Citrus Sinensis ID: 046357
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| 356505546 | 233 | PREDICTED: ubiquitin carboxyl-terminal h | 0.700 | 0.412 | 0.422 | 5e-13 | |
| 224153137 | 222 | predicted protein [Populus trichocarpa] | 0.591 | 0.364 | 0.381 | 6e-11 | |
| 224140755 | 290 | predicted protein [Populus trichocarpa] | 0.591 | 0.279 | 0.381 | 6e-10 | |
| 224140753 | 311 | predicted protein [Populus trichocarpa] | 0.591 | 0.260 | 0.381 | 8e-10 | |
| 225429035 | 330 | PREDICTED: MATH domain-containing protei | 0.627 | 0.260 | 0.336 | 6e-08 | |
| 296083026 | 672 | unnamed protein product [Vitis vinifera] | 0.627 | 0.127 | 0.336 | 7e-08 | |
| 356503299 | 322 | PREDICTED: uncharacterized protein LOC10 | 0.642 | 0.273 | 0.330 | 7e-08 | |
| 224100297 | 505 | predicted protein [Populus trichocarpa] | 0.605 | 0.164 | 0.336 | 1e-07 | |
| 147827577 | 341 | hypothetical protein VITISV_024779 [Viti | 0.627 | 0.252 | 0.346 | 4e-07 | |
| 225429037 | 261 | PREDICTED: uncharacterized protein LOC10 | 0.591 | 0.310 | 0.343 | 6e-07 |
| >gi|356505546|ref|XP_003521551.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 12-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 79.3 bits (194), Expect = 5e-13, Method: Compositional matrix adjust.
Identities = 49/116 (42%), Positives = 65/116 (56%), Gaps = 20/116 (17%)
Query: 7 ETSSLPTGWEVNAIINFFFYC-------------EKHFRAVKTKWCITKFIDLETLSNTL 53
++SSLP WEVNAI+NF Y + F +KT+W + KFID++T ++
Sbjct: 2 DSSSLPVDWEVNAIVNFSAYNFIDDEYVATQDTNVRRFHVLKTEWGVAKFIDIDTFNDPS 61
Query: 54 NEYLINDVCVCGCVCEEVFVVKNTFKGERSSMMHEPPHLLPYLESCA-QLMSLAKL 108
N YL++D CV G EVFVVK T KG+ SM+H P +P S SLAKL
Sbjct: 62 NGYLMDDTCVFGA---EVFVVKTTTKGDCLSMIHGP---IPLSHSWKFDNFSLAKL 111
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224153137|ref|XP_002337319.1| predicted protein [Populus trichocarpa] gi|222838767|gb|EEE77118.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224140755|ref|XP_002323744.1| predicted protein [Populus trichocarpa] gi|222866746|gb|EEF03877.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224140753|ref|XP_002323743.1| predicted protein [Populus trichocarpa] gi|222866745|gb|EEF03876.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225429035|ref|XP_002268000.1| PREDICTED: MATH domain-containing protein At5g43560-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296083026|emb|CBI22430.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356503299|ref|XP_003520448.1| PREDICTED: uncharacterized protein LOC100809118 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224100297|ref|XP_002311820.1| predicted protein [Populus trichocarpa] gi|222851640|gb|EEE89187.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147827577|emb|CAN66220.1| hypothetical protein VITISV_024779 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225429037|ref|XP_002265732.1| PREDICTED: uncharacterized protein LOC100258339 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 137 | ||||||
| TAIR|locus:2089045 | 309 | AT3G17380 "AT3G17380" [Arabido | 0.423 | 0.187 | 0.342 | 3.9e-07 | |
| TAIR|locus:2179744 | 351 | AT5G26260 "AT5G26260" [Arabido | 0.591 | 0.230 | 0.268 | 2.7e-05 |
| TAIR|locus:2089045 AT3G17380 "AT3G17380" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 89 (36.4 bits), Expect = 3.9e-07, Sum P(2) = 3.9e-07
Identities = 24/70 (34%), Positives = 34/70 (48%)
Query: 3 LQKSETSSLPTGWEVNAIINFFF-------YC-----EKHFRAVKTKWCITKFIDLETLS 50
L +++SSL GWEV A+ + Y E+ F +VK +W KFI T S
Sbjct: 74 LSLADSSSLSPGWEVYAVFRLYLLDQNKDNYLILQGNERRFHSVKREWGFDKFIPTGTFS 133
Query: 51 NTLNEYLIND 60
+ N YL+ D
Sbjct: 134 DASNGYLMED 143
|
|
| TAIR|locus:2179744 AT5G26260 "AT5G26260" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.8193000101 | hypothetical protein (222 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| cd03772 | 137 | MATH_HAUSP Herpesvirus-associated ubiquitin-specif | 99.5 | |
| cd03775 | 134 | MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p | 99.47 | |
| cd03774 | 139 | MATH_SPOP Speckle-type POZ protein (SPOP) family, | 99.28 | |
| PF00917 | 119 | MATH: MATH domain; InterPro: IPR002083 Although ap | 99.11 | |
| cd00121 | 126 | MATH MATH (meprin and TRAF-C homology) domain; an | 98.97 | |
| cd00270 | 149 | MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- | 98.88 | |
| cd03773 | 132 | MATH_TRIM37 Tripartite motif containing protein 37 | 98.74 | |
| cd03776 | 147 | MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A | 98.54 | |
| KOG1987 | 297 | consensus Speckle-type POZ protein SPOP and relate | 98.48 | |
| cd03778 | 164 | MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A | 98.33 | |
| cd03779 | 147 | MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A | 98.28 | |
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 98.23 | |
| cd03781 | 154 | MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A | 98.23 | |
| cd03780 | 148 | MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A | 98.18 | |
| cd03772 | 137 | MATH_HAUSP Herpesvirus-associated ubiquitin-specif | 98.03 | |
| smart00061 | 95 | MATH meprin and TRAF homology. | 97.95 | |
| cd03777 | 186 | MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A | 97.91 | |
| cd03771 | 167 | MATH_Meprin Meprin family, MATH domain; Meprins ar | 97.82 | |
| cd03774 | 139 | MATH_SPOP Speckle-type POZ protein (SPOP) family, | 97.55 | |
| cd03778 | 164 | MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) A | 97.35 | |
| KOG1863 | 1093 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 97.25 | |
| PF00917 | 119 | MATH: MATH domain; InterPro: IPR002083 Although ap | 97.2 | |
| cd03775 | 134 | MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p | 97.15 | |
| cd00270 | 149 | MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)- | 96.64 | |
| cd03771 | 167 | MATH_Meprin Meprin family, MATH domain; Meprins ar | 95.34 | |
| cd03780 | 148 | MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-A | 95.18 | |
| cd03773 | 132 | MATH_TRIM37 Tripartite motif containing protein 37 | 95.16 | |
| cd03776 | 147 | MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-A | 94.9 | |
| cd00121 | 126 | MATH MATH (meprin and TRAF-C homology) domain; an | 94.58 | |
| cd03783 | 167 | MATH_Meprin_Alpha Meprin family, Alpha subunit, MA | 94.45 | |
| cd03779 | 147 | MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) A | 93.58 | |
| cd03781 | 154 | MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-A | 92.89 | |
| cd03782 | 167 | MATH_Meprin_Beta Meprin family, Beta subunit, MATH | 91.32 | |
| cd03783 | 167 | MATH_Meprin_Alpha Meprin family, Alpha subunit, MA | 89.67 | |
| cd03777 | 186 | MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-A | 89.64 |
| >cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
Probab=99.50 E-value=6.3e-14 Score=102.17 Aligned_cols=71 Identities=15% Similarity=0.242 Sum_probs=61.1
Q ss_pred CeEEecCCCCCCCCCEEEEEEEEEEEe------------CcccccccccccccceeccccccccCCceEeCCeEEEEEee
Q 046357 1 MTLQKSETSSLPTGWEVNAIINFFFYC------------EKHFRAVKTKWCITKFIDLETLSNTLNEYLINDVCVCGCVC 68 (137)
Q Consensus 1 lYL~~~~~~~l~~~w~v~a~fkl~i~N------------~~~F~~~~~~wG~~~fi~l~~l~d~~~GyLv~D~~v~~a~~ 68 (137)
|||++.+.. ..++|++.|+|+|+|+| .++|+.....|||++||++++|.++++|||+||+++|+|
T Consensus 52 vyL~~~~~~-~~~~w~i~a~~~~~l~~~~~~~~~~~~~~~~~f~~~~~~~G~~~fi~~~~L~~~~sgyl~~D~l~Ie~-- 128 (137)
T cd03772 52 FFLQCNAES-DSTSWSCHAQAVLRIINYKDDEPSFSRRISHLFFSKENDWGFSNFMTWSEVTDPEKGFIEDDTITLEV-- 128 (137)
T ss_pred EEEeeCCcC-CCCCCeEEEEEEEEEEcCCCCcccEEEeeeeEEcCCCCCccchheeEHHHhcCCCCCcEECCEEEEEE--
Confidence 589987644 44599999999999999 346877778999999999999999999999999999999
Q ss_pred eeEEEEc
Q 046357 69 EEVFVVK 75 (137)
Q Consensus 69 ~eV~vv~ 75 (137)
+|.|=.
T Consensus 129 -~V~~~~ 134 (137)
T cd03772 129 -YVQADA 134 (137)
T ss_pred -EEEeeC
Confidence 997643
|
It contains an N-terminal TRAF-like domain and a C-terminal catalytic protease (C19 family) domain. The tumor suppressor p53 protein is a transcription factor that responds to many cellular stress signals and is regulated primarily through ubiquitylation and subsequent degradation. MDM2 is a RING-finger E3 ubiquitin ligase that promotes p53 ubiquitinylation. p53 and MDM2 bind to the same site in the N-terminal TRAF-like domain of HAUSP in a mutually exclusive manner. HAUSP also interacts with the Epstein-Barr nuclear antigen 1 (EBNA1) protein of the Epstein-Barr virus (EBV), which efficiently immortalizes infected cells predisposing the host to a variety of cancers. EBNA1 |
| >cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] | Back alignment and domain information |
|---|
| >cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03772 MATH_HAUSP Herpesvirus-associated ubiquitin-specific protease (HAUSP, also known as USP7) family, N-terminal MATH (TRAF-like) domain; composed of proteins similar to human HAUSP, an enzyme that specifically catalyzes the deubiquitylation of p53 and MDM2, hence playing an important role in the p53-MDM2 pathway | Back alignment and domain information |
|---|
| >smart00061 MATH meprin and TRAF homology | Back alignment and domain information |
|---|
| >cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >cd03774 MATH_SPOP Speckle-type POZ protein (SPOP) family, MATH domain; composed of proteins with similarity to human SPOP | Back alignment and domain information |
|---|
| >cd03778 MATH_TRAF2 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF2 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00917 MATH: MATH domain; InterPro: IPR002083 Although apparently functionally unrelated, intracellular TRAFs and extracellular meprins share a conserved region of about 180 residues, the meprin and TRAF homology (MATH) domain [] | Back alignment and domain information |
|---|
| >cd03775 MATH_Ubp21p Ubiquitin-specific protease 21 (Ubp21p) family, MATH domain; composed of fungal proteins with similarity to Ubp21p of fission yeast | Back alignment and domain information |
|---|
| >cd00270 MATH_TRAF_C Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link cell surface TNFRs and receptors of the interleukin-1/Toll-like family to downstream kinase signaling cascades which results in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses in the immune and inflammatory systems | Back alignment and domain information |
|---|
| >cd03771 MATH_Meprin Meprin family, MATH domain; Meprins are multidomain, highly glycosylated extracellular metalloproteases, which are either anchored to the membrane or secreted into extracellular spaces | Back alignment and domain information |
|---|
| >cd03780 MATH_TRAF5 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF5 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03773 MATH_TRIM37 Tripartite motif containing protein 37 (TRIM37) family, MATH domain; TRIM37 is a peroxisomal protein and is a member of the tripartite motif (TRIM) protein subfamily, also known as the RING-B-box-coiled-coil (RBCC) subfamily of zinc-finger proteins | Back alignment and domain information |
|---|
| >cd03776 MATH_TRAF6 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF6 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF6, including the Drosophila protein DTRAF2 | Back alignment and domain information |
|---|
| >cd00121 MATH MATH (meprin and TRAF-C homology) domain; an independent folding unit with an eight-stranded beta-sandwich structure found in meprins, TRAFs and other proteins | Back alignment and domain information |
|---|
| >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03779 MATH_TRAF1 Tumor Necrosis Factor Receptor (TNFR) Associated Factor (TRAF) family, TRAF1 subfamily, TRAF domain, C-terminal MATH subdomain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
| >cd03781 MATH_TRAF4 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF4 subfamily, TRAF domain, C-terminal MATH subdomain; composed of proteins with similarity to human TRAF4, including the Drosophila protein DTRAF1 | Back alignment and domain information |
|---|
| >cd03782 MATH_Meprin_Beta Meprin family, Beta subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03783 MATH_Meprin_Alpha Meprin family, Alpha subunit, MATH domain; Meprins are multidomain extracellular metalloproteases capable of cleaving growth factors, cytokines, extracellular matrix proteins, and biologically active peptides | Back alignment and domain information |
|---|
| >cd03777 MATH_TRAF3 Tumor Necrosis Factor Receptor (TNFR)-Associated Factor (TRAF) family, TRAF3 subfamily, TRAF domain; TRAF molecules serve as adapter proteins that link TNFRs and downstream kinase cascades resulting in the activation of transcription factors and the regulation of cell survival, proliferation and stress responses | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 137 | |||
| 2foj_A | 155 | Ubiquitin carboxyl-terminal hydrolase 7; MATH doma | 2e-04 |
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A Length = 155 | Back alignment and structure |
|---|
Score = 37.9 bits (88), Expect = 2e-04
Identities = 8/83 (9%), Positives = 20/83 (24%), Gaps = 15/83 (18%)
Query: 7 ETSSLPTGWEVNAIINFFFYCEKHFRAVKTK------------WCITKFIDLETLSNTLN 54
S T W +A + ++ W + F+ +++
Sbjct: 72 NAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEK 131
Query: 55 EYLINDVCVCGCVCEEVFVVKNT 77
++ +D V
Sbjct: 132 GFIDDDKVTFEV---FVQADAPH 151
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| 2foj_A | 155 | Ubiquitin carboxyl-terminal hydrolase 7; MATH doma | 99.59 | |
| 3ivv_A | 145 | Speckle-type POZ protein; protein binding, nucleus | 99.52 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.33 | |
| 4gjh_A | 178 | TNF receptor-associated factor 5; TRAF domain, imm | 99.24 | |
| 1ca9_A | 192 | TRAF2, protein (TNF receptor associated factor 2); | 99.18 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.17 | |
| 1d00_A | 168 | Tumor necrosis factor receptor associated protein | 99.17 | |
| 1lb6_A | 160 | TNF receptor-associated factor 6; TRAF6-CD40 compl | 99.07 | |
| 4ghu_A | 198 | TNF receptor-associated factor 3; alpha/beta, inna | 98.99 | |
| 2gkw_A | 192 | TNF receptor-associated factor 3; CD40, NF-KB sign | 98.97 | |
| 1flk_A | 228 | TNF receptor associated factor 3; TNF signaling, T | 98.95 | |
| 2foj_A | 155 | Ubiquitin carboxyl-terminal hydrolase 7; MATH doma | 98.6 | |
| 3ivv_A | 145 | Speckle-type POZ protein; protein binding, nucleus | 98.13 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 97.84 | |
| 4gjh_A | 178 | TNF receptor-associated factor 5; TRAF domain, imm | 97.73 | |
| 1d00_A | 168 | Tumor necrosis factor receptor associated protein | 97.49 | |
| 1lb6_A | 160 | TNF receptor-associated factor 6; TRAF6-CD40 compl | 97.49 | |
| 1ca9_A | 192 | TRAF2, protein (TNF receptor associated factor 2); | 97.44 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 97.43 | |
| 4ghu_A | 198 | TNF receptor-associated factor 3; alpha/beta, inna | 96.76 | |
| 2gkw_A | 192 | TNF receptor-associated factor 3; CD40, NF-KB sign | 96.75 | |
| 1flk_A | 228 | TNF receptor associated factor 3; TNF signaling, T | 96.65 | |
| 4gwm_A | 592 | Meprin A subunit beta; mulidomain structure, hydro | 90.11 |
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A | Back alignment and structure |
|---|
Probab=99.59 E-value=1.3e-15 Score=111.42 Aligned_cols=74 Identities=15% Similarity=0.184 Sum_probs=64.8
Q ss_pred CeEEecCCCCCCCCCEEEEEEEEEEEe------------CcccccccccccccceeccccccccCCceEeCCeEEEEEee
Q 046357 1 MTLQKSETSSLPTGWEVNAIINFFFYC------------EKHFRAVKTKWCITKFIDLETLSNTLNEYLINDVCVCGCVC 68 (137)
Q Consensus 1 lYL~~~~~~~l~~~w~v~a~fkl~i~N------------~~~F~~~~~~wG~~~fi~l~~l~d~~~GyLv~D~~v~~a~~ 68 (137)
+||+++. +..+++|.++|+|+|+|+| .++|+.....|||++||++++|.|+.+|||+||+++|+|
T Consensus 67 lyL~~~~-~~~~~~w~v~a~~~l~l~~~~~~~~~~~~~~~~~F~~~~~~wG~~~Fi~~~~L~~~~~~yl~dD~l~Ie~-- 143 (155)
T 2foj_A 67 FFLQCNA-ESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEV-- 143 (155)
T ss_dssp EEEEEST-TCCCSSCEEEEEEEEEECCSSCGGGCEEEEEEEEEETTBCEEEEEEEEEHHHHTCTTTSSCBTTBEEEEE--
T ss_pred EEEEeCC-CCCCCCCEEEEEEEEEEEcCCCCcceEEeccEEEeCCCCCCEeECCeEEHHHhcCcCCCceECCEEEEEE--
Confidence 5898854 4578899999999999998 346877678999999999999999999999999999999
Q ss_pred eeEEEEccCC
Q 046357 69 EEVFVVKNTF 78 (137)
Q Consensus 69 ~eV~vv~~~~ 78 (137)
+|.|.++++
T Consensus 144 -~V~V~~~tG 152 (155)
T 2foj_A 144 -FVQADAPHG 152 (155)
T ss_dssp -EEEECCCBS
T ss_pred -EEEEeCccc
Confidence 999977654
|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A | Back alignment and structure |
|---|
| >4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A | Back alignment and structure |
|---|
| >2foj_A Ubiquitin carboxyl-terminal hydrolase 7; MATH domain, hydrolase; 1.60A {Homo sapiens} PDB: 1yze_A 1yy6_A 2foo_A 2fop_A 3mqr_A 3mqs_C 2f1w_A 2f1x_A 2f1y_A 2xxn_A | Back alignment and structure |
|---|
| >3ivv_A Speckle-type POZ protein; protein binding, nucleus, UBL conjugation pathway, ligase; 1.25A {Homo sapiens} SCOP: b.8.1.1 PDB: 3ivq_A 3ivb_A 3hsv_A 3hqh_A 3hqm_A 3hql_A 2cr2_A | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >4gjh_A TNF receptor-associated factor 5; TRAF domain, immune system; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >1d00_A Tumor necrosis factor receptor associated protein 2; B-sandwich, protein-peptide complex, apoptosis; 2.00A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1ca4_A 1d0j_A 1f3v_B 1czy_A 1d01_A 1d0a_A | Back alignment and structure |
|---|
| >1lb6_A TNF receptor-associated factor 6; TRAF6-CD40 complex, signaling protein; 1.80A {Homo sapiens} SCOP: b.8.1.1 PDB: 1lb5_A 1lb4_A | Back alignment and structure |
|---|
| >1ca9_A TRAF2, protein (TNF receptor associated factor 2); TNF signaling, TRAF, adapter protein, cell surviVal; 2.30A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1qsc_A 1czz_A | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ghu_A TNF receptor-associated factor 3; alpha/beta, innate immunity, IFN pathway, immune system; 2.20A {Mus musculus} PDB: 2gkw_A 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >2gkw_A TNF receptor-associated factor 3; CD40, NF-KB signaling, BAFF receptor, TRAF3, apoptosis; 2.70A {Homo sapiens} PDB: 1kzz_A 1l0a_A 1zms_A 1rf3_A | Back alignment and structure |
|---|
| >1flk_A TNF receptor associated factor 3; TNF signaling, TRAF3, CD40-binding protein, apoptosis; 2.80A {Homo sapiens} SCOP: b.8.1.1 h.1.2.1 PDB: 1fll_A | Back alignment and structure |
|---|
| >4gwm_A Meprin A subunit beta; mulidomain structure, hydrolase; HET: NAG BMA FUC MAN; 1.85A {Homo sapiens} PDB: 4gwn_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 137 | ||||
| d2cr2a1 | 146 | b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {H | 0.002 |
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: Speckle-type poz protein SPOP species: Human (Homo sapiens) [TaxId: 9606]
Score = 34.4 bits (78), Expect = 0.002
Identities = 13/50 (26%), Positives = 20/50 (40%), Gaps = 3/50 (6%)
Query: 29 KHFRAVKTKWCITKFIDLETLSNTLNEYLINDVCVCGCVCEEVFVVKNTF 78
+ W KFI + L + N L +D C EV VV+++
Sbjct: 95 AYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFC---EVSVVQDSV 141
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 137 | |||
| d2cr2a1 | 146 | Speckle-type poz protein SPOP {Human (Homo sapiens | 99.32 | |
| d1czya1 | 152 | TNF receptor associated factor 2 (TRAF2) {Human (H | 99.18 | |
| d1l0aa1 | 155 | TNF receptor associated factor 3 (TRAF3) {Human (H | 99.01 | |
| d1lb6a_ | 155 | TNF receptor associated factor 6 (TRAF6) {Human (H | 99.01 | |
| d2cr2a1 | 146 | Speckle-type poz protein SPOP {Human (Homo sapiens | 98.37 | |
| d1czya1 | 152 | TNF receptor associated factor 2 (TRAF2) {Human (H | 98.19 | |
| d1lb6a_ | 155 | TNF receptor associated factor 6 (TRAF6) {Human (H | 97.79 | |
| d1l0aa1 | 155 | TNF receptor associated factor 3 (TRAF3) {Human (H | 97.56 |
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: TRAF domain-like superfamily: TRAF domain-like family: MATH domain domain: Speckle-type poz protein SPOP species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.32 E-value=6.5e-13 Score=94.18 Aligned_cols=70 Identities=26% Similarity=0.265 Sum_probs=59.7
Q ss_pred CeEEecCCCCCCCCCEEEEEEEEEEEe------------CcccccccccccccceeccccccccCCceEeCCeEEEEEee
Q 046357 1 MTLQKSETSSLPTGWEVNAIINFFFYC------------EKHFRAVKTKWCITKFIDLETLSNTLNEYLINDVCVCGCVC 68 (137)
Q Consensus 1 lYL~~~~~~~l~~~w~v~a~fkl~i~N------------~~~F~~~~~~wG~~~fi~l~~l~d~~~GyLv~D~~v~~a~~ 68 (137)
+||.+.+. ++|.+.|+++|+|.| .+++......|||++||++++|.++.+|||+||+++|++
T Consensus 59 v~L~~~~~----~~~~v~~~~~~~l~n~~~~~~~~~~~~~~~~~~~~~~~G~~~fi~~~~l~~~~~g~l~~d~l~I~~-- 132 (146)
T d2cr2a1 59 LYLLLVSC----PKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFC-- 132 (146)
T ss_dssp EEEECCCC----SSSEEEEECEEEEECTTSCEEEEEECSCCEEEETTCEEEESCCSBHHHHSCTTTTSCTTSEEEEEE--
T ss_pred EEEEeccC----CCceEEEEEEEEEEcCCCCcccceEecceEeCCCCCeeeccEEEEHHHhcCcccCceeCCEEEEEE--
Confidence 46766543 469999999999998 334556667899999999999999999999999999999
Q ss_pred eeEEEEccC
Q 046357 69 EEVFVVKNT 77 (137)
Q Consensus 69 ~eV~vv~~~ 77 (137)
+|.|++++
T Consensus 133 -~I~v~~e~ 140 (146)
T d2cr2a1 133 -EVSVVQDS 140 (146)
T ss_dssp -EEEEECCS
T ss_pred -EEEEEeCC
Confidence 99999765
|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1czya1 b.8.1.1 (A:350-501) TNF receptor associated factor 2 (TRAF2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lb6a_ b.8.1.1 (A:) TNF receptor associated factor 6 (TRAF6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l0aa1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|