Citrus Sinensis ID: 046331

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MDVDKDNPQDEVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRTGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCLHG
ccccccccHHHHHHHHHHHHHHcHHHHHHHHccEEEEccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHcccEEEEcccccccccccEEEEccc
ccccccccccHHEEHHEHHEcccHHHHHHHHHccEEEEEEEccccccccEEEcccccccccccccccccccccEEEEEEEcEcccccccccccEEEEEccccHHHcHHHHHcccccccEEEcccccccEEEEEEEccccccccccccccccccccccHcHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHccEEEEEEcccccccccEEEEEccc
mdvdkdnpqdeVSMLRFCKITLSWDYFRLVKESCVYGrlalsggtcnscsfgnrmqdadlwpnrclppnpplevEFVLFHKLASMypelmsssqlafispYRHQVKQFQEWFKETFGELVDMTTTDGCQIirawchpsseagnytareiegsqmshtsstaagkrgkdvsfsrtgkKKQISEMLLMMHDATTVGVDLITISIGhahalnfsdesisigsfhamkngiltsnsagnrgprtdQLLVCLHG
mdvdkdnpqdevsmLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSqmshtsstaagkrgkdvsfsrtGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGIltsnsagnrgprtDQLLVCLHG
MDVDKDNPQDEVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRTGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCLHG
************SMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHP********************************************EMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGIL*********************
**********EVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQ**FISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRTGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCL**
**********EVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREI***************************KKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCLHG
*****DNPQDEVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSS***************SHTSSTAAGKRGKDVSFSRTGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCLHG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVDKDNPQDEVSMLRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRTGKKKQISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRTDQLLVCLHG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
B6SFA4818 Probable helicase MAGATAM yes no 0.228 0.069 0.603 2e-13
Q39547 731 Cucumisin OS=Cucumis melo N/A no 0.333 0.113 0.386 3e-09
Q9LLL8 749 Xylem serine proteinase 1 no no 0.120 0.040 0.666 0.0002
>sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 Back     alignment and function desciption
 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (74%), Gaps = 6/63 (9%)

Query: 73  EVEFVL--FHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFG----ELVDMTTTD 126
           EVEFVL  +H+L +MYPEL SSSQLA ISPY +QVK F++ FKE FG    ++VD+ T D
Sbjct: 623 EVEFVLLIYHRLVTMYPELKSSSQLAIISPYNYQVKTFKDRFKEMFGTEAEKVVDINTVD 682

Query: 127 GCQ 129
           G Q
Sbjct: 683 GFQ 685
Probable helicase that may regulate RNA molecules involved in nucleolar organization and pollen tube guidance.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q39547|CUCM1_CUCME Cucumisin OS=Cucumis melo PE=1 SV=1 Back     alignment and function description
>sp|Q9LLL8|XSP1_ARATH Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
147846613 668 hypothetical protein VITISV_010797 [Viti 0.437 0.163 0.396 5e-13
359478633 740 PREDICTED: cucumisin [Vitis vinifera] 0.437 0.147 0.396 6e-13
297746066 703 unnamed protein product [Vitis vinifera] 0.437 0.155 0.396 6e-13
224140843 565 predicted protein [Populus trichocarpa] 0.228 0.100 0.619 3e-12
2244913 555 SEN1 like protein [Arabidopsis thaliana] 0.236 0.106 0.584 3e-12
225461912 831 PREDICTED: probable helicase DDB_G027439 0.228 0.068 0.619 7e-12
296089913332 unnamed protein product [Vitis vinifera] 0.228 0.171 0.619 1e-11
42566850 818 protein MAGATAMA 3 [Arabidopsis thaliana 0.228 0.069 0.603 1e-11
255558936 2072 peptidase, putative [Ricinus communis] g 0.433 0.052 0.392 3e-11
296084074 656 unnamed protein product [Vitis vinifera] 0.373 0.141 0.391 5e-11
>gi|147846613|emb|CAN81645.1| hypothetical protein VITISV_010797 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 70/131 (53%), Gaps = 22/131 (16%)

Query: 129 QIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRTGKKKQ--------- 179
           +II A  + S  + + TAR+ EG   +HT+STAAG   K  SF   GK            
Sbjct: 105 KIIGARVYNSMISPDNTARDSEG-HGTHTASTAAGSVVKGASFYGVGKGDARGGVPSARI 163

Query: 180 ------------ISEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGI 227
                       +++++    DA + GVD+IT+S+G A AL    +SI IG+FHAM  GI
Sbjct: 164 AVYKVCYETGCTVADVMAAFDDAISDGVDIITVSLGAAAALPLDSDSIGIGAFHAMAKGI 223

Query: 228 LTSNSAGNRGP 238
           LT NSAGN GP
Sbjct: 224 LTLNSAGNNGP 234

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359478633|ref|XP_002280951.2| PREDICTED: cucumisin [Vitis vinifera] Back     alignment and taxonomy information
>gi|297746066|emb|CBI16122.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140843|ref|XP_002323788.1| predicted protein [Populus trichocarpa] gi|222866790|gb|EEF03921.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|2244913|emb|CAB10335.1| SEN1 like protein [Arabidopsis thaliana] gi|7268305|emb|CAB78599.1| SEN1 like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225461912|ref|XP_002265434.1| PREDICTED: probable helicase DDB_G0274399-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296089913|emb|CBI39732.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42566850|ref|NP_193292.3| protein MAGATAMA 3 [Arabidopsis thaliana] gi|384950687|sp|B6SFA4.1|MAA3_ARATH RecName: Full=Probable helicase MAGATAMA 3; AltName: Full=SEN1-like protein gi|209574484|gb|ACI63222.1| MAA3 [Arabidopsis thaliana] gi|332658227|gb|AEE83627.1| protein MAGATAMA 3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255558936|ref|XP_002520491.1| peptidase, putative [Ricinus communis] gi|223540333|gb|EEF41904.1| peptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296084074|emb|CBI24462.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
TAIR|locus:2130384818 MAA3 "MAGATAMA 3" [Arabidopsis 0.228 0.069 0.603 3.1e-14
TAIR|locus:2168434 732 SBT4.13 "AT5G59120" [Arabidops 0.236 0.080 0.583 1.7e-10
TAIR|locus:2153291 736 SBT4.12 "AT5G59090" [Arabidops 0.405 0.137 0.437 5.4e-09
TAIR|locus:2102792 738 AT3G46840 "AT3G46840" [Arabido 0.224 0.075 0.517 2.1e-08
TAIR|locus:2168444 732 AT5G59130 "AT5G59130" [Arabido 0.409 0.139 0.392 2.9e-08
TAIR|locus:2144583 766 AT5G03620 "AT5G03620" [Arabido 0.224 0.073 0.561 7.3e-08
TAIR|locus:2168524 693 AT5G59190 "AT5G59190" [Arabido 0.228 0.082 0.491 7.5e-08
TAIR|locus:2154528 713 AT5G58840 "AT5G58840" [Arabido 0.409 0.143 0.389 2.1e-07
TAIR|locus:2102807 736 AT3G46850 "AT3G46850" [Arabido 0.224 0.076 0.464 3.2e-07
TAIR|locus:2153296 741 AT5G59100 "AT5G59100" [Arabido 0.228 0.076 0.473 7.6e-07
TAIR|locus:2130384 MAA3 "MAGATAMA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 3.1e-14, Sum P(2) = 3.1e-14
 Identities = 38/63 (60%), Positives = 47/63 (74%)

Query:    73 EVEFVL--FHKLASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFG----ELVDMTTTD 126
             EVEFVL  +H+L +MYPEL SSSQLA ISPY +QVK F++ FKE FG    ++VD+ T D
Sbjct:   623 EVEFVLLIYHRLVTMYPELKSSSQLAIISPYNYQVKTFKDRFKEMFGTEAEKVVDINTVD 682

Query:   127 GCQ 129
             G Q
Sbjct:   683 GFQ 685
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0009553 "embryo sac development" evidence=IMP
GO:0009875 "pollen-pistil interaction" evidence=IMP
GO:0010183 "pollen tube guidance" evidence=IMP
TAIR|locus:2168434 SBT4.13 "AT5G59120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153291 SBT4.12 "AT5G59090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102792 AT3G46840 "AT3G46840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168444 AT5G59130 "AT5G59130" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144583 AT5G03620 "AT5G03620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168524 AT5G59190 "AT5G59190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154528 AT5G58840 "AT5G58840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102807 AT3G46850 "AT3G46850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153296 AT5G59100 "AT5G59100" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024311001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (703 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd04852307 cd04852, Peptidases_S8_3, Peptidase S8 family doma 6e-14
pfam13087195 pfam13087, AAA_12, AAA domain 6e-04
>gnl|CDD|173795 cd04852, Peptidases_S8_3, Peptidase S8 family domain, uncharacterized subfamily 3 Back     alignment and domain information 
 Score = 69.5 bits (171), Expect = 6e-14
 Identities = 31/109 (28%), Positives = 43/109 (39%), Gaps = 25/109 (22%)

Query: 155 SHTSSTAAGKRGKDVSFSRTGKKKQISEM-----------------------LLMMHDAT 191
           +HT+STAAG    + S          S +                       L  +  A 
Sbjct: 112 THTASTAAGNVVVNASVGGFAFG-TASGVAPRARIAVYKVCWPDGGCFGSDILAAIDQAI 170

Query: 192 TVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPRT 240
             GVD+I+ SIG      + D  I+I   HA++ GI  + SAGN GP  
Sbjct: 171 ADGVDVISYSIGGGSPDPYED-PIAIAFLHAVEAGIFVAASAGNSGPGA 218

This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values. Length = 307
>gnl|CDD|221913 pfam13087, AAA_12, AAA domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
cd04852307 Peptidases_S8_3 Peptidase S8 family domain, unchar 99.96
cd07478 455 Peptidases_S8_CspA-like Peptidase S8 family domain 99.9
PTZ00262 639 subtilisin-like protease; Provisional 99.89
cd07479 255 Peptidases_S8_SKI-1_like Peptidase S8 family domai 99.89
cd07483291 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 fa 99.88
cd07475 346 Peptidases_S8_C5a_Peptidase Peptidase S8 family do 99.87
cd07476 267 Peptidases_S8_thiazoline_oxidase_subtilisin-like_p 99.85
cd04857 412 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptid 99.85
cd05562 275 Peptidases_S53_like Peptidase domain in the S53 fa 99.85
cd07497 311 Peptidases_S8_14 Peptidase S8 family domain, uncha 99.85
cd07485273 Peptidases_S8_Fervidolysin_like Peptidase S8 famil 99.84
cd07480 297 Peptidases_S8_12 Peptidase S8 family domain, uncha 99.84
cd07487 264 Peptidases_S8_1 Peptidase S8 family domain, unchar 99.84
cd07473259 Peptidases_S8_Subtilisin_like Peptidase S8 family 99.84
cd07496285 Peptidases_S8_13 Peptidase S8 family domain, uncha 99.83
cd07489 312 Peptidases_S8_5 Peptidase S8 family domain, unchar 99.83
cd07491247 Peptidases_S8_7 Peptidase S8 family domain, unchar 99.83
cd07498242 Peptidases_S8_15 Peptidase S8 family domain, uncha 99.82
cd05561239 Peptidases_S8_4 Peptidase S8 family domain, unchar 99.82
cd07474 295 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 fam 99.82
cd07494 298 Peptidases_S8_10 Peptidase S8 family domain, uncha 99.82
cd07481264 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 99.82
cd07484260 Peptidases_S8_Thermitase_like Peptidase S8 family 99.81
cd07493261 Peptidases_S8_9 Peptidase S8 family domain, unchar 99.81
cd07482 294 Peptidases_S8_Lantibiotic_specific_protease Peptid 99.8
cd04842 293 Peptidases_S8_Kp43_protease Peptidase S8 family do 99.8
cd07490 254 Peptidases_S8_6 Peptidase S8 family domain, unchar 99.79
cd04843 277 Peptidases_S8_11 Peptidase S8 family domain, uncha 99.77
cd07477229 Peptidases_S8_Subtilisin_subset Peptidase S8 famil 99.77
cd04848267 Peptidases_S8_Autotransporter_serine_protease_like 99.77
cd07492222 Peptidases_S8_8 Peptidase S8 family domain, unchar 99.76
cd04077255 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 99.76
cd04059297 Peptidases_S8_Protein_convertases_Kexins_Furin-lik 99.75
cd04847 291 Peptidases_S8_Subtilisin_like_2 Peptidase S8 famil 99.73
PF00082 282 Peptidase_S8: Subtilase family This is family S8 i 99.68
KOG1153 501 consensus Subtilisin-related protease/Vacuolar pro 99.63
cd00306241 Peptidases_S8_S53 Peptidase domain in the S8 and S 99.57
KOG1114 1304 consensus Tripeptidyl peptidase II [Posttranslatio 99.57
KOG4266 1033 consensus Subtilisin kexin isozyme-1/site 1 protea 99.52
cd07488 247 Peptidases_S8_2 Peptidase S8 family domain, unchar 99.5
COG1404 508 AprE Subtilisin-like serine proteases [Posttransla 99.25
cd04056 361 Peptidases_S53 Peptidase domain in the S53 family. 98.48
PF13087200 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP 97.62
KOG1803649 consensus DNA helicase [Replication, recombination 97.31
KOG18051100 consensus DNA replication helicase [Replication, r 97.1
KOG3526 629 consensus Subtilisin-like proprotein convertase [P 96.81
KOG1801827 consensus tRNA-splicing endonuclease positive effe 96.24
TIGR00376637 DNA helicase, putative. The gene product may repre 95.97
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 95.78
COG1112767 Superfamily I DNA and RNA helicases and helicase s 94.17
KOG18071025 consensus Helicases [Replication, recombination an 93.24
KOG1804775 consensus RNA helicase [RNA processing and modific 84.02
>cd04852 Peptidases_S8_3 Peptidase S8 family domain, uncharacterized subfamily 3 Back     alignment and domain information 
Probab=99.96  E-value=1.4e-29  Score=229.79  Aligned_cols=183  Identities=28%  Similarity=0.372  Sum_probs=134.7

Q ss_pred             hhcccccCccccc-------------cccceEEEEecCCCCCCCCCCccCCCCC--CCCCCCCCCCCCCCcchhHHHHHH
Q 046331           17 FCKITLSWDYFRL-------------VKESCVYGRLALSGGTCNSCSFGNRMQD--ADLWPNRCLPPNPPLEVEFVLFHK   81 (249)
Q Consensus        17 ~~~tt~sw~~l~l-------------~g~gviigvi~dtGi~~~~~sf~~~~~~--~~~w~g~c~~~~n~~ea~~~~~~k   81 (249)
                      +|||||+|+|+|+             .|+|++|+|| ||||+++||.|.+....  +..|++.|..+....-  ..+++|
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~~G~gv~VaVi-DtGid~~hp~f~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~k   78 (307)
T cd04852           2 QLHTTRSPDFLGLPGAWGGSLLGAANAGEGIIIGVL-DTGIWPEHPSFADVGGGPYPHTWPGDCVTGEDFNP--FSCNNK   78 (307)
T ss_pred             CccccCCHHHcCCCCCCCcccccccCCCCccEEEEE-eCCCCCCCcCcccCCCCCCCCCCCCcccCCCCcCc--cCcCCe
Confidence            3789999998886             3899999999 99999999999987433  7889999988653211  112445


Q ss_pred             hhhcCcccccCCcceeecchhHHHHHHHHHHHHhcCCceeccccCcccccccccCCCCCCCCCCccccCCCcccchhhcc
Q 046331           82 LASMYPELMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTA  161 (249)
Q Consensus        82 Li~~~~~~~~~~~igvItPy~~Qv~~l~~~~~~~~G~~vdi~t~DgfqG~~~~~~~~~~~~~~~~~D~~GH~GThvA~i~  161 (249)
                      +++.+...                                    ++......   ...+.+..++.|..|| |||||||+
T Consensus        79 i~g~~~~~------------------------------------~~~~~~~~---~~~~~~~~~~~d~~gH-GT~VAgii  118 (307)
T cd04852          79 LIGARYFS------------------------------------DGYDAYGG---FNSDGEYRSPRDYDGH-GTHTASTA  118 (307)
T ss_pred             EEEEEEcc------------------------------------cchhhccC---cccccCCCCCccCCCC-chhhhhhh
Confidence            44422100                                    00000000   0123345678899999 99999999


Q ss_pred             ccccCCC--------CCcccccCCCcH--------------HHHHHHHHHHHHCCCcEEEeccCCCCCCcchhhHHHHHH
Q 046331          162 AGKRGKD--------VSFSRTGKKKQI--------------SEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGS  219 (249)
Q Consensus       162 ag~~~~~--------~~~~G~a~~~ri--------------~~i~~ai~~Ai~~gvdVI~~SlG~~~~~~~~~~~i~~~~  219 (249)
                      ||+...+        ..+.|+||+++|              +++++||++|+++|++|||||||.... ..+.+.+..++
T Consensus       119 ag~~~~~~~~~~~~~~~~~GvAP~a~l~~~kv~~~~~~~~~~~~~~ai~~a~~~g~~Vin~S~G~~~~-~~~~~~~~~~~  197 (307)
T cd04852         119 AGNVVVNASVGGFAFGTASGVAPRARIAVYKVCWPDGGCFGSDILAAIDQAIADGVDVISYSIGGGSP-DPYEDPIAIAF  197 (307)
T ss_pred             cCCCcccccccccccccEEEECCCCeEEEEEEecCCCCccHHHHHHHHHHHHHcCCCEEEeCCCCCCC-CcccCHHHHHH
Confidence            9986532        346799999965              789999999999999999999998742 34556777788


Q ss_pred             HHHHhCCcEEEEcCCCCCCCCCce
Q 046331          220 FHAMKNGILTSNSAGNRGPRTDQL  243 (249)
Q Consensus       220 ~~a~~~Gi~Vv~aAGN~Gp~~~tv  243 (249)
                      +.+.++|++||+||||+|+...+.
T Consensus       198 ~~a~~~gilvV~aAGN~g~~~~~~  221 (307)
T cd04852         198 LHAVEAGIFVAASAGNSGPGASTV  221 (307)
T ss_pred             HHHHhCCCEEEEECCCCCCCCCcc
Confidence            889999999999999999765543

This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
>cd07478 Peptidases_S8_CspA-like Peptidase S8 family domain in CspA-like proteins Back     alignment and domain information
>PTZ00262 subtilisin-like protease; Provisional Back     alignment and domain information
>cd07479 Peptidases_S8_SKI-1_like Peptidase S8 family domain in SKI-1-like proteins Back     alignment and domain information
>cd07483 Peptidases_S8_Subtilisin_Novo-like Peptidase S8 family domain in Subtilisin_Novo-like proteins Back     alignment and domain information
>cd07475 Peptidases_S8_C5a_Peptidase Peptidase S8 family domain in Streptococcal C5a peptidases Back     alignment and domain information
>cd07476 Peptidases_S8_thiazoline_oxidase_subtilisin-like_protease Peptidase S8 family domain in Thiazoline oxidase/subtilisin-like proteases Back     alignment and domain information
>cd04857 Peptidases_S8_Tripeptidyl_Aminopeptidase_II Peptidase S8 family domain in Tripeptidyl aminopeptidases_II Back     alignment and domain information
>cd05562 Peptidases_S53_like Peptidase domain in the S53 family Back     alignment and domain information
>cd07497 Peptidases_S8_14 Peptidase S8 family domain, uncharacterized subfamily 14 Back     alignment and domain information
>cd07485 Peptidases_S8_Fervidolysin_like Peptidase S8 family domain in Fervidolysin Back     alignment and domain information
>cd07480 Peptidases_S8_12 Peptidase S8 family domain, uncharacterized subfamily 12 Back     alignment and domain information
>cd07487 Peptidases_S8_1 Peptidase S8 family domain, uncharacterized subfamily 1 Back     alignment and domain information
>cd07473 Peptidases_S8_Subtilisin_like Peptidase S8 family domain in Subtilisin-like proteins Back     alignment and domain information
>cd07496 Peptidases_S8_13 Peptidase S8 family domain, uncharacterized subfamily 13 Back     alignment and domain information
>cd07489 Peptidases_S8_5 Peptidase S8 family domain, uncharacterized subfamily 5 Back     alignment and domain information
>cd07491 Peptidases_S8_7 Peptidase S8 family domain, uncharacterized subfamily 7 Back     alignment and domain information
>cd07498 Peptidases_S8_15 Peptidase S8 family domain, uncharacterized subfamily 15 Back     alignment and domain information
>cd05561 Peptidases_S8_4 Peptidase S8 family domain, uncharacterized subfamily 4 Back     alignment and domain information
>cd07474 Peptidases_S8_subtilisin_Vpr-like Peptidase S8 family domain in Vpr-like proteins Back     alignment and domain information
>cd07494 Peptidases_S8_10 Peptidase S8 family domain, uncharacterized subfamily 10 Back     alignment and domain information
>cd07481 Peptidases_S8_BacillopeptidaseF-like Peptidase S8 family domain in BacillopeptidaseF-like proteins Back     alignment and domain information
>cd07484 Peptidases_S8_Thermitase_like Peptidase S8 family domain in Thermitase-like proteins Back     alignment and domain information
>cd07493 Peptidases_S8_9 Peptidase S8 family domain, uncharacterized subfamily 9 Back     alignment and domain information
>cd07482 Peptidases_S8_Lantibiotic_specific_protease Peptidase S8 family domain in Lantiobiotic (lanthionine-containing antibiotics) specific proteases Back     alignment and domain information
>cd04842 Peptidases_S8_Kp43_protease Peptidase S8 family domain in Kp43 proteases Back     alignment and domain information
>cd07490 Peptidases_S8_6 Peptidase S8 family domain, uncharacterized subfamily 6 Back     alignment and domain information
>cd04843 Peptidases_S8_11 Peptidase S8 family domain, uncharacterized subfamily 11 Back     alignment and domain information
>cd07477 Peptidases_S8_Subtilisin_subset Peptidase S8 family domain in Subtilisin proteins Back     alignment and domain information
>cd04848 Peptidases_S8_Autotransporter_serine_protease_like Peptidase S8 family domain in Autotransporter serine proteases Back     alignment and domain information
>cd07492 Peptidases_S8_8 Peptidase S8 family domain, uncharacterized subfamily 8 Back     alignment and domain information
>cd04077 Peptidases_S8_PCSK9_ProteinaseK_like Peptidase S8 family domain in ProteinaseK-like proteins Back     alignment and domain information
>cd04059 Peptidases_S8_Protein_convertases_Kexins_Furin-like Peptidase S8 family domain in Protein convertases Back     alignment and domain information
>cd04847 Peptidases_S8_Subtilisin_like_2 Peptidase S8 family domain in Subtilisin-like proteins Back     alignment and domain information
>PF00082 Peptidase_S8: Subtilase family This is family S8 in the peptidase classification Back     alignment and domain information
>KOG1153 consensus Subtilisin-related protease/Vacuolar protease B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00306 Peptidases_S8_S53 Peptidase domain in the S8 and S53 families Back     alignment and domain information
>KOG1114 consensus Tripeptidyl peptidase II [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4266 consensus Subtilisin kexin isozyme-1/site 1 protease, subtilase superfamily [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07488 Peptidases_S8_2 Peptidase S8 family domain, uncharacterized subfamily 2 Back     alignment and domain information
>COG1404 AprE Subtilisin-like serine proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04056 Peptidases_S53 Peptidase domain in the S53 family Back     alignment and domain information
>PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG3526 consensus Subtilisin-like proprotein convertase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1807 consensus Helicases [Replication, recombination and repair] Back     alignment and domain information
>KOG1804 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
3vta_A 621 Crystal Structure Of Cucumisin, A Subtilisin-Like E 2e-10
3i6s_A 649 Crystal Structure Of The Plant Subtilisin-Like Prot 2e-07
>pdb|3VTA|A Chain A, Crystal Structure Of Cucumisin, A Subtilisin-Like Endoprotease From Cucumis Melo L Length = 621 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 59/106 (55%), Gaps = 23/106 (21%)
Query: 155 SHTSSTAAG---------------KRGKDVSFSRTGKKK-------QISEMLLMMHDATT 192
           +HT+STAAG                RG  V  +R    K         +++L    DA  
Sbjct: 96  THTASTAAGGLVSQANLYGLGLGTARGG-VPLARIAAYKVCWNDGCSDTDILAAYDDAIA 154
Query: 193 VGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGP 238
            GVD+I++S+G A+  ++  ++I+IGSFHA++ GILTSNSAGN GP
Sbjct: 155 DGVDIISLSVGGANPRHYFVDAIAIGSFHAVERGILTSNSAGNGGP 200
>pdb|3I6S|A Chain A, Crystal Structure Of The Plant Subtilisin-Like Protease Sbt3 Length = 649 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
3vta_A 621 Cucumisin; subtilisin-like fold, serine protease, 2e-16
3i6s_A 649 Subtilisin-like protease; PA-domain, FN3-domain, h 9e-14
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Length = 621 Back     alignment and structure
 Score = 77.4 bits (190), Expect = 2e-16
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 21/105 (20%)

Query: 155 SHTSSTAAGKRGKDVSFSRTGKKKQ---------------------ISEMLLMMHDATTV 193
           +HT+STAAG      +    G                          +++L    DA   
Sbjct: 96  THTASTAAGGLVSQANLYGLGLGTARGGVPLARIAAYKVCWNDGCSDTDILAAYDDAIAD 155

Query: 194 GVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGP 238
           GVD+I++S+G A+  ++  ++I+IGSFHA++ GILTSNSAGN GP
Sbjct: 156 GVDIISLSVGGANPRHYFVDAIAIGSFHAVERGILTSNSAGNGGP 200
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Length = 649 Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Length = 926 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3vta_A 621 Cucumisin; subtilisin-like fold, serine protease, 100.0
3i6s_A 649 Subtilisin-like protease; PA-domain, FN3-domain, h 100.0
1xf1_A 926 C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {St 99.93
4h6x_A 357 Thiazoline oxidase/subtilisin-like protease; hydro 99.89
3t41_A 471 Epidermin leader peptide processing serine protea; 99.88
1dbi_A 280 AK.1 serine protease; hydrolase; 1.80A {Bacillus S 99.88
3afg_A 539 Subtilisin-like serine protease; propeptide, therm 99.88
3zxy_A 282 Subtilisin-like protein; hydrolase; 1.58A {Prochlo 99.88
1thm_A 279 Thermitase; hydrolase(serine protease); 1.37A {The 99.87
2ixt_A 310 36KDA protease; serine protease, sphericase, subti 99.87
1to2_E 281 Subtilisin BPN'; serine protease, hydrolase; HET: 99.87
2z2z_A 395 TK-subtilisin precursor; thermococcus kodakaraensi 99.87
2x8j_A 327 Intracellular subtilisin protease; hydrolase, seri 99.86
1r0r_E 274 Subtilisin carlsberg; high resolution, serine prot 99.86
2z30_A 320 TK-subtilisin; thermococcus kodakaraensis, hydrola 99.86
1y9z_A 441 Alkaline serine protease; subtilisin-like alpha/be 99.86
3lpc_A 340 APRB2; protease, subtilase, virulence factor, hydr 99.86
1gci_A 269 Subtilisin; hydrolase, serine protease; 0.78A {Bac 99.86
2iy9_A 347 SUBA; toxin, shiga, plasmid; 1.8A {Escherichia col 99.85
1p8j_A 471 Furin precursor; prohormone convertase, SPC1, PACE 99.84
1sh7_A 284 Extracellular subtilisin-like serine proteinase; c 99.84
4dzt_A 276 Aqualysin-1, aqualysin-I; serine protease, calcium 99.83
4h6w_A 306 N-terminal cyanobactin protease; hydrolase; 2.45A 99.83
2b6n_A 278 Proteinase K; S binding, substrate specificity, pr 99.83
1r6v_A 671 Subtilisin-like serine protease; sandwich domain, 99.83
2pwa_A 279 Proteinase K; structure, alanine boronic acid, hyd 99.82
3f7m_A 279 Alkaline serine protease VER112; verticillium psal 99.82
1wmd_A 434 Protease; alpha-beta hydrolase fold, jelly-roll be 99.81
2id4_A 503 Kexin; KEX2, kexin, furin, proprotein, prohormone, 99.8
2oxa_A 600 Extracellular serine protease; kexin, hydrolase; 1 99.8
2p4e_P 692 Proprotein convertase subtilisin/kexin type 9; pro 99.79
2qtw_B 546 Proprotein convertase subtilisin/kexin type 9; cor 99.79
3hjr_A 600 Extracellular serine protease; kexin, hydrolase; 1 99.73
3lxu_X 1354 Tripeptidyl-peptidase 2; spindle complex, aminopep 99.65
1t1e_A 552 Kumamolisin; proenzyme, prosubtilase, activation m 98.47
1ga6_A 372 Serine-carboxyl proteinase; serine-carboxyl protei 98.28
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.39
3edy_A 544 Tripeptidyl-peptidase 1; protease, TPP1, sedolisin 94.74
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 94.45
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 94.38
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 93.81
>3vta_A Cucumisin; subtilisin-like fold, serine protease, hydrolase; HET: DFP NAG FUC BMA MAN; 2.75A {Cucumis melo} Back     alignment and structure
Probab=100.00  E-value=4.2e-39  Score=316.32  Aligned_cols=174  Identities=34%  Similarity=0.470  Sum_probs=142.2

Q ss_pred             ccccCccccc---------cccceEEEEecCCCCCCCCCCccCCC-C-CCCCCCCCCCCCCCCcchhHHHHHHhhhcCcc
Q 046331           20 ITLSWDYFRL---------VKESCVYGRLALSGGTCNSCSFGNRM-Q-DADLWPNRCLPPNPPLEVEFVLFHKLASMYPE   88 (249)
Q Consensus        20 tt~sw~~l~l---------~g~gviigvi~dtGi~~~~~sf~~~~-~-~~~~w~g~c~~~~n~~ea~~~~~~kLi~~~~~   88 (249)
                      ||||||||||         .|+||||||| ||||||+||+|.+.. . .+.+|+|.|+.+.+     |.|++||++.+. 
T Consensus         1 tt~s~~flGl~~~~~~~~~~G~gViVgVi-DTGId~~Hp~f~d~g~~~~~~~w~g~~~~~~~-----~~~n~k~ig~~~-   73 (621)
T 3vta_A            1 TTRSWDFLGFPLTVPRRSQVESNIVVGVL-DTGIWPESPSFDDEGFSPPPPKWKGTCETSNN-----FRCNRKIIGARS-   73 (621)
T ss_dssp             CCSHHHHTTCCTTCCCCHHHHTTCEEEEE-ESCBCTTSGGGCCTTCCCCCTTCCCCBCCSSS-----CCCCSSEEEEEE-
T ss_pred             CCCChhHcCCCccccccCCCCCCCEEEEE-ecCCCCCChhhcCCCCCCcccccccccccCCC-----cccCcceeeeee-
Confidence            8999999998         3899999999 999999999999863 3 38899999998763     446777776321 


Q ss_pred             cccCCcceeecchhHHHHHHHHHHHHhcCCceeccccCcccccccccCCCCCCCCCCccccCCCcccchhhccccccCCC
Q 046331           89 LMSSSQLAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKD  168 (249)
Q Consensus        89 ~~~~~~igvItPy~~Qv~~l~~~~~~~~G~~vdi~t~DgfqG~~~~~~~~~~~~~~~~~D~~GH~GThvA~i~ag~~~~~  168 (249)
                                  |                           .    ......+.+..+|+|.+|| ||||||||||+.+.+
T Consensus        74 ------------~---------------------------~----~~~~~~~~~~~~p~D~~GH-GTHvAgi~AG~~~~~  109 (621)
T 3vta_A           74 ------------Y---------------------------H----IGRPISPGDVNGPRDTNGH-GTHTASTAAGGLVSQ  109 (621)
T ss_dssp             ------------C---------------------------C----CSSSCCTTCCSSSBCSSSH-HHHHHHHHHCCCEEE
T ss_pred             ------------c---------------------------c----cCCccCCCCCCCCCCCCcC-HHHHHHHHhCcCCCC
Confidence                        0                           0    0011122345578999999 999999999987654


Q ss_pred             CC--------cccccCCCcH-------------HHHHHHHHHHHHCCCcEEEeccCCCCCCcchhhHHHHHHHHHHhCCc
Q 046331          169 VS--------FSRTGKKKQI-------------SEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGI  227 (249)
Q Consensus       169 ~~--------~~G~a~~~ri-------------~~i~~ai~~Ai~~gvdVI~~SlG~~~~~~~~~~~i~~~~~~a~~~Gi  227 (249)
                      .+        +.|+||++||             ++|++||++|+++|+||||||||+..+..+..+++++++++|+++||
T Consensus       110 ~~~~g~~~g~~~GvAP~A~l~~~kv~~~~g~~~~di~~a~~~a~~~g~dVin~SlG~~~~~~~~~~~~~~~~~~a~~~Gi  189 (621)
T 3vta_A          110 ANLYGLGLGTARGGVPLARIAAYKVCWNDGCSDTDILAAYDDAIADGVDIISLSVGGANPRHYFVDAIAIGSFHAVERGI  189 (621)
T ss_dssp             EEETTEEEEEECCSCTTSEEEEEECEETTEECHHHHHHHHHHHHHHTCSEEEECCCCCCGGGGGGCTHHHHHHHHHTTTC
T ss_pred             ccccccccccEEEECCCCEEEEEEeecCCCCCHHHHHHHHHHHHHhCCCEEEecCCCCCCCCcCCcHHHHHHHHHHHCCC
Confidence            33        4699999966             89999999999999999999999886666777889999999999999


Q ss_pred             EEEEcCCCCCCCCCcee
Q 046331          228 LTSNSAGNRGPRTDQLL  244 (249)
Q Consensus       228 ~Vv~aAGN~Gp~~~tv~  244 (249)
                      +||+||||+|+...|+.
T Consensus       190 ~vv~aAGN~g~~~~t~~  206 (621)
T 3vta_A          190 LTSNSAGNGGPNFFTTA  206 (621)
T ss_dssp             EEEEECCSCCSSTTCCC
T ss_pred             EEEEeCCCCCCCCcccC
Confidence            99999999999988764
>3i6s_A Subtilisin-like protease; PA-domain, FN3-domain, hydrolase; HET: NAG FUC; 2.50A {Solanum lycopersicum} PDB: 3i74_A* Back     alignment and structure
>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* Back     alignment and structure
>4h6x_A Thiazoline oxidase/subtilisin-like protease; hydrolase; 2.00A {Prochloron didemni} PDB: 4aks_A 4akt_A Back     alignment and structure
>3t41_A Epidermin leader peptide processing serine protea; structural genomics, center for structural genomics of infec diseases, csgid; 1.95A {Staphylococcus aureus} PDB: 3qfh_A Back     alignment and structure
>1dbi_A AK.1 serine protease; hydrolase; 1.80A {Bacillus SP} SCOP: c.41.1.1 Back     alignment and structure
>3afg_A Subtilisin-like serine protease; propeptide, thermococcus kodakaraensis, hydrolas protease; 2.00A {Thermococcus kodakarensis} Back     alignment and structure
>3zxy_A Subtilisin-like protein; hydrolase; 1.58A {Prochloron didemni} PDB: 3zxx_A Back     alignment and structure
>1thm_A Thermitase; hydrolase(serine protease); 1.37A {Thermoactinomyces vulgaris} SCOP: c.41.1.1 PDB: 2tec_E 1tec_E 3tec_E Back     alignment and structure
>2ixt_A 36KDA protease; serine protease, sphericase, subtilisin like protease, hydrolase; 0.8A {Bacillus sphaericus} SCOP: c.41.1.1 PDB: 3d43_A 1ea7_A* 2gko_A* Back     alignment and structure
>1to2_E Subtilisin BPN'; serine protease, hydrolase; HET: CIT 15P; 1.30A {Bacillus amyloliquefaciens} SCOP: c.41.1.1 PDB: 1tm1_E* 1tm3_E* 1tm4_E* 1lw6_E* 1tm7_E* 1tmg_E* 1to1_E* 1tm5_E* 1y1k_E* 1y33_E* 1y34_E* 1y3b_E* 1y3c_E* 1y3d_E* 1y3f_E* 1y48_E* 1y4a_E* 1y4d_E 1sup_A* 1sib_E ... Back     alignment and structure
>2z2z_A TK-subtilisin precursor; thermococcus kodakaraensis, hydrolase; 1.87A {Thermococcus kodakarensis} PDB: 2e1p_A 2zwp_A 2zwo_A Back     alignment and structure
>2x8j_A Intracellular subtilisin protease; hydrolase, serine protease, intracellular proteinase regulat; HET: CSX 1PE; 1.56A {Bacillus clausii} PDB: 2wv7_A 2wwt_A 2xrm_A* Back     alignment and structure
>1r0r_E Subtilisin carlsberg; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Bacillus licheniformis} SCOP: c.41.1.1 PDB: 1af4_A* 1be8_A* 1bfk_A 1bfu_A 1be6_A 1oyv_A 1cse_E 1sbc_A 1sca_A 1scb_A 1scd_A 2sec_E 2wuv_A 2wuw_E 1yu6_A 1scn_E* 1c3l_A 1avt_A* 1av7_A* 1sel_A ... Back     alignment and structure
>2z30_A TK-subtilisin; thermococcus kodakaraensis, hydrolase; 1.65A {Thermococcus kodakarensis} PDB: 3a3o_A 3a3n_A 2zrq_A 2z57_A 2z56_A 2z58_A 3a3p_A 2z2x_A* 2z2y_A Back     alignment and structure
>1y9z_A Alkaline serine protease; subtilisin-like alpha/beta domain, insert beta barrel domain hydrolase; HET: PMS; 1.40A {Pseudoalteromonas SP} PDB: 1v6c_A* 1wvm_A* Back     alignment and structure
>3lpc_A APRB2; protease, subtilase, virulence factor, hydrolase; 1.70A {Dichelobacter nodosus} PDB: 3lpa_A 3lpd_A 3ti9_A 3ti7_A Back     alignment and structure
>1gci_A Subtilisin; hydrolase, serine protease; 0.78A {Bacillus lentus} SCOP: c.41.1.1 PDB: 1jea_A 1ndq_A 1svn_A 1tk2_A* 3bx1_A 1ah2_A 1iav_A* 1c9m_A* 1wsd_A 1mpt_A 1ndu_A 1c9j_A 1q5p_A* 1st3_A 1c9n_A* Back     alignment and structure
>2iy9_A SUBA; toxin, shiga, plasmid; 1.8A {Escherichia coli} Back     alignment and structure
>1p8j_A Furin precursor; prohormone convertase, SPC1, PACE, P-domain; HET: DKA AR7 NAG FUL BMA MAN GAL FUC; 2.60A {Mus musculus} SCOP: b.18.1.20 c.41.1.1 Back     alignment and structure
>1sh7_A Extracellular subtilisin-like serine proteinase; cold adaptation, psychrotrophic, subtilisin-like proteinase, depentent, hydrolase; HET: PMS; 1.84A {Vibrio SP} PDB: 1s2n_A* Back     alignment and structure
>4dzt_A Aqualysin-1, aqualysin-I; serine protease, calcium binding, inhibitor, hydrolase-hydro inhibitor complex; HET: PMS; 1.95A {Thermus aquaticus} Back     alignment and structure
>4h6w_A N-terminal cyanobactin protease; hydrolase; 2.45A {Planktothrix agardhii nies-596} Back     alignment and structure
>2b6n_A Proteinase K; S binding, substrate specificity, proteinase K, subtilase, psychrotrophic, psychrophilic, hydrolase; 1.80A {Serratia SP} Back     alignment and structure
>1r6v_A Subtilisin-like serine protease; sandwich domain, propeptide, hydrolase; 1.70A {Fervidobacterium pennivorans} SCOP: c.41.1.1 Back     alignment and structure
>2pwa_A Proteinase K; structure, alanine boronic acid, hydrolase; 0.83A {Engyodontium album} SCOP: c.41.1.1 PDB: 1p7v_A 1p7w_A 2dqk_A 2duj_A 2g4v_A 2hd4_A 2hpz_A 2id8_A 2pq2_A 1ic6_A 2pwb_A* 2pyz_A* 2v8b_A 3aj8_A 3aj9_A 3dyb_A* 3gt3_A* 3gt4_A* 3l1k_A 3osz_A ... Back     alignment and structure
>3f7m_A Alkaline serine protease VER112; verticillium psalliotae, cuticle- degrading protease, nematodes, hydrolase, secreted, zymogen; 1.60A {Lecanicillium psalliotae} SCOP: c.41.1.1 PDB: 3f7o_A Back     alignment and structure
>1wmd_A Protease; alpha-beta hydrolase fold, jelly-roll beta-barrel, hydrolase; 1.30A {Bacillus SP} SCOP: b.18.1.20 c.41.1.1 PDB: 1wme_A 1wmf_A Back     alignment and structure
>2id4_A Kexin; KEX2, kexin, furin, proprotein, prohormone, convertase, SUBT like protease, serine protease; HET: NDG; 1.90A {Saccharomyces cerevisiae} SCOP: b.18.1.20 c.41.1.1 PDB: 1r64_A* 1ot5_A* Back     alignment and structure
>2p4e_P Proprotein convertase subtilisin/kexin type 9; protease, LDL receptor, LDL, endocytosis, hydrol; 1.98A {Homo sapiens} Back     alignment and structure
>2qtw_B Proprotein convertase subtilisin/kexin type 9; coronary heart disease, hypercholest low density lipoprotein receptor, autocatalytic cleavage; HET: NAG; 1.90A {Homo sapiens} PDB: 3m0c_B 3bps_A 3gcw_A 3gcx_A 3p5b_A 3p5c_A 2pmw_B 3h42_B 2w2n_A 2w2m_A 2w2p_A 2w2q_A 2xtj_A 2w2o_A Back     alignment and structure
>3hjr_A Extracellular serine protease; kexin, hydrolase; 1.65A {Aeromonas sobria} Back     alignment and structure
>3lxu_X Tripeptidyl-peptidase 2; spindle complex, aminopeptidase, hydrolase, phosphoprotein, protease; 3.14A {Drosophila melanogaster} Back     alignment and structure
>1t1e_A Kumamolisin; proenzyme, prosubtilase, activation mechanism, sedolisin, serine-carboxyl proteinase, hydrolase; 1.18A {Bacillus SP} SCOP: c.41.1.2 d.58.3.2 PDB: 1t1g_A 1t1i_A 1gt9_1 1gtg_1 1gtj_1* 1gtl_1* 1sio_A* 1sn7_A 1zvj_A 1siu_A 1zvk_A Back     alignment and structure
>1ga6_A Serine-carboxyl proteinase; serine-carboxyl proteinase, hydrolase-hydrolase inhibitor CO; 1.00A {Pseudomonas SP} SCOP: c.41.1.2 PDB: 1ga4_A* 1ga1_A 1kdv_A* 1kdy_A* 1kdz_A* 1ke1_A* 1ke2_A* 1nlu_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3edy_A Tripeptidyl-peptidase 1; protease, TPP1, sedolisin, batten disease, lincl, zymogen, P exopeptidase, endopeptidase, S53 family, CLN2; HET: NAG; 1.85A {Homo sapiens} PDB: 3ee6_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1dbia_ 280 Thermostable serine protease {Bacillus sp., AK.1 [ 99.86
d1v6ca_ 435 Alkaline serine protease Apa1 {Pseudoalteromonas s 99.85
d1r6va_ 671 Fervidolysin {Fervidobacterium pennivorans [TaxId: 99.81
d1to2e_ 281 Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' 99.8
d1thma_ 279 Thermitase {Thermoactinomyces vulgaris [TaxId: 202 99.8
d1r0re_ 274 Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1 99.79
d1gcia_ 269 Subtilisin {Bacillus lentus [TaxId: 1467]} 99.75
d2ixta1 309 Sphericase {Bacillus sphaericus [TaxId: 1421]} 99.74
d1p8ja2 334 Furin, N-terminal domain {Mouse (Mus musculus) [Ta 99.69
d1wmda2 318 Alkaline serine protease kp-43, N-terminal domain 99.67
d2pwaa1 279 Proteinase K {Fungus (Tritirachium album), strain 99.65
d2id4a2 339 Kexin, N-terminal domain {Baker's yeast (Saccharom 99.61
d1t1ga_ 357 Serine-carboxyl proteinase, SCP {Bacillus novosp. 99.31
d1ga6a_ 369 Serine-carboxyl proteinase, SCP {Pseudomonas sp., 99.12
>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Subtilisin-like
superfamily: Subtilisin-like
family: Subtilases
domain: Thermostable serine protease
species: Bacillus sp., AK.1 [TaxId: 1409]

Probab=99.86  E-value=1.6e-22  Score=177.70  Aligned_cols=140  Identities=14%  Similarity=0.214  Sum_probs=108.2

Q ss_pred             hhhhcccccCccccccccceEEEEecCCCCCCCCCCccCCCCCCCCCCCCCCCCCCCcchhHHHHHHhhhcCcccccCCc
Q 046331           15 LRFCKITLSWDYFRLVKESCVYGRLALSGGTCNSCSFGNRMQDADLWPNRCLPPNPPLEVEFVLFHKLASMYPELMSSSQ   94 (249)
Q Consensus        15 ~~~~~tt~sw~~l~l~g~gviigvi~dtGi~~~~~sf~~~~~~~~~w~g~c~~~~n~~ea~~~~~~kLi~~~~~~~~~~~   94 (249)
                      ++.++..+.|+ +++.|+|++|+|| ||||++.|++|.....     .+.+                    +        
T Consensus        15 l~~i~~~~aw~-~~~~G~gv~Vavi-DsGi~~~h~~l~~~~~-----~~~~--------------------~--------   59 (280)
T d1dbia_          15 PQNTYTDYAWD-VTKGSSGQEIAVI-DTGVDYTHPDLDGKVI-----KGYD--------------------F--------   59 (280)
T ss_dssp             TGGGTHHHHTT-TCCCCTTCEEEEE-ESCCCTTSTTTTTTEE-----EEEE--------------------T--------
T ss_pred             hhhCCHHHHHh-ccCCCCCeEEEEE-ccCcCCCChhhcCCee-----eccc--------------------c--------
Confidence            35577888999 7899999999999 9999999999875310     0000                    0        


Q ss_pred             ceeecchhHHHHHHHHHHHHhcCCceeccccCcccccccccCCCCCCCCCCccccCCCcccchhhccccccCCCCCcccc
Q 046331           95 LAFISPYRHQVKQFQEWFKETFGELVDMTTTDGCQIIRAWCHPSSEAGNYTAREIEGSQMSHTSSTAAGKRGKDVSFSRT  174 (249)
Q Consensus        95 igvItPy~~Qv~~l~~~~~~~~G~~vdi~t~DgfqG~~~~~~~~~~~~~~~~~D~~GH~GThvA~i~ag~~~~~~~~~G~  174 (249)
                                                                  . .....+.|.+|| |||||+++++.......+.|+
T Consensus        60 --------------------------------------------~-~~~~~~~d~~~H-GT~vag~i~~~~~~~~~~~Gv   93 (280)
T d1dbia_          60 --------------------------------------------V-DNDYDPMDLNNH-GTHVAGIAAAETNNATGIAGM   93 (280)
T ss_dssp             --------------------------------------------T-TTBSCCCCSSSH-HHHHHHHHHCCCSSSSSCCCS
T ss_pred             --------------------------------------------c-CCCCcccccccc-ccceeEeeeccccCCCceeEE
Confidence                                                        0 001235788999 999999999987666778899


Q ss_pred             cCCCcH--------------HHHHHHHHHHHHCCCcEEEeccCCCCCCcchhhHHHHHHHHHHhCCcEEEEcCCCCCCC
Q 046331          175 GKKKQI--------------SEMLLMMHDATTVGVDLITISIGHAHALNFSDESISIGSFHAMKNGILTSNSAGNRGPR  239 (249)
Q Consensus       175 a~~~ri--------------~~i~~ai~~Ai~~gvdVI~~SlG~~~~~~~~~~~i~~~~~~a~~~Gi~Vv~aAGN~Gp~  239 (249)
                      ||+++|              +++++||+||++.|++|||+|||.......    ...+...|.++||+||+||||+|..
T Consensus        94 Ap~a~l~~~~v~~~~~~~~~~~~~~ai~~a~~~g~~iin~S~g~~~~~~~----~~~a~~~a~~~gilvv~aaGn~g~~  168 (280)
T d1dbia_          94 APNTRILAVRALDRNGSGTLSDIADAIIYAADSGAEVINLSLGCDCHTTT----LENAVNYAWNKGSVVVAAAGNNGSS  168 (280)
T ss_dssp             SSSCEEEEEECCCTTSCCCHHHHHHHHHHHHHTTCSEEEECCSSCCCCHH----HHHHHHHHHHTTCEEEEECCBC---
T ss_pred             eccCEEEEEEEeCCCCCcCHHHHHHHHHHHHHcCCcEeeccccccccchh----HHHHHHHHHHCCEEEEEecCccCCC
Confidence            999965              889999999999999999999998753332    3345567889999999999999864
>d1v6ca_ c.41.1.1 (A:) Alkaline serine protease Apa1 {Pseudoalteromonas sp. AS-11 [TaxId: 247492]} Back     information, alignment and structure
>d1r6va_ c.41.1.1 (A:) Fervidolysin {Fervidobacterium pennivorans [TaxId: 93466]} Back     information, alignment and structure
>d1to2e_ c.41.1.1 (E:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]} Back     information, alignment and structure
>d1thma_ c.41.1.1 (A:) Thermitase {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d1r0re_ c.41.1.1 (E:) Subtilisin {Bacillus subtilis, carlsberg [TaxId: 1423]} Back     information, alignment and structure
>d1gcia_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]} Back     information, alignment and structure
>d2ixta1 c.41.1.1 (A:1-309) Sphericase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1p8ja2 c.41.1.1 (A:109-442) Furin, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmda2 c.41.1.1 (A:1-318) Alkaline serine protease kp-43, N-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Back     information, alignment and structure
>d2pwaa1 c.41.1.1 (A:1-279) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]} Back     information, alignment and structure
>d2id4a2 c.41.1.1 (A:122-460) Kexin, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ga_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Bacillus novosp. MN-32, kumamolisin [TaxId: 198803]} Back     information, alignment and structure
>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]} Back     information, alignment and structure