Citrus Sinensis ID: 046299


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYPRE
ccEEEcccccccEEccccccccccHHHHHccccccEEccHHccccccccEEEccccEEEEEEcccccccccccEEEccccccccccccccccccccEEEEEcccccccccHHHHHHccccccEEEccccccEEccccc
ccEEEEcccccccccccccccccHHHHHHHHHHHccccccHHHHHHcccEEEccccEEEEEEccccccccEEEEEEEcccccccccccHHHcccccccHccHHHHHcHHHHHHHHHHccccEEEEccccccccccccc
mkdlfvgnnrlngtltkasdsfpsfsfWTSLIILRKLAGDIITNLSRLAHMDLSFdlrtfnfssgwippfqlntiilgsckmgpgfpnpipemphdvLISSFQQYVFRVDIYFQQYVSQSWTIIDlginkfsgqypre
mkdlfvgnnrlngtltkasdsfpsFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYPRE
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYPRE
************GTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKF*******
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYP**
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYPRE
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFS*QY***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILRKLAGDIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISSFQQYVFRVDIYFQQYVSQSWTIIDLGINKFSGQYPRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query138
302143751 550 unnamed protein product [Vitis vinifera] 0.615 0.154 0.413 4e-08
359490164 1198 PREDICTED: LRR receptor-like serine/thre 0.608 0.070 0.413 5e-08
147812512 986 hypothetical protein VITISV_015942 [Viti 0.623 0.087 0.391 2e-07
359489995 867 PREDICTED: probable LRR receptor-like se 0.615 0.098 0.397 2e-07
357519389 938 Receptor-like kinase [Medicago truncatul 0.615 0.090 0.373 3e-07
224105895 963 predicted protein [Populus trichocarpa] 0.630 0.090 0.370 3e-07
359490572 975 PREDICTED: probable LRR receptor-like se 0.615 0.087 0.402 3e-07
147855809 1107 hypothetical protein VITISV_029207 [Viti 0.673 0.084 0.363 4e-07
302143729 641 unnamed protein product [Vitis vinifera] 0.615 0.132 0.402 4e-07
224115848 884 predicted protein [Populus trichocarpa] 0.594 0.092 0.375 4e-07
>gi|302143751|emb|CBI22612.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 62.8 bits (151), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (56%), Gaps = 7/92 (7%)

Query: 1   MKDLFVGNNRLNGTLTKASDSFPSFSF----WTSLIILRKLAGDIITNLSRLAHMDLSFD 56
           +  L +G N+LNG L ++             W SL     ++   + NLS+L H DL+F+
Sbjct: 77  LTRLELGYNQLNGNLPESIAQLSQLQVLNMPWNSL--QGTVSEAHLFNLSKLQHFDLAFN 134

Query: 57  -LRTFNFSSGWIPPFQLNTIILGSCKMGPGFP 87
            L T NFSS W+P FQL  I+L SCK+GP FP
Sbjct: 135 SLLTLNFSSDWVPQFQLTEILLASCKLGPRFP 166




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490164|ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147812512|emb|CAN72773.1| hypothetical protein VITISV_015942 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359489995|ref|XP_003634011.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357519389|ref|XP_003629983.1| Receptor-like kinase [Medicago truncatula] gi|355524005|gb|AET04459.1| Receptor-like kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|224105895|ref|XP_002333753.1| predicted protein [Populus trichocarpa] gi|222838401|gb|EEE76766.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147855809|emb|CAN79130.1| hypothetical protein VITISV_029207 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143729|emb|CBI22590.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224115848|ref|XP_002332072.1| predicted protein [Populus trichocarpa] gi|222831958|gb|EEE70435.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

No hits with e-value below 0.001 by BLAST


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 138
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.79
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.78
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.58
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.52
PLN03150623 hypothetical protein; Provisional 99.48
KOG0617264 consensus Ras suppressor protein (contains leucine 99.45
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.42
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.41
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.39
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.34
PLN03150623 hypothetical protein; Provisional 99.32
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.28
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.27
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.26
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.24
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.24
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.23
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.22
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.22
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.19
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.13
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.12
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.12
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
KOG4237498 consensus Extracellular matrix protein slit, conta 98.99
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.98
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.94
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.94
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.81
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.59
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 98.45
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.43
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.37
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.31
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.23
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 98.21
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.21
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.19
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.12
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.05
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.66
PRK15386 426 type III secretion protein GogB; Provisional 97.65
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.64
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.6
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.54
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.42
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.24
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.21
PRK15386 426 type III secretion protein GogB; Provisional 97.13
KOG1644 233 consensus U2-associated snRNP A' protein [RNA proc 96.99
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.88
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.35
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.17
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.09
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.53
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.18
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.76
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 94.7
smart0037026 LRR Leucine-rich repeats, outliers. 94.15
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.15
KOG0473 326 consensus Leucine-rich repeat protein [Function un 92.49
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 92.1
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.74
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.82
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.23
KOG3864221 consensus Uncharacterized conserved protein [Funct 86.57
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.79  E-value=3.3e-19  Score=148.08  Aligned_cols=133  Identities=23%  Similarity=0.248  Sum_probs=84.5

Q ss_pred             CcEEEccCccccCcCCccccCCCCCCCccEEEccc-cccc---ccccCCCCCCEEEcccCccceeCCCCCccccCcceEE
Q 046299            1 MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILR-KLAG---DIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTII   76 (138)
Q Consensus         1 L~~L~Ls~N~l~~~~p~~~~~l~~~~~L~~L~Ls~-~l~~---~~~~~l~~L~~L~ls~N~l~~~~~~~~~~~~~L~~L~   76 (138)
                      |++|++++|.+++.+|..++.+   ++|++|++++ .+.+   ..|+++++|++|++++|.+++.+|..+..+.+|++|+
T Consensus       142 L~~L~Ls~n~~~~~~p~~~~~l---~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        142 LETLDLSNNMLSGEIPNDIGSF---SSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             CCEEECcCCcccccCChHHhcC---CCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            4556666666666666666666   7777777766 6655   4566667777777777766666666666666666777


Q ss_pred             ecCCcCCCCCCCCCCCCCC--eEEec------------cCCCceeEEEeeCCccc---------CCCCcEEEccCCeeee
Q 046299           77 LGSCKMGPGFPNPIPEMPH--DVLIS------------SFQQYVFRVDIYFQQYV---------SQSWTIIDLGINKFSG  133 (138)
Q Consensus        77 l~~n~l~~~~p~~~~~l~~--~L~ls------------~~l~~L~~L~ls~N~l~---------~~~L~~L~Ls~N~l~g  133 (138)
                      +++|++++.+|..++.+++  +|+++            +.+++|++|++++|+++         .++|+.|++++|.++|
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~  298 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSG  298 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeecc
Confidence            7666666666666666665  55555            34455666666666654         2455666666666655


Q ss_pred             cCC
Q 046299          134 QYP  136 (138)
Q Consensus       134 ~iP  136 (138)
                      .+|
T Consensus       299 ~~p  301 (968)
T PLN00113        299 EIP  301 (968)
T ss_pred             CCC
Confidence            554



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query138
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 37.2 bits (87), Expect = 9e-04
 Identities = 26/163 (15%), Positives = 49/163 (30%), Gaps = 34/163 (20%)

Query: 4   LFVGNNRLNGTLTKASDSFPSFSFWTSLIILR----KLAGDI---ITNLSRLAHMDLS-- 54
           + + NNRL G +              +L IL+      +G+I   + +   L  +DL+  
Sbjct: 495 ISLSNNRLTGEIP------KWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 548

Query: 55  -------------FDLRTFNFSSGWIPPFQLNTIILGSCKMGPGFPNPIPEMPHDVLISS 101
                              NF +G    +  N  +   C                +   S
Sbjct: 549 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 608

Query: 102 FQQYVFRVDIYFQQYVSQSW------TIIDLGINKFSGQYPRE 138
            +         +  + S ++        +D+  N  SG  P+E
Sbjct: 609 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKE 651


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.86
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.83
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.83
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.82
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.81
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.81
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.81
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.8
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.8
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.8
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.8
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.79
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.79
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.79
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.78
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.78
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.78
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.78
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.77
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.77
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.76
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.76
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.76
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.75
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.75
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.75
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.74
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.74
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.73
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.72
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.71
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.7
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.69
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.69
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.69
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.68
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.68
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.65
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.64
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.61
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.57
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.56
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.55
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.54
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.47
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.46
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.46
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.43
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.28
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.1
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.02
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.93
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.78
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.76
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.63
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.33
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.7
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.3
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.23
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.95
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.94
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.92
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 81.1
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.89  E-value=4.3e-23  Score=166.52  Aligned_cols=134  Identities=19%  Similarity=0.186  Sum_probs=99.1

Q ss_pred             CcEEEccCccccCcCCccccCCCCCCCccEEEccc-cccc---ccccCCCCCCEEEcccCccceeCCCCCc---------
Q 046299            1 MKDLFVGNNRLNGTLTKASDSFPSFSFWTSLIILR-KLAG---DIITNLSRLAHMDLSFDLRTFNFSSGWI---------   67 (138)
Q Consensus         1 L~~L~Ls~N~l~~~~p~~~~~l~~~~~L~~L~Ls~-~l~~---~~~~~l~~L~~L~ls~N~l~~~~~~~~~---------   67 (138)
                      |++|++++|++++.+|.+++.+   ++|++|++++ ++++   ..++.+++|++|++++|+++|.+|..+.         
T Consensus       492 L~~L~L~~N~l~~~~p~~~~~l---~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~  568 (768)
T 3rgz_A          492 LNWISLSNNRLTGEIPKWIGRL---ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAAN  568 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGGC---TTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCS
T ss_pred             CCEEEccCCccCCcCChHHhcC---CCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhh
Confidence            4566777777766667777766   7777777777 6665   5667777777777777777665554321         


Q ss_pred             -------------------------------------------------------------cccCcceEEecCCcCCCCC
Q 046299           68 -------------------------------------------------------------PPFQLNTIILGSCKMGPGF   86 (138)
Q Consensus        68 -------------------------------------------------------------~~~~L~~L~l~~n~l~~~~   86 (138)
                                                                                   .+.+|++|++++|+++|.+
T Consensus       569 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~i  648 (768)
T 3rgz_A          569 FIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYI  648 (768)
T ss_dssp             TTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCC
T ss_pred             ccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccC
Confidence                                                                         2345777888888888888


Q ss_pred             CCCCCCCCC--eEEec------------cCCCceeEEEeeCCccc---------CCCCcEEEccCCeeeecCCC
Q 046299           87 PNPIPEMPH--DVLIS------------SFQQYVFRVDIYFQQYV---------SQSWTIIDLGINKFSGQYPR  137 (138)
Q Consensus        87 p~~~~~l~~--~L~ls------------~~l~~L~~L~ls~N~l~---------~~~L~~L~Ls~N~l~g~iP~  137 (138)
                      |.+++.++.  +|+++            +.+++|++||+++|+++         .+.|++||+++|+++|.||.
T Consensus       649 p~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          649 PKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             CHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            888887777  78877            56778889999999888         36788999999999999885



>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query138
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.74
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.66
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.65
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.6
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.58
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.53
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.53
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.37
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.23
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.06
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.97
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.95
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.88
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.88
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.82
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.26
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.15
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.88  E-value=7.2e-23  Score=147.74  Aligned_cols=134  Identities=16%  Similarity=0.328  Sum_probs=98.6

Q ss_pred             CcEEEccC-ccccCcCCccccCCCCCCCccEEEccc-cccc---ccccCCCCCCEEEcccCccceeCCCCCccccCcceE
Q 046299            1 MKDLFVGN-NRLNGTLTKASDSFPSFSFWTSLIILR-KLAG---DIITNLSRLAHMDLSFDLRTFNFSSGWIPPFQLNTI   75 (138)
Q Consensus         1 L~~L~Ls~-N~l~~~~p~~~~~l~~~~~L~~L~Ls~-~l~~---~~~~~l~~L~~L~ls~N~l~~~~~~~~~~~~~L~~L   75 (138)
                      |++|+|++ |+++|.+|++|+++   ++|++|++++ ++.+   ..+..+.+|+++++++|.+.+.+|..+..+.+++++
T Consensus        78 L~~L~Ls~~N~l~g~iP~~i~~L---~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l  154 (313)
T d1ogqa_          78 LNFLYIGGINNLVGPIPPAIAKL---TQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGI  154 (313)
T ss_dssp             CSEEEEEEETTEESCCCGGGGGC---TTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEE
T ss_pred             ccccccccccccccccccccccc---cccchhhhccccccccccccccchhhhcccccccccccccCchhhccCccccee
Confidence            56777775 67777777777777   7777777777 7776   446666677777777777666677777777777788


Q ss_pred             EecCCcCCCCCCCCCCCCCC---eEEec----------------------------------------------------
Q 046299           76 ILGSCKMGPGFPNPIPEMPH---DVLIS----------------------------------------------------  100 (138)
Q Consensus        76 ~l~~n~l~~~~p~~~~~l~~---~L~ls----------------------------------------------------  100 (138)
                      ++++|.+++.+|..+..+..   .++++                                                    
T Consensus       155 ~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~  234 (313)
T d1ogqa_         155 TFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLA  234 (313)
T ss_dssp             ECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEEC
T ss_pred             eccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            88888777777776555443   33332                                                    


Q ss_pred             ------cCCCceeEEEeeCCccc---------CCCCcEEEccCCeeeecCCC
Q 046299          101 ------SFQQYVFRVDIYFQQYV---------SQSWTIIDLGINKFSGQYPR  137 (138)
Q Consensus       101 ------~~l~~L~~L~ls~N~l~---------~~~L~~L~Ls~N~l~g~iP~  137 (138)
                            ..++++++|++++|+++         .++|++|||++|+|+|.||.
T Consensus       235 ~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~  286 (313)
T d1ogqa_         235 FDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ  286 (313)
T ss_dssp             CBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC
T ss_pred             ccccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC
Confidence                  34678889999999887         47899999999999998885



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure