homeobox-leucine zipper protein HDG8 OS=Arabidopsis thaliana GN=HDG8 PE=2 SV=2 Back     alignment and function description
>sp|Q9LMT8|HDG12_ARATH Homeobox-leucine zipper protein HDG12 OS=Arabidopsis thaliana GN=HDG12 PE=2 SV=1 Back     alignment and function description
>sp|A2YR02|ROC7_ORYSI Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. indica GN=ROC7 PE=3 SV=1 Back     alignment and function description
>sp|A3BPF2|ROC7_ORYSJ Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. japonica GN=ROC7 PE=2 SV=1 Back     alignment and function description
>sp|Q0J9X2|ROC2_ORYSJ Homeobox-leucine zipper protein ROC2 OS=Oryza sativa subsp. japonica GN=ROC2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZAR0|ROC1_ORYSJ Homeobox-leucine zipper protein ROC1 OS=Oryza sativa subsp. japonica GN=ROC1 PE=2 SV=1 Back     alignment and function description
>sp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 OS=Arabidopsis thaliana GN=PDF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9FFI0|HDG9_ARATH Homeobox-leucine zipper protein HDG9 OS=Arabidopsis thaliana GN=HDG9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
449445947 706 PREDICTED: homeobox-leucine zipper prote 0.979 0.621 0.659 1e-172
225466249 714 PREDICTED: homeobox-leucine zipper prote 0.968 0.607 0.635 1e-165
224077468 682 predicted protein [Populus trichocarpa] 0.950 0.624 0.616 1e-153
224134761 676 predicted protein [Populus trichocarpa] 0.935 0.619 0.576 1e-144
147820899461 hypothetical protein VITISV_008020 [Viti 0.881 0.856 0.596 1e-139
225464265 715 PREDICTED: homeobox-leucine zipper prote 0.895 0.560 0.535 1e-131
147856728 717 hypothetical protein VITISV_009450 [Viti 0.895 0.559 0.535 1e-131
296088020 674 unnamed protein product [Vitis vinifera] 0.895 0.594 0.535 1e-131
356532435 714 PREDICTED: homeobox-leucine zipper prote 0.955 0.599 0.530 1e-129
356529444 896 PREDICTED: homeobox-leucine zipper prote 0.897 0.448 0.515 1e-129
>gi|449445947|ref|XP_004140733.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  611 bits (1576), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 298/452 (65%), Positives = 360/452 (79%), Gaps = 13/452 (2%)

Query: 5   DEQDATNSQNKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWF 64
           DEQ+A+N + KGK T HRH  +QIQ LE+FF+ CPHPDENQRRQLS+ELGL+ KQIKFWF
Sbjct: 13  DEQEASNDR-KGKKTYHRHNPYQIQQLESFFRQCPHPDENQRRQLSRELGLETKQIKFWF 71

Query: 65  QNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEERQRSLQ 124
           QNKRTQTKAQNERA+NS LR ENE++ CENLAIREAL+NVICPSCGGPPFG EERQR+LQ
Sbjct: 72  QNKRTQTKAQNERADNSSLRTENEKIQCENLAIREALRNVICPSCGGPPFGEEERQRNLQ 131

Query: 125 KLQLENSQLKEEHEKVSNLLAKYIGKPICQMNSSLMPSLPGSAILEHQN----VLPPPIL 180
           KL+LENS LKEEHEKVSNLLAKYIGKPI Q+ S L+P L  S  L  ++    ++P P +
Sbjct: 132 KLRLENSHLKEEHEKVSNLLAKYIGKPISQLES-LLPVLGSSLDLSPRSSLTQIVPSPAV 190

Query: 181 PVHQEMDI--GLDLNLQFKGINDLEQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNI 238
            +  +  I  G     Q +GINDLE +LM+ETA   ++ELIRL+RI+EPLW+K   S N 
Sbjct: 191 DLISDPVILDGAATPYQSRGINDLENALMLETAATGLEELIRLLRIDEPLWMK---SLND 247

Query: 239 ERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTI 298
            RYV+H +SYEK+FPR NHFKTSSAR ESSK  G+VTM+ +QLV+  LD+DKW DLFPTI
Sbjct: 248 GRYVLHRDSYEKIFPRPNHFKTSSARTESSKALGVVTMSAIQLVDFFLDADKWADLFPTI 307

Query: 299 VSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDV 358
           ++ A T  +++PG+ GNR+G LQLM++QMHI SPLVSPR++ FLRHCQQIE G+WVIVDV
Sbjct: 308 ITNAETFHIIDPGMPGNRSGALQLMYQQMHIFSPLVSPRDFCFLRHCQQIEFGVWVIVDV 367

Query: 359 SYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCA 418
           SYE  KD ++S+ CWRLPSG +IQ+M NGCS VTW+EHVEVDDKTQTHRLYRDL+ N  A
Sbjct: 368 SYEILKDCVTSARCWRLPSGCLIQEMPNGCSKVTWVEHVEVDDKTQTHRLYRDLVFNTLA 427

Query: 419 YGAERWVVTLQRTCERLLA--ENSQSIHEVGG 448
           YGA+RW+ TLQR CERL     +    HE+GG
Sbjct: 428 YGADRWLFTLQRMCERLAYTFRDCAPNHELGG 459

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225466249|ref|XP_002268272.1| PREDICTED: homeobox-leucine zipper protein ROC8 [Vitis vinifera] gi|297738149|emb|CBI27350.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077468|ref|XP_002305259.1| predicted protein [Populus trichocarpa] gi|222848223|gb|EEE85770.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134761|ref|XP_002327482.1| predicted protein [Populus trichocarpa] gi|222836036|gb|EEE74457.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147820899|emb|CAN60897.1| hypothetical protein VITISV_008020 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225464265|ref|XP_002271012.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147856728|emb|CAN83483.1| hypothetical protein VITISV_009450 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296088020|emb|CBI35303.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356532435|ref|XP_003534778.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] Back     alignment and taxonomy information
>gi|356529444|ref|XP_003533302.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
TAIR|locus:2206880 722 HDG11 "AT1G73360" [Arabidopsis 0.984 0.610 0.475 1.1e-108
TAIR|locus:2030913 687 HDG12 "homeodomain GLABROUS 12 0.982 0.640 0.460 1.1e-101
TAIR|locus:2097770 699 HDG8 "AT3G03260" [Arabidopsis 0.966 0.619 0.455 3.4e-100
TAIR|locus:2135368 743 PDF2 "AT4G04890" [Arabidopsis 0.962 0.580 0.416 3.6e-89
TAIR|locus:2119048 762 ATML1 "AT4G21750" [Arabidopsis 0.953 0.560 0.413 3.6e-89
TAIR|locus:2023932 708 HDG10 "AT1G34650" [Arabidopsis 0.526 0.333 0.440 1.9e-87
TAIR|locus:2167230 718 HDG9 "AT5G17320" [Arabidopsis 0.955 0.596 0.427 3.3e-86
TAIR|locus:2098866 808 HDG1 "AT3G61150" [Arabidopsis 0.966 0.535 0.413 8.9e-86
TAIR|locus:2127008 802 ANL2 "ANTHOCYANINLESS 2" [Arab 0.953 0.532 0.410 1.4e-85
TAIR|locus:2207235 721 HDG2 "AT1G05230" [Arabidopsis 0.857 0.532 0.415 5.5e-77
TAIR|locus:2206880 HDG11 "AT1G73360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1074 (383.1 bits), Expect = 1.1e-108, P = 1.1e-108
 Identities = 221/465 (47%), Positives = 312/465 (67%)

Query:     1 GDLGDEQDATNSQ-NKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQ 59
             GD G       S+ ++ K   HRHT  QIQ LE+ FK+CPHPDE QR QLS+ELGL  +Q
Sbjct:    16 GDGGGSHHHDGSETDRKKKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQ 75

Query:    60 IKFWFQNKRTQTKAQNERANNSVLRAENERVHCENLAIREALKNVICPSCGGPPFGIEER 119
             IKFWFQN+RTQ KAQ+ERA+NS L+AEN+++ CEN+AIREALK+ ICP+CGGPP   E+ 
Sbjct:    76 IKFWFQNRRTQLKAQHERADNSALKAENDKIRCENIAIREALKHAICPNCGGPPVS-EDP 134

Query:   120 QRSLQKLQLENSQLKEEHEKVSNLLAKYIGKPICQMN-------SSL---MPSLPGSAIL 169
                 QKL++EN+ L+EE E++S + +KY+G+PI Q++       S L   M SL G    
Sbjct:   135 YFDEQKLRIENAHLREELERMSTIASKYMGRPISQLSTLHPMHISPLDLSMTSLTGCGPF 194

Query:   170 EHQNVLPPPILPVHQEMDIGLDLNLQFK---GINDLEQSLMMETATNAMDELIRLMRINE 226
              H   L   +LP    M +G + NLQ +    I+D+++ +M   A  AM+EL+RL++ NE
Sbjct:   195 GHGPSLDFDLLP-GSSMAVGPNNNLQSQPNLAISDMDKPIMTGIALTAMEELLRLLQTNE 253

Query:   227 PLWIKPPSSTNIERYVIHPESYEKVFPRA-NHFKTSSARVESSKYSGMVTMNGMQLVEML 285
             PLW +    T+  R +++  SYE VFPR+ N  K  + RVE+S+ SG+V MN M LV+M 
Sbjct:   254 PLWTR----TDGCRDILNLGSYENVFPRSSNRGKNQNFRVEASRSSGIVFMNAMALVDMF 309

Query:   286 LDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHC 345
             +D  KW +LFP+I++ ++T+ V+  G+ G   G L L++E+M +LSPLV+ RE+  LR+C
Sbjct:   310 MDCVKWTELFPSIIAASKTLAVISSGMGGTHEGALHLLYEEMEVLSPLVATREFCELRYC 369

Query:   346 QQIELGLWVIVDVSYEWPKDNISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQT 405
             QQ E G W++V+VSY+ P+  +S S  +R PSG +IQDM NG S VTW+EH+E ++K   
Sbjct:   370 QQTEQGSWIVVNVSYDLPQF-VSHSQSYRFPSGCLIQDMPNGYSKVTWVEHIETEEKELV 428

Query:   406 HRLYRDLICNNCAYGAERWVVTLQRTCERL--LAENSQSIHEVGG 448
             H LYR++I    A+GA+RWV TLQR CER   L+  + S  ++GG
Sbjct:   429 HELYREIIHRGIAFGADRWVTTLQRMCERFASLSVPASSSRDLGG 473
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM;IEA;ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0010091 "trichome branching" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2030913 HDG12 "homeodomain GLABROUS 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097770 HDG8 "AT3G03260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2023932 HDG10 "AT1G34650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167230 HDG9 "AT5G17320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
cd08875229 cd08875, START_ArGLABRA2_like, C-terminal lipid-bi 1e-104
pfam01852205 pfam01852, START, START domain 5e-32
smart00234205 smart00234, START, in StAR and phosphatidylcholine 5e-25
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-16
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-16
smart0038957 smart00389, HOX, Homeodomain 8e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 9e-10
cd00177193 cd00177, START, Lipid-binding START domain of mamm 2e-05
pfam0592040 pfam05920, Homeobox_KN, Homeobox KN domain 3e-04
>gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information 
 Score =  308 bits (792), Expect = e-104
 Identities = 118/233 (50%), Positives = 161/233 (69%), Gaps = 7/233 (3%)

Query: 204 QSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSA 263
           +S ++E A  AMDEL++L +  EPLWIK   S  ++  +++P+ YE++FPR    K    
Sbjct: 1   KSGLLELAEEAMDELLKLAQGGEPLWIK---SPGMKPEILNPDEYERMFPRHGGSKPGGF 57

Query: 264 RVESSKYSGMVTMNGMQLVEMLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLM 323
             E+S+  G+V MN ++LVE+L+D +KW +LFP IVSKA+T+QV+  G  GNRNG LQLM
Sbjct: 58  TTEASRACGLVMMNAIKLVEILMDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLM 117

Query: 324 HEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWPKDN---ISSSHCWRLPSGFM 380
           + ++ + SPLV  RE+YFLR+C+Q+E GLW +VDVS +  +      S   C RLPSG +
Sbjct: 118 YAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQTAPPPASFVRCRRLPSGCL 177

Query: 381 IQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCE 433
           IQDM NG S VTW+EHVEVD+K   H LYR L+ +  A+GA RWV TLQR CE
Sbjct: 178 IQDMPNGYSKVTWVEHVEVDEKP-VHLLYRYLVSSGLAFGATRWVATLQRQCE 229

This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. Length = 229
>gnl|CDD|216740 pfam01852, START, START domain Back     alignment and domain information
>gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>gnl|CDD|203350 pfam05920, Homeobox_KN, Homeobox KN domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 448
cd08875229 START_ArGLABRA2_like C-terminal lipid-binding STAR 100.0
PF01852206 START: START domain; InterPro: IPR002913 START (St 99.74
smart00234206 START in StAR and phosphatidylcholine transfer pro 99.74
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.64
KOG0488309 consensus Transcription factor BarH and related HO 99.57
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.57
KOG0843197 consensus Transcription factor EMX1 and related HO 99.55
KOG0489261 consensus Transcription factor zerknullt and relat 99.49
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.49
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.47
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.47
KOG0850245 consensus Transcription factor DLX and related pro 99.46
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.45
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.44
KOG0494332 consensus Transcription factor CHX10 and related H 99.4
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.4
KOG0848317 consensus Transcription factor Caudal, contains HO 99.37
cd00177193 START Lipid-binding START domain of mammalian STAR 99.32
KOG0493342 consensus Transcription factor Engrailed, contains 99.31
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.28
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.28
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.27
COG5576156 Homeodomain-containing transcription factor [Trans 99.26
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.17
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.16
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.15
cd08871222 START_STARD10-like Lipid-binding START domain of m 99.13
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 99.1
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.1
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.09
KOG0847288 consensus Transcription factor, contains HOX domai 99.07
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 99.02
cd08904204 START_STARD6-like Lipid-binding START domain of ma 98.89
KOG0490235 consensus Transcription factor, contains HOX domai 98.83
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.74
KOG0849354 consensus Transcription factor PRD and related pro 98.6
cd08909205 START_STARD13-like C-terminal lipid-binding START 98.6
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.57
cd08905209 START_STARD1-like Cholesterol-binding START domain 98.56
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.55
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 98.46
KOG0775304 consensus Transcription factor SIX and related HOX 98.4
cd08906209 START_STARD3-like Cholesterol-binding START domain 98.34
cd08902202 START_STARD4-like Lipid-binding START domain of ma 98.25
cd08908204 START_STARD12-like C-terminal lipid-binding START 98.23
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 97.99
cd08910207 START_STARD2-like Lipid-binding START domain of ma 97.98
cd08874205 START_STARD9-like C-terminal START domain of mamma 97.98
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 97.91
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.89
cd08870209 START_STARD2_7-like Lipid-binding START domain of 97.89
KOG0774334 consensus Transcription factor PBX and related HOX 97.86
cd08907205 START_STARD8-like C-terminal lipid-binding START d 97.72
KOG2252558 consensus CCAAT displacement protein and related h 97.6
cd08911207 START_STARD7-like Lipid-binding START domain of ma 97.55
KOG0490235 consensus Transcription factor, contains HOX domai 97.4
cd08873235 START_STARD14_15-like Lipid-binding START domain o 97.35
cd08872235 START_STARD11-like Ceramide-binding START domain o 97.33
cd08913240 START_STARD14-like Lipid-binding START domain of m 96.9
cd08914236 START_STARD15-like Lipid-binding START domain of m 96.82
KOG11461406 consensus Homeobox protein [General function predi 95.88
KOG0773342 consensus Transcription factor MEIS1 and related H 95.47
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.69
KOG4196135 consensus bZIP transcription factor MafK [Transcri 92.23
PRK09413121 IS2 repressor TnpA; Reviewed 91.62
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 91.55
KOG2761219 consensus START domain-containing proteins involve 89.41
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 89.38
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 88.98
cd08864208 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- 88.44
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 87.97
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 85.74
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 85.24
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 85.05
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 84.71
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 84.15
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 82.39
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 82.1
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 81.97
PRK10724158 hypothetical protein; Provisional 81.6
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 81.33
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 81.13
PRK1542279 septal ring assembly protein ZapB; Provisional 80.59
smart0033865 BRLZ basic region leucin zipper. 80.41
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 80.2
>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information 
Probab=100.00  E-value=1.5e-94  Score=693.71  Aligned_cols=226  Identities=52%  Similarity=0.915  Sum_probs=218.4

Q ss_pred             HHHHHHHHHHHHHHHHHhhccCCCCcccCCCCCCCCccccChhhhcccCCCCCCCCCCCCeeeeecceeeEEechhhHHH
Q 046202          204 QSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLVE  283 (448)
Q Consensus       204 k~~~~~lA~~am~El~~la~~~~plWi~~~~~~~~~~e~ln~~~y~~~f~~~~~~~~~~~~~easR~~~~V~~~~~~lve  283 (448)
                      |++|++||++||+||++||++++|||++++++   ++|+||+|||.++|++..+.++.||++||||+||+|+||+.+|||
T Consensus         1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~---~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe   77 (229)
T cd08875           1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGM---KPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVE   77 (229)
T ss_pred             ChHHHHHHHHHHHHHHHHhccCCCCceecCCC---CccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHH
Confidence            46899999999999999999999999999976   789999999999999999999999999999999999999999999


Q ss_pred             HhcChhhhhhhcccccccceEeEEecCCCCCCCCCceeeehhhhhccCccccCceeEEEEeeeeecCCeEEEEEEecCCC
Q 046202          284 MLLDSDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHEQMHILSPLVSPREYYFLRHCQQIELGLWVIVDVSYEWP  363 (448)
Q Consensus       284 ~lmD~~~W~~~Fp~iVs~a~t~~vi~~g~~g~~~g~lqlm~~e~~v~SPlvp~Re~~flRyc~q~~~g~w~vvDvS~d~~  363 (448)
                      +|||+++|.++||+||++|+|++||++|++|++||+|||||+|||+||||||+|||||||||+|++||+|||||||+|+.
T Consensus        78 ~lmD~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~  157 (229)
T cd08875          78 ILMDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGV  157 (229)
T ss_pred             HHhChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCC---CCCcccccCCccceeeeCCCCcceEEEEEeeeecCcCccchhhccccccccccchhhHHHHHHHHHH
Q 046202          364 KDN---ISSSHCWRLPSGFMIQDMTNGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTCE  433 (448)
Q Consensus       364 ~~~---~~~~~~~r~PSGclIq~~~ng~skVtwveH~e~d~~~~v~~l~r~l~~sg~afGA~RW~~~l~R~ce  433 (448)
                      +..   ..++||+|+|||||||||+|||||||||||+|||++ .+|.+||++++||+||||+||+++||||||
T Consensus       158 ~~~p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~-~~~~l~~~l~~sg~AfgA~rw~a~lqRqce  229 (229)
T cd08875         158 QTAPPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEK-PVHLLYRYLVSSGLAFGATRWVATLQRQCE  229 (229)
T ss_pred             ccCCCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCC-cccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence            421   237899999999999999999999999999999999 999999999999999999999999999997

This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells.
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 9e-05
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-04
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 2e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-04
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 4e-04
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 4e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 6e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 6e-04
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 32/49 (65%)
Query: 24 TTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTK 72
          ++ Q+  L+  F +  +  E +R+QLS ELGL+  QIK WFQNKR + K
Sbjct: 11 SSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIK 59
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-19
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-16
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 3e-16
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-16
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-15
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 8e-14
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-13
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-12
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 1e-11
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-11
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-10
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-10
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-09
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 4e-09
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-09
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 8e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-08
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-08
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 7e-08
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 8e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 9e-08
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-07
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-07
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-07
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-07
1uhs_A72 HOP, homeodomain only protein; structural genomics 6e-07
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 7e-07
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-07
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-07
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 1e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-06
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-06
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 3e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-06
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-06
2e19_A64 Transcription factor 8; homeobox domain, structura 3e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-06
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 5e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 6e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 8e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-05
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 4e-05
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 4e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-05
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 7e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 9e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 9e-05
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 1e-04
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 2e-04
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 2e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-04
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 4e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 4e-04
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 5e-04
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 5e-04
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 6e-04
2pso_A237 STAR-related lipid transfer protein 13; alpha and 6e-04
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 7e-04
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 81.1 bits (200), Expect = 2e-19
 Identities = 15/71 (21%), Positives = 31/71 (43%)

Query: 11 NSQNKGKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQ 70
          +S + G          Q++ LE+ F   P P + +  +L  E  +  ++I  WF  +R +
Sbjct: 2  SSGSSGPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWFSERRKK 61

Query: 71 TKAQNERANNS 81
            A+  + +  
Sbjct: 62 VNAEETKKSGP 72
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Length = 258 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 99.84
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.67
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.66
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.65
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.65
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.65
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.65
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.64
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.64
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.64
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.64
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.63
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.63
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.63
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.63
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.63
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.63
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.62
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.62
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.62
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.62
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.62
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.62
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.61
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.61
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.61
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.61
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.61
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.6
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.6
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.6
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.6
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.6
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.59
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.59
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.59
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.59
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.59
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.58
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.58
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.58
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.57
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.57
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.57
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.56
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.56
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.56
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.55
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.55
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.55
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.53
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.53
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.53
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.52
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.52
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.5
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.5
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.49
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.49
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.49
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.49
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.48
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.48
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.48
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.47
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.47
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.46
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.46
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.44
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.43
2e19_A64 Transcription factor 8; homeobox domain, structura 99.42
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.41
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.37
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 99.25
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 99.23
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.2
2pso_A237 STAR-related lipid transfer protein 13; alpha and 99.15
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.07
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.03
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.98
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.95
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 98.86
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 98.82
3qsz_A189 STAR-related lipid transfer protein; structural ge 98.63
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 98.39
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.31
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 95.72
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 88.21
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 87.7
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 87.21
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.28
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 85.42
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.38
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 84.28
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 84.11
2wt7_B90 Transcription factor MAFB; transcription, transcri 84.01
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 83.19
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 81.15
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 80.69
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 80.46
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=2.3e-20  Score=177.31  Aligned_cols=200  Identities=15%  Similarity=0.148  Sum_probs=156.0

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccCCCCcccCCCCCCCCccccChhhhcccCCCCCCCCCCCCeeeeecceeeEEechhhHH
Q 046202          203 EQSLMMETATNAMDELIRLMRINEPLWIKPPSSTNIERYVIHPESYEKVFPRANHFKTSSARVESSKYSGMVTMNGMQLV  282 (448)
Q Consensus       203 ~k~~~~~lA~~am~El~~la~~~~plWi~~~~~~~~~~e~ln~~~y~~~f~~~~~~~~~~~~~easR~~~~V~~~~~~lv  282 (448)
                      +++.+.++|++||+||+++++. +..|....+.           ++.++|.+..    .+....+.|..|+|.+++.+|+
T Consensus        20 ~~~~y~~~a~~~~~~~l~~~~~-~~~W~~~~~~-----------~gv~v~~~~~----~~~~~~~~k~~~~v~~~~~~v~   83 (231)
T 2r55_A           20 FQSMAAQMSEAVAEKMLQYRRD-TAGWKICREG-----------NGVSVSWRPS----VEFPGNLYRGEGIVYGTLEEVW   83 (231)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHC-CSSCEEEECC-----------SSEEEEEEEC----SSSSSEEEEEEEEESSCHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHhcC-CCCCEEEEeC-----------CCEEEEEEcc----CCCCCcEEEEEEEECCCHHHHH
Confidence            4678999999999999999965 4689764321           1223343322    1223478899999999999999


Q ss_pred             HHhcC-----hhhhhhhcccccccceEeEEecCCCCCCCCCceeeehh-hhhccCccccCceeEEEEeeeeecCCeEEEE
Q 046202          283 EMLLD-----SDKWVDLFPTIVSKARTIQVLEPGINGNRNGCLQLMHE-QMHILSPLVSPREYYFLRHCQQIELGLWVIV  356 (448)
Q Consensus       283 e~lmD-----~~~W~~~Fp~iVs~a~t~~vi~~g~~g~~~g~lqlm~~-e~~v~SPlvp~Re~~flRyc~q~~~g~w~vv  356 (448)
                      +.||+     ..+|-..|...    ++|+.|+..        -.++|. ....++++|++|||.++||+++.++|.|+|+
T Consensus        84 ~~l~~~d~~~r~~Wd~~~~~~----~vle~i~~~--------~~i~~~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~  151 (231)
T 2r55_A           84 DCVKPAVGGLRVKWDENVTGF----EIIQSITDT--------LCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSN  151 (231)
T ss_dssp             HHHCC--CCSHHHHCTTCSEE----EEEEECSSS--------EEEEEEECCCBTTTTBCCEEEEEEEEEEECTTSCEEEE
T ss_pred             HHHHhhCcchhhhhcccccee----EEEEEcCCC--------EEEEEEEeccccCCccCCCeEEEEEEEEEcCCCEEEEE
Confidence            99977     88998887644    888888631        123442 2234567999999999999999999999999


Q ss_pred             EEecCCCC--CCCCCcccccCCccceeeeCC--CCcceEEEEEeeeecCcCccchhhccccccccccchhhHHHHHHHHH
Q 046202          357 DVSYEWPK--DNISSSHCWRLPSGFMIQDMT--NGCSNVTWLEHVEVDDKTQTHRLYRDLICNNCAYGAERWVVTLQRTC  432 (448)
Q Consensus       357 DvS~d~~~--~~~~~~~~~r~PSGclIq~~~--ng~skVtwveH~e~d~~~~v~~l~r~l~~sg~afGA~RW~~~l~R~c  432 (448)
                      ..|++...  +...++|+..++|||+|++++  +|.|+|||+.|++..-+  +|   +.+++++++.++-+|++.|+++|
T Consensus       152 ~~Sv~~~~~P~~~~~VR~~~~~~g~~i~p~~~~~~~t~vt~~~~~Dp~G~--iP---~~lvn~~~~~~~~~~~~~Lr~~~  226 (231)
T 2r55_A          152 ATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGY--LP---QNVVDSFFPRSMTRFYANLQKAV  226 (231)
T ss_dssp             EEECCCTTSCCCTTCEEEEECSEEEEEEECC--CCCEEEEEEECEECCSS--CC---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEeccCCCCCCCCCCEEEEEEeeEEEEEEeCCCCCcEEEEEEEEeCCCCC--cc---HHHHHHHHhHhHHHHHHHHHHHH
Confidence            99998532  112379999999999999998  78999999999998866  33   57888999999999999999999


Q ss_pred             HHH
Q 046202          433 ERL  435 (448)
Q Consensus       433 er~  435 (448)
                      +.+
T Consensus       227 ~~~  229 (231)
T 2r55_A          227 KQF  229 (231)
T ss_dssp             HGG
T ss_pred             HHh
Confidence            853
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 448
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-14
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 6e-14
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 7e-14
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 4e-13
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-12
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 6e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-11
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-11
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 5e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 7e-11
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-11
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-11
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 8e-11
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-10
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-10
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-10
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-10
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 7e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-09
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-09
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-09
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 4e-09
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 4e-07
d1jssa_199 d.129.3.2 (A:) Cholesterol-regulated Start protein 3e-04
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: ZF-HD homeobox protein At4g24660
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 66.6 bits (162), Expect = 1e-14
 Identities = 13/75 (17%), Positives = 26/75 (34%), Gaps = 4/75 (5%)

Query: 4  GDEQDATNSQNKGKITCHRHTTHQIQTLEAFFKDC----PHPDENQRRQLSKELGLDLKQ 59
              + ++S    K    + T  Q + + AF +         D+    Q   E G+  + 
Sbjct: 5  SSGSNPSSSGGTTKRFRTKFTAEQKEKMLAFAERLGWRIQKHDDVAVEQFCAETGVRRQV 64

Query: 60 IKFWFQNKRTQTKAQ 74
          +K W  N +    + 
Sbjct: 65 LKIWMHNNKNSGPSS 79
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.71
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.71
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.7
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.7
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.69
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.68
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.68
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.68
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.67
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.66
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.65
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.65
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.64
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.63
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.63
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.61
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.61
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.59
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.59
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.58
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.57
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.55
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.54
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.5
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.46
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.43
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.39
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.39
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.38
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.31
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.99
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 98.65
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 98.47
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 98.38
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 93.63
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 90.92
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 84.68
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeotic bicoid protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.71  E-value=1.4e-18  Score=135.20  Aligned_cols=63  Identities=30%  Similarity=0.431  Sum_probs=58.4

Q ss_pred             CCCCCCCCCHHHHHHHHHhHhcCCCCCHHHHHHHHHHhCCCcceeeeeccccchHHhHHhHHh
Q 046202           16 GKITCHRHTTHQIQTLEAFFKDCPHPDENQRRQLSKELGLDLKQIKFWFQNKRTQTKAQNERA   78 (448)
Q Consensus        16 ~Kr~rtr~T~eQl~~LE~~F~~~~~Ps~~~R~~LA~~LgLs~rQVkvWFQNRRaK~Kr~~~r~   78 (448)
                      +||+|++||.+|+..||..|+.++||+..++.+||..|||+++||++||||||+|+|++....
T Consensus         1 Prr~Rt~ft~~Ql~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~~V~iWFqNrR~k~kk~~~~~   63 (67)
T d1zq3p1           1 PRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQH   63 (67)
T ss_dssp             CSCCSCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCcCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCCccceeeccccHHHhHhhhhhhc
Confidence            356788999999999999999999999999999999999999999999999999999866544
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure