Citrus Sinensis ID: 046349


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHWKEAREE
ccccccccccccccEEEccccccccccHHHcccccccEEcccccccccccccccccccEEEccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHccc
ccccccccccHHHHEEEccccccccccHHHHHHHHHHHcccHHHHHHHcccccccccEEEEccccccHHEcccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccc
melpeslgqlstlEELFLVknnfvripeSIMQLSKLKFLNLSYSERLQSLLKLPcslleldahhctvlDTLSGLIFSSYeidlscnfkldrneARGIVEDALQEIQLMATAHWKEAREE
melpeslgqlsTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHWKEAREE
MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERlqsllklpcsllelDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHWKEAREE
***********TLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHW******
MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEA*GIVEDALQEI**************
MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHWKEAREE
*ELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHW******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLELDAHHCTVLDTLSGLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHWKEAREE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
Q40392 1144 TMV resistance protein N N/A no 0.512 0.053 0.476 5e-06
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 2/63 (3%)

Query: 3   LPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLEL-- 60
           LPE +G LS+L++L L +NNF  +P SI QL  L+ L+L   +RL  L +LP  L EL  
Sbjct: 850 LPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHV 909

Query: 61  DAH 63
           D H
Sbjct: 910 DCH 912




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
255544956 1403 leucine-rich repeat containing protein, 0.932 0.079 0.393 9e-13
451798988 1219 TMV resistance protein N-like protein 6 0.907 0.088 0.426 1e-12
359493487 1162 PREDICTED: TMV resistance protein N-like 0.907 0.092 0.426 1e-12
359493483 1274 PREDICTED: TMV resistance protein N-like 0.907 0.084 0.382 5e-12
451798990 1335 TMV resistance protein N-like protein 7 0.907 0.080 0.382 5e-12
224171160 307 predicted protein [Populus trichocarpa] 0.588 0.228 0.542 2e-11
147770134 1414 hypothetical protein VITISV_040107 [Viti 0.907 0.076 0.4 5e-10
359486075 1291 PREDICTED: TMV resistance protein N-like 0.907 0.083 0.4 5e-10
147787212 600 hypothetical protein VITISV_032562 [Viti 0.554 0.11 0.492 4e-09
224131066 1176 tir-nbs-lrr resistance protein [Populus 0.924 0.093 0.381 5e-09
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 77.8 bits (190), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 71/122 (58%), Gaps = 11/122 (9%)

Query: 1    MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCSLLEL 60
            +++P SLG LS+L+ L L  NNF+RIP +I QLS L+ L++SY +RL++L +LP  +  L
Sbjct: 1024 VKVPGSLGYLSSLQVLLLKGNNFMRIPATIRQLSWLEVLDISYCKRLKALPELPQRIRVL 1083

Query: 61   DAHHCTVLDTLSGLIF-----------SSYEIDLSCNFKLDRNEARGIVEDALQEIQLMA 109
             AH+CT L T+S  +              Y    +    L++N    IVE AL + Q +A
Sbjct: 1084 VAHNCTSLKTVSSPLIQFQESQEQSPDDKYGFTFANCVSLEKNARSNIVESALLKTQHLA 1143

Query: 110  TA 111
            TA
Sbjct: 1144 TA 1145




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|451798988|gb|AGF69192.1| TMV resistance protein N-like protein 6 [Vitis labrusca] Back     alignment and taxonomy information
>gi|359493487|ref|XP_003634612.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493483|ref|XP_003634610.1| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|224171160|ref|XP_002339466.1| predicted protein [Populus trichocarpa] gi|222875162|gb|EEF12293.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147770134|emb|CAN76615.1| hypothetical protein VITISV_040107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147787212|emb|CAN75767.1| hypothetical protein VITISV_032562 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224131066|ref|XP_002328445.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222838160|gb|EEE76525.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
TAIR|locus:2118106 1219 AT4G12010 [Arabidopsis thalian 0.941 0.091 0.322 6.3e-07
TAIR|locus:2081790 1253 AT3G51560 [Arabidopsis thalian 0.957 0.090 0.299 0.00018
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.747 0.068 0.361 0.00019
TAIR|locus:2081810 1226 AT3G51570 [Arabidopsis thalian 0.840 0.081 0.321 0.00023
TAIR|locus:2046585 808 RLP27 "receptor like protein 2 0.361 0.053 0.431 0.00028
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.369 0.038 0.477 0.00072
MGI|MGI:1920564347 Lrrc69 "leucine rich repeat co 0.336 0.115 0.425 0.00088
UNIPROTKB|F1PUU4 1273 FLII "Uncharacterized protein" 0.336 0.031 0.425 0.00097
UNIPROTKB|J9P2Y3 1278 FLII "Uncharacterized protein" 0.336 0.031 0.425 0.00098
TAIR|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 6.3e-07, P = 6.3e-07
 Identities = 39/121 (32%), Positives = 60/121 (49%)

Query:     2 ELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERXXXXXXXXXXXXXXD 61
             +LP+++G LS+L+ L L  NN   +PES  QL+ LK+ +L + +               D
Sbjct:   869 KLPDNIGGLSSLQSLCLSGNNIENLPESFNQLNNLKWFDLKFCKMLKSLPVLPQNLQYLD 928

Query:    62 AHHCTVLDTLS--------GLIFSSYEIDLSCNFKLDRNEARGIVEDALQEIQLMATAHW 113
             AH C  L+TL+        G    S  I  +C +KL+++    +V  A  + QLMA A  
Sbjct:   929 AHECESLETLANPLTPLTVGERIHSMFIFSNC-YKLNQDAQASLVGHARIKSQLMANASA 987

Query:   114 K 114
             K
Sbjct:   988 K 988




GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0007165 "signal transduction" evidence=IEA
GO:0043531 "ADP binding" evidence=IEA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
TAIR|locus:2081790 AT3G51560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
MGI|MGI:1920564 Lrrc69 "leucine rich repeat containing 69" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUU4 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2Y3 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_scaffold_20023000001
hypothetical protein (307 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.01780044
hypothetical protein (331 aa)
       0.494
fgenesh4_pg.C_scaffold_2767000001
hypothetical protein (201 aa)
       0.484
eugene3.00190957
annotation not avaliable (274 aa)
       0.477
eugene3.29890001
hypothetical protein (424 aa)
       0.474
eugene3.02170026
hypothetical protein (204 aa)
       0.468
gw1.19161.1.1
hypothetical protein (165 aa)
       0.467
eugene3.00031219
hypothetical protein (230 aa)
       0.466
eugene3.00150435
hypothetical protein (198 aa)
       0.463
fgenesh4_pg.C_scaffold_10476000001
hypothetical protein (434 aa)
       0.455
eugene3.00181060
hypothetical protein (243 aa)
       0.453

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 37.5 bits (87), Expect = 7e-04
 Identities = 20/42 (47%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 2   ELPESLGQLSTLEELFLVKNNFV-RIPESIMQLSKLKFLNLS 42
            +P SLG L  L+ LFL +N     IP SI  L KL  L+LS
Sbjct: 251 PIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLS 292


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
PLN03150623 hypothetical protein; Provisional 99.09
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.06
KOG0617264 consensus Ras suppressor protein (contains leucine 99.04
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.88
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.86
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.8
KOG0617264 consensus Ras suppressor protein (contains leucine 98.79
PLN03150623 hypothetical protein; Provisional 98.76
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.72
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.63
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.54
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.48
KOG0472 565 consensus Leucine-rich repeat protein [Function un 98.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.37
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.24
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.24
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.23
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.2
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.18
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.13
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.11
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.09
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.07
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.03
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.02
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.93
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.75
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.74
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.73
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.73
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.7
PRK15386 426 type III secretion protein GogB; Provisional 97.64
KOG1259490 consensus Nischarin, modulator of integrin alpha5 97.57
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.5
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 97.45
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.44
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.4
PRK15386 426 type III secretion protein GogB; Provisional 97.22
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.14
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 97.01
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.82
smart0037026 LRR Leucine-rich repeats, outliers. 96.71
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.71
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 96.6
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.99
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.99
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 95.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.66
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.35
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 95.33
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.97
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 94.76
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 94.42
KOG2123 388 consensus Uncharacterized conserved protein [Funct 94.26
KOG2982 418 consensus Uncharacterized conserved protein [Funct 93.53
KOG2120 419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.05
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 92.94
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 92.9
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 92.64
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.14
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 91.23
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.47
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 89.1
KOG2982 418 consensus Uncharacterized conserved protein [Funct 85.93
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 82.2
KOG0473 326 consensus Leucine-rich repeat protein [Function un 81.37
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.09  E-value=1.9e-10  Score=88.48  Aligned_cols=76  Identities=22%  Similarity=0.300  Sum_probs=69.8

Q ss_pred             CcChhccCCCCCCEEeccCCCCc-cCChhhhcCCCCCEEeccCcccccccCCC---CCCCceeeccCCCCccccCccccC
Q 046349            2 ELPESLGQLSTLEELFLVKNNFV-RIPESIMQLSKLKFLNLSYSERLQSLLKL---PCSLLELDAHHCTVLDTLSGLIFS   77 (119)
Q Consensus         2 ~lP~~~~~l~~L~~L~ls~n~l~-~lP~~~~~l~~L~~L~l~~n~~~~~lp~~---~~~L~~L~l~~~~~~~~lp~~~~~   77 (119)
                      .+|.+++.+++|+.|++++|.+. .+|..++.+++|+.|++++|++.+.+|+.   +.+|+.|++++|.+.+.+|..++.
T Consensus       433 ~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~N~lsg~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~l~~  512 (623)
T PLN03150        433 FIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSLSGRVPAALGG  512 (623)
T ss_pred             cCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCCCCCCCCCchHHhcCCCCCEEECcCCcccccCChHHhh
Confidence            47888999999999999999998 89999999999999999999999999986   578999999999999999988764



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-07
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-06
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 2e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-07
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-05
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-05
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 7e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 49.6 bits (119), Expect = 2e-08
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 1   MELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSL 50
           MELP+++ Q + LE L L +N    +P SI  L++L+ L++     L  L
Sbjct: 117 MELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTEL 166


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.31
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.3
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.22
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.2
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.18
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.18
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.17
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.11
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.1
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.08
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.08
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.03
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.02
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.01
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.0
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.99
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.99
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.98
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.98
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.96
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.96
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.95
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.95
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.93
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.92
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.92
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.91
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.91
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.9
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.9
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.9
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.9
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.89
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.89
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.89
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.87
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.86
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.86
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.86
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.85
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.85
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.85
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.85
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.85
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.83
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.83
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.83
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.83
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.83
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.82
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.82
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.81
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.81
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.81
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.8
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.78
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.77
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.77
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.77
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.76
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.76
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.74
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.73
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.72
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.7
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.7
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.7
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.7
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.7
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.69
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.69
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.68
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.67
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.65
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.65
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.63
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.63
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.58
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.58
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.56
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.55
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.53
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.52
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.47
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.43
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.42
1o6v_A466 Internalin A; bacterial infection, extracellular r 98.42
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.25
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.23
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.05
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 98.03
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.51
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.47
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.4
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.4
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.37
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.36
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.31
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.03
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.03
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.31
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.7
4fdw_A401 Leucine rich hypothetical protein; putative cell s 95.06
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 94.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 93.32
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 93.31
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 91.85
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.46
4gt6_A394 Cell surface protein; leucine rich repeats, putati 89.53
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 88.92
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.61
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.38  E-value=3.2e-12  Score=89.98  Aligned_cols=86  Identities=26%  Similarity=0.298  Sum_probs=63.3

Q ss_pred             CcChhccCCCCCCEEeccCCCCccCChhhhcCCCCCEEeccCcccccccCCC---CCCCceeeccCCCCccccCccccCc
Q 046349            2 ELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKL---PCSLLELDAHHCTVLDTLSGLIFSS   78 (119)
Q Consensus         2 ~lP~~~~~l~~L~~L~ls~n~l~~lP~~~~~l~~L~~L~l~~n~~~~~lp~~---~~~L~~L~l~~~~~~~~lp~~~~~l   78 (119)
                      .+|.+++++++|++|++++|.++.+|+.++.+++|+.|++++|.+.+.+|..   +++|+.|++++|+..+.+|..++.+
T Consensus       197 ~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l  276 (328)
T 4fcg_A          197 SLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRL  276 (328)
T ss_dssp             CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEECTTCTTCCBCCTTGGGC
T ss_pred             cchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEECCCCCchhhcchhhhcC
Confidence            4677788888888888888888878877888888888888888777777765   4567778888777777777766543


Q ss_pred             ---CceeecCcc
Q 046349           79 ---YEIDLSCNF   87 (119)
Q Consensus        79 ---~~l~~~~~~   87 (119)
                         +.|++.+|.
T Consensus       277 ~~L~~L~L~~n~  288 (328)
T 4fcg_A          277 TQLEKLDLRGCV  288 (328)
T ss_dssp             TTCCEEECTTCT
T ss_pred             CCCCEEeCCCCC
Confidence               345555543



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 40.1 bits (92), Expect = 2e-05
 Identities = 12/55 (21%), Positives = 19/55 (34%)

Query: 2   ELPESLGQLSTLEELFLVKNNFVRIPESIMQLSKLKFLNLSYSERLQSLLKLPCS 56
            LP+ L QL  L  L +  NN          L +      + ++ L       C+
Sbjct: 259 TLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNKCLCGSPLPACT 313


>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.25
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.11
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.06
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.02
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.01
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.98
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.97
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.95
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.9
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 98.88
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.78
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.69
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.66
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.63
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.6
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.56
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.51
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.5
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.47
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.31
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.92
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.53
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.18
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.83
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.21
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 95.6
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.09
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 90.55
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 85.99
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.25  E-value=2.6e-12  Score=87.82  Aligned_cols=79  Identities=28%  Similarity=0.369  Sum_probs=66.1

Q ss_pred             CcChhccCCCCCCEEeccC-CCCc-cCChhhhcCCCCCEEeccCcccccccCCC---CCCCceeeccCCCCccccCcccc
Q 046349            2 ELPESLGQLSTLEELFLVK-NNFV-RIPESIMQLSKLKFLNLSYSERLQSLLKL---PCSLLELDAHHCTVLDTLSGLIF   76 (119)
Q Consensus         2 ~lP~~~~~l~~L~~L~ls~-n~l~-~lP~~~~~l~~L~~L~l~~n~~~~~lp~~---~~~L~~L~l~~~~~~~~lp~~~~   76 (119)
                      ++|++++++++|++|++++ |.+. .+|++|+++++|++|++++|++.+..|..   ...|+.+++++|...+.+|..+.
T Consensus        67 ~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~  146 (313)
T d1ogqa_          67 PIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS  146 (313)
T ss_dssp             ECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             CCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhc
Confidence            4799999999999999986 7888 89999999999999999999976666654   45688888888777778887777


Q ss_pred             CcCc
Q 046349           77 SSYE   80 (119)
Q Consensus        77 ~l~~   80 (119)
                      ++..
T Consensus       147 ~l~~  150 (313)
T d1ogqa_         147 SLPN  150 (313)
T ss_dssp             GCTT
T ss_pred             cCcc
Confidence            6554



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure