Citrus Sinensis ID: 046408

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPVKKGADVEA
cccEEEEEccccHHHHHHHHHHHcHHHHcccccHHHHHHHHccccccccEEEccEEEEEEEEHHHHHHHHHHHHccccEEEcccccEEEEEccccccccccc
ccccEEEEcccHHHHHHHHHHHHcHHHHccccccHHHHHHHccccccccEEEEEcEEEEEEEHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccc
MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELnsrlpapfflsltFPMILLQLRMLELLLRWAARRVgkvkdpcgftwlicspvkkgadvea
MKPQLLVEaskvtdavqcYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGkvkdpcgftwlicspvkkgadvea
MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMIllqlrmlelllrwaarrVGKVKDPCGFTWLICSPVKKGADVEA
*********SKVTDAVQCYKTAFGAVEIN****************LPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPV********
**PQLL*EASKVTDAVQCYKTAFGAVEINR*********QELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPVKKGA****
MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPVKKGADVEA
*KPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPVK*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMILLQLRMLELLLRWAARRVGKVKDPCGFTWLICSPVKKGADVEA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
Q9LV66166 Uncharacterized protein A yes no 0.519 0.319 0.490 2e-05
>sp|Q9LV66|Y5848_ARATH Uncharacterized protein At5g48480 OS=Arabidopsis thaliana GN=At5g48480 PE=1 SV=1 Back     alignment and function desciption
 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%)

Query: 1  MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLS 53
           K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL   L +   L+
Sbjct: 26 FKQMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLA 78

Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
351723033165 uncharacterized protein LOC100306467 [Gl 1.0 0.618 0.347 1e-11
356567730163 PREDICTED: uncharacterized protein At5g4 1.0 0.625 0.361 2e-11
225470242161 PREDICTED: uncharacterized protein At5g4 0.931 0.590 0.369 2e-11
255572644165 conserved hypothetical protein [Ricinus 0.980 0.606 0.377 8e-11
388492568167 unknown [Lotus japonicus] 0.990 0.604 0.368 2e-10
224069912164 predicted protein [Populus trichocarpa] 1.0 0.621 0.380 3e-10
28565534166 early tobacco anther 1 [Nicotiana tabacu 0.931 0.572 0.343 5e-10
449437180159 PREDICTED: uncharacterized protein At5g4 0.941 0.603 0.333 5e-10
388490626165 unknown [Medicago truncatula] 1.0 0.618 0.345 3e-09
449511236159 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.941 0.603 0.325 5e-09
>gi|351723033|ref|NP_001235473.1| uncharacterized protein LOC100306467 [Glycine max] gi|255628635|gb|ACU14662.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 64/141 (45%), Gaps = 39/141 (27%)

Query: 1   MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMI- 59
           +KPQLLVEA K  DA+  +K AFGA E+ R +  KRKAE EL   L A   ++ +  ++ 
Sbjct: 25  VKPQLLVEAPKANDAILFFKAAFGAEEVGRTLNPKRKAEHELPLILSAELKIAGSTILVA 84

Query: 60  --------------------------------------LLQLRMLELLLRWAARRVGKVK 81
                                                 + +  + E  +     RVGKVK
Sbjct: 85  DLVDDTSSPAKTGGNGVVLCLETEDVDGAVAKAVSAGAVAEGEVAEGEVACCGGRVGKVK 144

Query: 82  DPCGFTWLICSPVKKGADVEA 102
           DP GF WL C+P KK ADVEA
Sbjct: 145 DPYGFVWLFCTPGKKCADVEA 165

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356567730|ref|XP_003552070.1| PREDICTED: uncharacterized protein At5g48480-like [Glycine max] Back     alignment and taxonomy information
>gi|225470242|ref|XP_002263284.1| PREDICTED: uncharacterized protein At5g48480 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572644|ref|XP_002527255.1| conserved hypothetical protein [Ricinus communis] gi|223533348|gb|EEF35099.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|388492568|gb|AFK34350.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224069912|ref|XP_002303084.1| predicted protein [Populus trichocarpa] gi|118487570|gb|ABK95611.1| unknown [Populus trichocarpa] gi|222844810|gb|EEE82357.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|28565534|gb|AAO43000.1| early tobacco anther 1 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|449437180|ref|XP_004136370.1| PREDICTED: uncharacterized protein At5g48480-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388490626|gb|AFK33379.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449511236|ref|XP_004163901.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At5g48480-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
TAIR|locus:2165996166 AT5G48480 "AT5G48480" [Arabido 0.401 0.246 0.585 1.6e-10
TAIR|locus:2165996 AT5G48480 "AT5G48480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 112 (44.5 bits), Expect = 1.6e-10, Sum P(2) = 1.6e-10
 Identities = 24/41 (58%), Positives = 29/41 (70%)

Query:     2 KPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQEL 42
             K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL
Sbjct:    27 KQMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQEL 67
GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005829 "cytosol" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010619001
SubName- Full=Chromosome undetermined scaffold_272, whole genome shotgun sequence; (161 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
cd07246123 cd07246, Glo_EDI_BRP_like_8, This conserved domain 2e-05
>gnl|CDD|211349 cd07246, Glo_EDI_BRP_like_8, This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information 
 Score = 40.2 bits (95), Expect = 2e-05
 Identities = 30/122 (24%), Positives = 41/122 (33%), Gaps = 34/122 (27%)

Query: 3   PQLLVEASKVTDAVQCYKTAFGAVEINRN-METKRKAEQEL---NSRL------------ 46
           P L+V  +    A+  YK AFGA E+ R   +  R    EL   +S L            
Sbjct: 5   PYLIVRDAA--AAIDFYKKAFGAEELARMPDDDGRIMHAELRIGDSVLMLADEFPEHGAS 62

Query: 47  -----PAPFFLSLTFPMI--LLQLRMLEL---LLRWAA-----RRVGKVKDPCGFTWLIC 91
                  P  L L    +      R +      +   A      R G V+DP G  W I 
Sbjct: 63  PASWGGTPVSLHLYVEDVDATYA-RAVAAGATSVMPPADQFWGDRYGGVRDPFGHRWWIA 121

Query: 92  SP 93
           + 
Sbjct: 122 TH 123

This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structures of this family demonstrate domain swapping, which is shared by glyoxalase I and antibiotic resistance proteins. Length = 123

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
COG2764136 PhnB Uncharacterized protein conserved in bacteria 99.97
PRK10148147 hypothetical protein; Provisional 99.96
PF06983116 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltrans 99.93
cd06588128 PhnB_like Escherichia coli PhnB and similar protei 99.92
cd08355122 Glo_EDI_BRP_like_14 This conserved domain belongs 99.72
COG3865151 Uncharacterized protein conserved in bacteria [Fun 99.69
cd07246122 Glo_EDI_BRP_like_8 This conserved domain belongs t 99.62
cd07264125 Glo_EDI_BRP_like_15 This conserved domain belongs 99.28
cd09011120 Glo_EDI_BRP_like_23 This conserved domain belongs 99.26
cd08359119 Glo_EDI_BRP_like_22 This conserved domain belongs 99.19
cd08356113 Glo_EDI_BRP_like_17 This conserved domain belongs 99.17
cd08350120 BLMT_like BLMT, a bleomycin resistance protein enc 99.16
cd08349112 BLMA_like Bleomycin binding protein (BLMA) and sim 99.05
cd07235122 MRD Mitomycin C resistance protein (MRD). Mitomyci 99.04
PF12681108 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 99.03
cd07238112 Glo_EDI_BRP_like_5 This conserved domain belongs t 99.03
cd08342136 HPPD_N_like N-terminal domain of 4-hydroxyphenylpy 98.98
cd07247114 SgaA_N_like N-terminal domain of Streptomyces gris 98.81
PRK10291129 glyoxalase I; Provisional 98.72
cd08352125 Glo_EDI_BRP_like_1 This conserved domain belongs t 98.68
PRK11478129 putative lyase; Provisional 98.64
PF00903128 Glyoxalase: Glyoxalase/Bleomycin resistance protei 98.64
cd07261114 Glo_EDI_BRP_like_11 This conserved domain belongs 98.63
cd08354122 Glo_EDI_BRP_like_13 This conserved domain belongs 98.56
TIGR03081128 metmalonyl_epim methylmalonyl-CoA epimerase. Membe 98.56
cd08353142 Glo_EDI_BRP_like_7 This conserved domain belongs t 98.53
cd07263119 Glo_EDI_BRP_like_16 This conserved domain belongs 98.51
cd08357125 Glo_EDI_BRP_like_18 This conserved domain belongs 98.5
cd07251121 Glo_EDI_BRP_like_10 This conserved domain belongs 98.46
cd07267113 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydr 98.46
cd08362120 BphC5-RrK37_N_like N-terminal, non-catalytic, doma 98.45
cd08351123 ChaP_like ChaP, an enzyme involved in the biosynth 98.42
cd09012124 Glo_EDI_BRP_like_24 This conserved domain belongs 98.42
cd07233121 Glyoxalase_I Glyoxalase I catalyzes the isomerizat 98.41
TIGR00068150 glyox_I lactoylglutathione lyase. Glyoxylase I is 98.41
cd08345113 Fosfomycin_RP Fosfomycin resistant protein; inhibi 98.4
TIGR03645162 glyox_marine lactoylglutathione lyase family prote 98.4
cd08343131 ED_TypeI_classII_C C-terminal domain of type I, cl 98.39
cd07241125 Glo_EDI_BRP_like_3 This conserved domain belongs t 98.33
cd06587112 Glo_EDI_BRP_like This domain superfamily is found 98.33
cd08344112 MhqB_like_N N-terminal domain of MhqB, a type I ex 98.31
PRK04101139 fosfomycin resistance protein FosB; Provisional 98.3
PLN03042185 Lactoylglutathione lyase; Provisional 98.28
cd07240117 ED_TypeI_classII_N N-terminal domain of type I, cl 98.26
cd07239144 BphC5-RK37_C_like C-terminal, catalytic, domain of 98.25
cd07245114 Glo_EDI_BRP_like_9 This conserved domain belongs t 98.25
cd08363131 FosB FosB, a fosfomycin resistance protein, cataly 98.24
cd07253125 Glo_EDI_BRP_like_2 This conserved domain belongs t 98.21
cd08346126 PcpA_N_like N-terminal domain of Sphingobium chlor 98.19
cd08361124 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cuma 98.14
cd07258141 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cuma 98.14
PLN02367233 lactoylglutathione lyase 98.14
PRK06724128 hypothetical protein; Provisional 98.14
cd07265122 2_3_CTD_N N-terminal domain of catechol 2,3-dioxyg 98.11
cd07252120 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydro 98.11
PLN02300 286 lactoylglutathione lyase 98.1
cd07254120 Glo_EDI_BRP_like_20 This conserved domain belongs 98.1
cd07244121 FosA FosA, a Fosfomycin resistance protein, cataly 98.09
cd07266121 HPCD_N_class_II N-terminal domain of 3,4-dihydroxy 98.08
cd07257153 THT_oxygenase_C The C-terminal domain of 2,4,5-Tri 98.03
cd07243143 2_3_CTD_C C-terminal domain of catechol 2,3-dioxyg 98.02
cd07262123 Glo_EDI_BRP_like_19 This conserved domain belongs 97.99
cd07256161 HPCD_C_class_II C-terminal domain of 3,4-dihydroxy 97.98
cd09014166 BphC-JF8_C_like C-terminal, catalytic, domain of B 97.97
cd09013121 BphC-JF8_N_like N-terminal, non-catalytic, domain 97.97
cd08360134 MhqB_like_C C-terminal domain of Burkholderia sp. 97.9
cd07237154 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydro 97.87
cd08364131 FosX FosX, a fosfomycin resistance protein, cataly 97.82
cd08348134 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydro 97.81
cd08347157 PcpA_C_like C-terminal domain of Sphingobium chlor 97.79
TIGR02295 294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 97.78
COG3324127 Predicted enzyme related to lactoylglutathione lya 97.75
TIGR03213286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 97.72
cd07255125 Glo_EDI_BRP_like_12 This conserved domain belongs 97.7
cd07249128 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, als 97.67
TIGR03213 286 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase 97.62
TIGR03211303 catechol_2_3 catechol 2,3 dioxygenase. Members of 97.56
cd08358127 Glo_EDI_BRP_like_21 This conserved domain belongs 97.51
cd07242128 Glo_EDI_BRP_like_6 This conserved domain belongs t 97.45
PLN02300286 lactoylglutathione lyase 97.4
TIGR03211 303 catechol_2_3 catechol 2,3 dioxygenase. Members of 97.28
TIGR02295294 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase. T 97.12
PRK01037357 trmD tRNA (guanine-N(1)-)-methyltransferase/unknow 96.95
COG3607133 Predicted lactoylglutathione lyase [General functi 96.93
PF13669109 Glyoxalase_4: Glyoxalase/Bleomycin resistance prot 95.33
TIGR01263 353 4HPPD 4-hydroxyphenylpyruvate dioxygenase. This pr 94.29
PF14506125 CppA_N: CppA N-terminal; PDB: 3E0R_D. 94.26
COG0346138 GloA Lactoylglutathione lyase and related lyases [ 93.46
cd07250191 HPPD_C_like C-terminal domain of 4-hydroxyphenylpy 87.61
COG3565138 Predicted dioxygenase of extradiol dioxygenase fam 81.32
COG2514265 Predicted ring-cleavage extradiol dioxygenase [Gen 81.04
KOG2943 299 consensus Predicted glyoxalase [Carbohydrate trans 80.66
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information 
Probab=99.97  E-value=4.7e-31  Score=177.42  Aligned_cols=95  Identities=24%  Similarity=0.445  Sum_probs=77.8

Q ss_pred             CeeEEEeCCCCHHHHHHHHHHhhCCeEEEEecCccc----ccccccCceEEEEEeeC-Cee------------------e
Q 046408            1 MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKR----KAEQELNSRLPAPFFLS-LTF------------------P   57 (102)
Q Consensus         1 ~~PyL~~~~~~~~eAi~FY~~~fG~~~~~~~~~~~~----~~~~~~~~i~ha~l~i~-~~i------------------~   57 (102)
                      |+|||+|+|| |++||+||+++||+++..+ ++...    ..+...++||||+|+++ ..|                  +
T Consensus         2 l~PYl~f~gn-~~~Al~fY~~vFgae~~~~-~~~~d~~~~~~~~~~~~i~HA~l~i~g~~im~sd~~~~~~~~~~~~~s~   79 (136)
T COG2764           2 LSPYLFFNGN-AREALAFYKEVFGAEELKR-VPFGDMPSSAGEPPGGRIMHAELRIGGSTIMLSDAFPDMGATEGGGTSL   79 (136)
T ss_pred             cceEEEECCC-HHHHHHHHHHHhCceEEEE-EEcCccCccccccccCceEEEEEEECCEEEEEecCCCccCcccCCCeeE
Confidence            6899999987 9999999999999999887 33220    01122258999999999 666                  5


Q ss_pred             EEEEeeCcHHHHH----------------hhhcCeEEEEEcCCCCEEEEecccCCC
Q 046408           58 MILLQLRMLELLL----------------RWAARRVGKVKDPCGFTWLICSPVKKG   97 (102)
Q Consensus        58 ~l~l~~~d~~~~~----------------~~wG~~~g~v~D~fGv~W~i~~~~~~~   97 (102)
                      +|.+.++|++++|                +|||.|||+|+|||||.|+|+++.+..
T Consensus        80 ~l~~~~~d~da~f~~a~~aGa~v~mpl~~~fwG~r~G~v~D~fGv~W~l~~~~~~~  135 (136)
T COG2764          80 SLDLYVEDVDAVFERAAAAGATVVMPLEDTFWGDRYGQVTDPFGVVWMLNTPVESV  135 (136)
T ss_pred             EEEEEehHHHHHHHHHHhcCCeEEecchhcCcccceEEEECCCCCEEEEecCccCC
Confidence            6666678888888                999999999999999999999987653

>PRK10148 hypothetical protein; Provisional Back     alignment and domain information
>PF06983 3-dmu-9_3-mt: 3-demethylubiquinone-9 3-methyltransferase; PDB: 1U7I_A 1TSJ_A 1U69_D 3L20_B 3OMS_A Back     alignment and domain information
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E Back     alignment and domain information
>cd08355 Glo_EDI_BRP_like_14 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>COG3865 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07246 Glo_EDI_BRP_like_8 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07264 Glo_EDI_BRP_like_15 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd09011 Glo_EDI_BRP_like_23 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08359 Glo_EDI_BRP_like_22 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08356 Glo_EDI_BRP_like_17 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08350 BLMT_like BLMT, a bleomycin resistance protein encoded on the transposon Tn5, and similar proteins Back     alignment and domain information
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm Back     alignment and domain information
>cd07235 MRD Mitomycin C resistance protein (MRD) Back     alignment and domain information
>PF12681 Glyoxalase_2: Glyoxalase-like domain; PDB: 3G12_B 1JIF_B 1JIE_B 1QTO_A 3OXH_A 2PJS_A 2RBB_A 3SK1_B 3SK2_B 3RRI_A Back     alignment and domain information
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08342 HPPD_N_like N-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>cd07247 SgaA_N_like N-terminal domain of Streptomyces griseus SgaA (suppression of growth disturbance caused by A-factor at a high concentration under high osmolality during early growth phase), and similar domains Back     alignment and domain information
>PRK10291 glyoxalase I; Provisional Back     alignment and domain information
>cd08352 Glo_EDI_BRP_like_1 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PRK11478 putative lyase; Provisional Back     alignment and domain information
>PF00903 Glyoxalase: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily This Prosite is specific to glyoxalases This Prosite is specific to Extradiol ring-cleavage dioxygenases This prints entry is specific to bleomycin resistance protein Back     alignment and domain information
>cd07261 Glo_EDI_BRP_like_11 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08354 Glo_EDI_BRP_like_13 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>TIGR03081 metmalonyl_epim methylmalonyl-CoA epimerase Back     alignment and domain information
>cd08353 Glo_EDI_BRP_like_7 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07263 Glo_EDI_BRP_like_16 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08357 Glo_EDI_BRP_like_18 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07251 Glo_EDI_BRP_like_10 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07267 THT_Oxygenase_N N-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase Back     alignment and domain information
>cd08362 BphC5-RrK37_N_like N-terminal, non-catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Rhodococcus rhodochrous K37, and similar proteins Back     alignment and domain information
>cd08351 ChaP_like ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha); and similar proteins Back     alignment and domain information
>cd09012 Glo_EDI_BRP_like_24 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione Back     alignment and domain information
>TIGR00068 glyox_I lactoylglutathione lyase Back     alignment and domain information
>cd08345 Fosfomycin_RP Fosfomycin resistant protein; inhibits the biological function of fosfomycin Back     alignment and domain information
>TIGR03645 glyox_marine lactoylglutathione lyase family protein Back     alignment and domain information
>cd08343 ED_TypeI_classII_C C-terminal domain of type I, class II extradiol dioxygenases; catalytic domain Back     alignment and domain information
>cd07241 Glo_EDI_BRP_like_3 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd06587 Glo_EDI_BRP_like This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins Back     alignment and domain information
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins Back     alignment and domain information
>PRK04101 fosfomycin resistance protein FosB; Provisional Back     alignment and domain information
>PLN03042 Lactoylglutathione lyase; Provisional Back     alignment and domain information
>cd07240 ED_TypeI_classII_N N-terminal domain of type I, class II extradiol dioxygenases; non-catalytic domain Back     alignment and domain information
>cd07239 BphC5-RK37_C_like C-terminal, catalytic, domain of BphC5 (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacterium Rhodococcus rhodochrous K37 and similar proteins Back     alignment and domain information
>cd07245 Glo_EDI_BRP_like_9 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08363 FosB FosB, a fosfomycin resistance protein, catalyzes the Mg(II) dependent addition of L-cysteine to the epoxide ring of fosfomycin Back     alignment and domain information
>cd07253 Glo_EDI_BRP_like_2 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd08346 PcpA_N_like N-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>cd08361 PpCmtC_N N-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>cd07258 PpCmtC_C C-terminal domain of 2,3-dihydroxy-p-cumate-3,4-dioxygenase (PpCmtC) Back     alignment and domain information
>PLN02367 lactoylglutathione lyase Back     alignment and domain information
>PRK06724 hypothetical protein; Provisional Back     alignment and domain information
>cd07265 2_3_CTD_N N-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07252 BphC1-RGP6_N_like N-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>cd07254 Glo_EDI_BRP_like_20 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive Back     alignment and domain information
>cd07266 HPCD_N_class_II N-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD); belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd07257 THT_oxygenase_C The C-terminal domain of 2,4,5-Trihydroxytoluene (THT) oxygenase, which is an extradiol dioxygenease in the 2,4-dinitrotoluene (DNT) degradation pathway Back     alignment and domain information
>cd07243 2_3_CTD_C C-terminal domain of catechol 2,3-dioxygenase Back     alignment and domain information
>cd07262 Glo_EDI_BRP_like_19 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07256 HPCD_C_class_II C-terminal domain of 3,4-dihydroxyphenylacetate 2,3-dioxygenase (HPCD), which catalyses the second step in the degradation of 4-hydroxyphenylacetate to succinate and pyruvate; belongs to the type I class II family of extradiol dioxygenases Back     alignment and domain information
>cd09014 BphC-JF8_C_like C-terminal, catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd09013 BphC-JF8_N_like N-terminal, non-catalytic, domain of BphC_JF8, (2,3-dihydroxybiphenyl 1,2-dioxygenase) from Bacillus sp Back     alignment and domain information
>cd08360 MhqB_like_C C-terminal domain of Burkholderia sp Back     alignment and domain information
>cd07237 BphC1-RGP6_C_like C-terminal domain of 2,3-dihydroxybiphenyl 1,2-dioxygenase (BphC, EC 1 Back     alignment and domain information
>cd08364 FosX FosX, a fosfomycin resistance protein, catalyzes the addition of a water molecule to the C1 position of the antibiotic with inversion of configuration at C1 Back     alignment and domain information
>cd08348 BphC2-C3-RGP6_C_like The single-domain 2,3-dihydroxybiphenyl 1,2-dioxygenases (BphC, EC 1 Back     alignment and domain information
>cd08347 PcpA_C_like C-terminal domain of Sphingobium chlorophenolicum 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and similar proteins Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>COG3324 Predicted enzyme related to lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>cd07255 Glo_EDI_BRP_like_12 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE) Back     alignment and domain information
>TIGR03213 23dbph12diox 2,3-dihydroxybiphenyl 1,2-dioxygenase Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>cd08358 Glo_EDI_BRP_like_21 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>cd07242 Glo_EDI_BRP_like_6 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases Back     alignment and domain information
>PLN02300 lactoylglutathione lyase Back     alignment and domain information
>TIGR03211 catechol_2_3 catechol 2,3 dioxygenase Back     alignment and domain information
>TIGR02295 HpaD 3,4-dihydroxyphenylacetate 2,3-dioxygenase Back     alignment and domain information
>PRK01037 trmD tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG3607 Predicted lactoylglutathione lyase [General function prediction only] Back     alignment and domain information
>PF13669 Glyoxalase_4: Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A Back     alignment and domain information
>TIGR01263 4HPPD 4-hydroxyphenylpyruvate dioxygenase Back     alignment and domain information
>PF14506 CppA_N: CppA N-terminal; PDB: 3E0R_D Back     alignment and domain information
>COG0346 GloA Lactoylglutathione lyase and related lyases [Amino acid transport and metabolism] Back     alignment and domain information
>cd07250 HPPD_C_like C-terminal domain of 4-hydroxyphenylpyruvate dioxygenase (HppD) and hydroxymandelate Synthase (HmaS) Back     alignment and domain information
>COG3565 Predicted dioxygenase of extradiol dioxygenase family [General function prediction only] Back     alignment and domain information
>COG2514 Predicted ring-cleavage extradiol dioxygenase [General function prediction only] Back     alignment and domain information
>KOG2943 consensus Predicted glyoxalase [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
1xy7_A166 X-Ray Structure Of Gene Product From Arabidopsis Th 7e-07
>pdb|1XY7|A Chain A, X-Ray Structure Of Gene Product From Arabidopsis Thaliana At5g48480 Length = 166 Back     alignment and structure 
Iteration: 1

 Score = 48.9 bits (115), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%)
Query: 1  MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLS 53
           K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL   L +   L+
Sbjct: 26 FKQXLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLA 78
  Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
1xy7_A166 Unknown protein; structural genomics, protein stru 1e-05
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Length = 166 Back     alignment and structure
 Score = 40.4 bits (94), Expect = 1e-05
 Identities = 36/132 (27%), Positives = 50/132 (37%), Gaps = 37/132 (28%)

Query: 1   MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPA-------PFFLS 53
            K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL   L +        F + 
Sbjct: 26  FKQMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLAGSSFVVC 85

Query: 54  LTFPM------------ILLQL----------RMLE----LLLRWAAR----RVGKVKDP 83
               +            +   L          + ++     +    A       GKV DP
Sbjct: 86  DVSSLPGFSTAKSEGSGVTFLLGTKDAEAAVAKAVDAGAVKVEVTEAEVELGFKGKVTDP 145

Query: 84  CGFTWLICSPVK 95
            G TW+      
Sbjct: 146 FGVTWIFAEKKT 157

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
3oms_A138 PHNB protein; structural genomics, PSI-2, protein 99.94
3l20_A172 Putative uncharacterized protein; hypothetical pro 99.91
1tsj_A139 Conserved hypothetical protein; structural genomic 99.91
1u69_A163 Hypothetical protein; structural genomics, MSCG, p 99.9
1u7i_A136 Hypothetical protein; structural genomics, PA1358, 99.84
1u6l_A149 Hypothetical protein; structural genomics, PSI, pr 99.83
1xy7_A166 Unknown protein; structural genomics, protein stru 99.67
3itw_A137 Protein TIOX; bleomycin resistance fold, bisinterc 99.59
3fcd_A134 Lyase, ORF125EGC139; lactoylglutathione lyase, YEC 99.45
4hc5_A133 Glyoxalase/bleomycin resistance protein/dioxygena; 99.32
4g6x_A155 Glyoxalase/bleomycin resistance protein/dioxygena; 99.26
3m2o_A164 Glyoxalase/bleomycin resistance protein; unknown f 99.22
2zw5_A301 Bleomycin acetyltransferase; dimer, two domains; H 99.12
3r6a_A144 Uncharacterized protein; PSI biology, structural g 99.09
2i7r_A118 Conserved domain protein; structural genomics cons 99.08
2p25_A126 Glyoxalase family protein; structural genomics, MC 99.07
1qto_A122 Bleomycin-binding protein; arm-exchange, antibioti 99.06
3l7t_A134 SMU.1112C, putative uncharacterized protein; metal 99.05
3bt3_A148 Glyoxalase-related enzyme, ARAC type; VOC superfam 99.04
1ecs_A126 Bleomycin resistance protein; arm-exchange, antibi 99.01
2pjs_A119 AGR_C_3564P, uncharacterized protein ATU1953; glyo 99.01
3rhe_A148 NAD-dependent benzaldehyde dehydrogenase; structur 98.99
1xrk_A124 Bleomycin resistance protein; arm exchange, ligand 98.99
1f9z_A135 Glyoxalase I; beta-alpha-beta-BETA-beta motif, pro 98.98
3g12_A128 Putative lactoylglutathione lyase; glyoxalase, ble 98.95
3oa4_A161 Glyoxalase, BH1468 protein; structural genomics, p 98.93
3e5d_A127 Putative glyoxalase I; structural genomics, joint 98.89
2rk0_A136 Glyoxalase/bleomycin resistance protein/dioxygena; 98.89
3bqx_A150 Glyoxalase-related enzyme; VOC superfamily, PSI-2, 98.87
3rmu_A134 Methylmalonyl-COA epimerase, mitochondrial; struct 98.86
2a4x_A138 Mitomycin-binding protein; ALFA/beta protein, mito 98.85
2r6u_A148 Uncharacterized protein; structural genomics, PSI- 98.82
2rbb_A141 Glyoxalase/bleomycin resistance protein/dioxygena; 98.82
2rk9_A145 Glyoxalase/bleomycin resistance protein/dioxygena; 98.81
2qnt_A141 AGR_C_3434P, uncharacterized protein ATU1872; glyo 98.81
2qqz_A126 Glyoxalase family protein, putative; alpha-beta st 98.79
3ghj_A141 Putative integron gene cassette protein; integron 98.79
1ss4_A153 Glyoxalase family protein; structural genomics, PS 98.77
3uh9_A145 Metallothiol transferase FOSB 2; structural genomi 98.76
3ey7_A133 Biphenyl-2,3-DIOL 1,2-dioxygenase III-related prot 98.74
2c21_A144 Trypanothione-dependent glyoxalase I; lyase, gluta 98.7
3oxh_A282 RV0577 protein; kinase regulation, antibiotic resi 98.7
2kjz_A144 ATC0852; protein of unknown function, dimer, struc 98.69
2p7o_A133 Glyoxalase family protein; fosfomycin resistance p 98.68
3sk2_A132 EHPR; antibiotic resistance, griseoluteate-binding 98.66
3hdp_A133 Glyoxalase-I; glutathione,lyase, methylglyoxal,110 98.66
3vw9_A187 Lactoylglutathione lyase; glyoxalase, lyase-lyase 98.64
3huh_A152 Virulence protein STM3117; structural genomics, ny 98.63
1r9c_A139 Glutathione transferase; fosfomycin resistance pro 98.62
1jc4_A148 Methylmalonyl-COA epimerase; vicinal oxygen chelat 98.61
3r4q_A160 Lactoylglutathione lyase; structural genomics, PSI 98.59
3oxh_A 282 RV0577 protein; kinase regulation, antibiotic resi 98.5
4gym_A149 Glyoxalase/bleomycin resistance protein/dioxygena; 98.48
3kol_A156 Oxidoreductase, glyoxalase/bleomycin resistance pr 98.48
3rri_A135 Glyoxalase/bleomycin resistance protein/dioxygena; 98.46
3gm5_A159 Lactoylglutathione lyase and related lyases; sheet 98.42
2za0_A184 Glyoxalase I; lyase, lactoylglutathione lyase, met 98.41
3zw5_A147 Glyoxalase domain-containing protein 5; lyase; 1.6 98.4
1twu_A139 Hypothetical protein YYCE; structural genomics, pr 98.37
1nki_A135 Probable fosfomycin resistance protein; potassium 98.36
1xqa_A113 Glyoxalase/bleomycin resistance protein; dioxygena 98.3
1npb_A141 Fosfomycin-resistance protein; manganese binding, 98.3
1zsw_A 338 Metallo protein, glyoxalase family protein; hypoth 98.19
3ct8_A146 Protein BH2160, putative glyoxalase; NP_243026.1, 98.18
1mpy_A 307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 98.02
3hpy_A309 Catechol 2,3-dioxygenase; repeated motifs, aromati 97.99
1mpy_A307 Catechol 2,3-dioxygenase; extradiol dioxygenase, n 97.97
3zi1_A330 Glyoxalase domain-containing protein 4; isomerase; 97.95
3lm4_A339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 97.91
3oaj_A 335 Putative ring-cleaving dioxygenase MHQO; structura 97.91
1lgt_A 297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 97.9
1kw3_B 292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 97.88
3b59_A 310 Glyoxalase/bleomycin resistance protein/dioxygena; 97.85
3pkv_A 252 Toxoflavin lyase (TFLA); metalloenzyme, vicinal ox 97.84
1f1u_A 323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 97.82
2zyq_A300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 97.81
3lm4_A 339 Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein 97.8
3hpy_A 309 Catechol 2,3-dioxygenase; repeated motifs, aromati 97.79
2ehz_A 302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 97.72
1zsw_A338 Metallo protein, glyoxalase family protein; hypoth 97.65
3b59_A310 Glyoxalase/bleomycin resistance protein/dioxygena; 97.64
2zyq_A 300 Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; e 97.64
1f1u_A323 Homoprotocatechuate 2,3-dioxygenase; extradiol, ma 97.6
1lgt_A297 Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxy 97.54
4ghg_A 365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 97.52
2wl9_A 305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 97.44
3zi1_A 330 Glyoxalase domain-containing protein 4; isomerase; 97.38
1kw3_B292 2,3-dihydroxybiphenyl dioxygenase; four TIME repet 97.38
2wl9_A305 Catechol 2,3-dioxygenase; aromatic hydrocarbons ca 97.34
2ehz_A302 1,2-dihydroxynaphthalene dioxygenase; extradiol di 97.3
2r5v_A357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 97.28
3oaj_A335 Putative ring-cleaving dioxygenase MHQO; structura 96.77
1t47_A 381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 96.38
2r5v_A 357 PCZA361.1; dioxygenase, non-heme iron, vancomycin, 95.97
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 95.71
4ghg_A365 Homoprotocatechuate 2,3-dioxygenase; oxygen activa 95.4
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 94.94
3e0r_A 244 C3-degrading proteinase (CPPA protein); MCSG, PSI, 93.82
1cjx_A 357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 86.47
1sqd_A 424 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 84.69
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 84.36
1cjx_A357 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 83.4
1t47_A381 4-hydroxyphenylpyruvate dioxygenase; triketone inh 82.98
3isq_A 393 4-hydroxyphenylpyruvate dioxygenase; tyrosine meta 82.62
1sp8_A 418 4-hydroxyphenylpyruvate dioxygenase; oxidoreductas 80.93
>3oms_A PHNB protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, methyltransferase, GL family; 1.90A {Bacillus cereus} SCOP: d.32.1.0 Back     alignment and structure
Probab=99.94  E-value=1.7e-26  Score=154.03  Aligned_cols=90  Identities=14%  Similarity=0.324  Sum_probs=73.0

Q ss_pred             CeeEEEeCCCCHHHHHHHHHHhhC-CeEEEEe-cCcccccccccCceEEEEEeeC-Cee----------------eEEEE
Q 046408            1 MKPQLLVEASKVTDAVQCYKTAFG-AVEINRN-METKRKAEQELNSRLPAPFFLS-LTF----------------PMILL   61 (102)
Q Consensus         1 ~~PyL~~~~~~~~eAi~FY~~~fG-~~~~~~~-~~~~~~~~~~~~~i~ha~l~i~-~~i----------------~~l~l   61 (102)
                      |+|||+|+|+ |+||++||+++|| +++..+. ++..  +.+..++|||++|+++ ..|                ++++|
T Consensus        11 i~P~L~f~g~-a~eA~~FY~~vFg~~~i~~~~~~~~~--~~~~~g~v~ha~l~i~g~~lm~~d~~~~~~~~~~~~~~l~l   87 (138)
T 3oms_A           11 ITTFLMFEGK-AEEAMNFYTSLFDQSEIVSISRYDEN--GPGKEGTVIHATFTLNGQEFMCIDSYVNHNFTFTPAMSLYV   87 (138)
T ss_dssp             CCEEEEESSC-HHHHHHHHHTTSTTCCEEEEEECCTT--CSSCTTSEEEEEEEETTEEEEEEECSSCCSCCCCTTSCEEE
T ss_pred             EEEEEEECCC-HHHHHHHHHHHcCCceEEEEEecCCC--CCCCCCcEEEEEEEECCEEEEEEcCCCCCCCCCCCCEEEEE
Confidence            6899999976 9999999999999 5765441 3221  1122258999999998 666                67889


Q ss_pred             eeCc---HHHHH---------------hhhcCeEEEEEcCCCCEEEEecc
Q 046408           62 QLRM---LELLL---------------RWAARRVGKVKDPCGFTWLICSP   93 (102)
Q Consensus        62 ~~~d---~~~~~---------------~~wG~~~g~v~D~fGv~W~i~~~   93 (102)
                      .++|   ++++|               +|||.|+|+|+||||+.|+|+++
T Consensus        88 ~~~d~~evd~~~~~l~~Gg~v~~p~~~~~wg~~~~~~~Dp~G~~W~i~~~  137 (138)
T 3oms_A           88 TCETEEEIDTVFHKLAQDGAILMPLGSYPFSKKFGWLNDKYGVSWQLTLA  137 (138)
T ss_dssp             EESSHHHHHHHHHHHHTTCEEEEEEEEETTEEEEEEEECTTSCEEEEEEC
T ss_pred             EcCCHHHHHHHHHHHHcCCeEecCcccccCCcEEEEEECCCCCEEEEEeC
Confidence            9999   77777               89999999999999999999975
>3l20_A Putative uncharacterized protein; hypothetical protein, unknown function; 2.45A {Staphylococcus aureus} Back     alignment and structure
>1tsj_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, nysgxrc; 2.60A {Staphylococcus aureus subsp} SCOP: d.32.1.7 Back     alignment and structure
>1u69_A Hypothetical protein; structural genomics, MSCG, pseudomonas aeruginosa PAO1, HYPO protein, protein structure initiative (PSI); 1.60A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u7i_A Hypothetical protein; structural genomics, PA1358, PSI, PROT structure initiative; HET: MSE; 1.40A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1u6l_A Hypothetical protein; structural genomics, PSI, protein STRU initiative, NEW YORK SGX research center for structural GEN nysgxrc; 2.81A {Pseudomonas aeruginosa} SCOP: d.32.1.7 Back     alignment and structure
>1xy7_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G48480, reductively methylated protein, CATH 3.10.180 fold; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.9 PDB: 2q48_A Back     alignment and structure
>3itw_A Protein TIOX; bleomycin resistance fold, bisintercalator, solvent-exposed residue, thiocoraline, protein binding, peptide binding Pro; 2.15A {Micromonospora SP} Back     alignment and structure
>3fcd_A Lyase, ORF125EGC139; lactoylglutathione lyase, YECM, PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.92A {Uncultured bacterium} SCOP: d.32.1.0 Back     alignment and structure
>4hc5_A Glyoxalase/bleomycin resistance protein/dioxygena; MCSG, GEBA genomes, structural genomics, midwest center for structural genomics; HET: MSE GOL; 1.45A {Sphaerobacter thermophilus} Back     alignment and structure
>4g6x_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 1.73A {Catenulispora acidiphila} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>3r6a_A Uncharacterized protein; PSI biology, structural genomics, NEW YORK structural genomi research consortium, putative glyoxalase I; 1.76A {Methanosarcina mazei} Back     alignment and structure
>2i7r_A Conserved domain protein; structural genomics conserved domain, PSI-2, protein structure initiative; 2.20A {Streptococcus pneumoniae} SCOP: d.32.1.2 Back     alignment and structure
>2p25_A Glyoxalase family protein; structural genomics, MCSG, PSI-2, protein struct initiative, midwest center for structural genomics, oxidore; 1.70A {Enterococcus faecalis} Back     alignment and structure
>1qto_A Bleomycin-binding protein; arm-exchange, antibiotic inhibitor; 1.50A {Streptomyces verticillus} SCOP: d.32.1.2 PDB: 1jie_A* 1jif_A Back     alignment and structure
>3l7t_A SMU.1112C, putative uncharacterized protein; metal binding protein; 1.80A {Streptococcus mutans} Back     alignment and structure
>3bt3_A Glyoxalase-related enzyme, ARAC type; VOC superfamily, PSI-2, NYSGXRC, structural genomics, prote structure initiative; 2.50A {Clostridium phytofermentans} Back     alignment and structure
>1ecs_A Bleomycin resistance protein; arm-exchange, antibiotic inhibitor; HET: PG4; 1.70A {Klebsiella pneumoniae} SCOP: d.32.1.2 PDB: 1ewj_A* 1niq_B* 1mh6_A Back     alignment and structure
>2pjs_A AGR_C_3564P, uncharacterized protein ATU1953; glyoxalase/bleomycin resistance protein/dioxygenase superfamily, structural genomics; 1.85A {Agrobacterium tumefaciens str} SCOP: d.32.1.2 Back     alignment and structure
>3rhe_A NAD-dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, SGX; 2.05A {Legionella pneumophila} Back     alignment and structure
>1xrk_A Bleomycin resistance protein; arm exchange, ligand binding protein, thermostable mutant, antibiotic inhibitor; HET: BLM; 1.50A {Streptoalloteichus hindustanus} SCOP: d.32.1.2 PDB: 2zhp_A* 1byl_A Back     alignment and structure
>1f9z_A Glyoxalase I; beta-alpha-beta-BETA-beta motif, protein-NI(II) complex, homodimer, lyase; 1.50A {Escherichia coli} SCOP: d.32.1.1 PDB: 1fa5_A 1fa6_A 1fa7_A 1fa8_A Back     alignment and structure
>3g12_A Putative lactoylglutathione lyase; glyoxalase, bleomycin resistance, PSI-2, NYSGXRC, structural genomics; 2.58A {Bdellovibrio bacteriovorus HD100} Back     alignment and structure
>3oa4_A Glyoxalase, BH1468 protein; structural genomics, protein structure initiative, glyoxalas PSI-biology, lyase; 1.94A {Bacillus halodurans} Back     alignment and structure
>3e5d_A Putative glyoxalase I; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; 2.70A {Listeria monocytogenes str} Back     alignment and structure
>2rk0_A Glyoxalase/bleomycin resistance protein/dioxygena; 11002Z, glyoxylase, dioxygenas PSI-II; 2.04A {Frankia SP} Back     alignment and structure
>3bqx_A Glyoxalase-related enzyme; VOC superfamily, PSI-2, STRU genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.40A {Fulvimarina pelagi} Back     alignment and structure
>3rmu_A Methylmalonyl-COA epimerase, mitochondrial; structural genomics consortium, SGC, vitamin B12, mitochondr isomerase; HET: PG4; 1.80A {Homo sapiens} SCOP: d.32.1.0 Back     alignment and structure
>2a4x_A Mitomycin-binding protein; ALFA/beta protein, mitomycin C-binding protein, bleomycin A2, antimicrobial protein; HET: BLM; 1.40A {Streptomyces caespitosus} SCOP: d.32.1.2 PDB: 2a4w_A* 1kmz_A 1kll_A* Back     alignment and structure
>2r6u_A Uncharacterized protein; structural genomics, PSI-2, RHA04853, MCSG, protein structur initiative, midwest center for structural genomics; 1.50A {Rhodococcus SP} Back     alignment and structure
>2rbb_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-2, PROT structure initiative; 1.82A {Burkholderia phytofirmans} Back     alignment and structure
>2rk9_A Glyoxalase/bleomycin resistance protein/dioxygena; NYSGXRC, structural genomics, protein structur initiative II; 1.60A {Vibrio splendidus} Back     alignment and structure
>2qnt_A AGR_C_3434P, uncharacterized protein ATU1872; glyoxalase/bleomycin resistance protein/dioxygenase family R protein, PSI-2, MCSG; HET: MSE EPE; 1.40A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qqz_A Glyoxalase family protein, putative; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 1.92A {Bacillus anthracis str} Back     alignment and structure
>3ghj_A Putative integron gene cassette protein; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.47A {Uncultured bacterium} Back     alignment and structure
>1ss4_A Glyoxalase family protein; structural genomics, PSI, prote structure initiative, midwest center for structural genomic unknown function; HET: CIT GSH; 1.84A {Bacillus cereus} SCOP: d.32.1.6 Back     alignment and structure
>3ey7_A Biphenyl-2,3-DIOL 1,2-dioxygenase III-related protein; integron cassette protein mobIle metagenome structural genomics, oxidoreductase, PSI-2; HET: MSE; 1.60A {Vibrio cholerae} PDB: 3ey8_A* Back     alignment and structure
>2c21_A Trypanothione-dependent glyoxalase I; lyase, glutathionylspermidine, methylglyoxal, detoxification; 2.0A {Leishmania major} SCOP: d.32.1.1 Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>2kjz_A ATC0852; protein of unknown function, dimer, structural genomics, PSI protein structure initiative; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2p7o_A Glyoxalase family protein; fosfomycin resistance protein, Mn binding, antibiotic resist metal binding protein, hydrolase; 1.44A {Listeria monocytogenes} PDB: 2p7k_A 2p7l_A 2p7m_A 2p7p_A 2p7q_A Back     alignment and structure
>3sk2_A EHPR; antibiotic resistance, griseoluteate-binding protein; HET: GRI; 1.01A {Pantoea agglomerans} PDB: 3sk1_A* Back     alignment and structure
>3hdp_A Glyoxalase-I; glutathione,lyase, methylglyoxal,11003P,PSI2, structural GENOMIC,NYSGXRC., structural genomics; 2.06A {Clostridium acetobutylicum} PDB: 2qh0_A Back     alignment and structure
>3vw9_A Lactoylglutathione lyase; glyoxalase, lyase-lyase inhibitor complex; HET: EPE HPJ; 1.47A {Homo sapiens} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* 2za0_A* Back     alignment and structure
>3huh_A Virulence protein STM3117; structural genomics, nysgrc, target 13955A1BCT15P1, dioxygen virulence, PSI-2, protein structure initiative; 1.50A {Salmonella enterica subsp} PDB: 3hnq_A Back     alignment and structure
>1r9c_A Glutathione transferase; fosfomycin resistance protein, Mn binding, antibiotic resist transferase; 1.83A {Mesorhizobium loti} SCOP: d.32.1.2 Back     alignment and structure
>1jc4_A Methylmalonyl-COA epimerase; vicinal oxygen chelate superfamily, isomerase; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: d.32.1.4 PDB: 1jc5_A Back     alignment and structure
>3r4q_A Lactoylglutathione lyase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.51A {Agrobacterium tumefaciens} Back     alignment and structure
>3oxh_A RV0577 protein; kinase regulation, antibiotic resistance, mycobacterium tube structural genomics, PSI, protein structure initiative; HET: PMB XYL; 1.75A {Mycobacterium tuberculosis} Back     alignment and structure
>4gym_A Glyoxalase/bleomycin resistance protein/dioxygena; PSI-biology, midwest center for structural genomics, MCSG, oxidoreductase; HET: MSE; 1.56A {Conexibacter woesei} Back     alignment and structure
>3kol_A Oxidoreductase, glyoxalase/bleomycin resistance protein/dioxygenase; metal ION binding, NYSGXRC, PSI2, structural genomics; 1.90A {Nostoc punctiforme pcc 73102} Back     alignment and structure
>3rri_A Glyoxalase/bleomycin resistance protein/dioxygena; structural genomics, PSI-biology, midwest center for structu genomics; 1.50A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3gm5_A Lactoylglutathione lyase and related lyases; sheet-helix-sheet-sheet-sheet motif, isomerase; HET: CIT; 2.00A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2za0_A Glyoxalase I; lyase, lactoylglutathione lyase, methyl- gerfelin; HET: MGI; 1.70A {Mus musculus} PDB: 1qip_A* 1fro_A* 1qin_A* 1bh5_A* Back     alignment and structure
>3zw5_A Glyoxalase domain-containing protein 5; lyase; 1.60A {Homo sapiens} Back     alignment and structure
>1twu_A Hypothetical protein YYCE; structural genomics, protein structure initiative, MCSG, DUP of the alpha-beta sandwichs. bacillus subtilis, PSI; 2.00A {Bacillus subtilis} SCOP: d.32.1.8 Back     alignment and structure
>1nki_A Probable fosfomycin resistance protein; potassium binding loop, manganese binding, transferase; 0.95A {Pseudomonas aeruginosa} SCOP: d.32.1.2 PDB: 1lqo_A 1lqk_A 1lqp_A 1nnr_A Back     alignment and structure
>1xqa_A Glyoxalase/bleomycin resistance protein; dioxygenase, structural GEN midwest center for structural genomics, MCSG; HET: P6G; 1.80A {Bacillus cereus atcc 14579} SCOP: d.32.1.2 Back     alignment and structure
>1npb_A Fosfomycin-resistance protein; manganese binding, potassium binding loop, transferase; 2.50A {Serratia marcescens} SCOP: d.32.1.2 Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>3ct8_A Protein BH2160, putative glyoxalase; NP_243026.1, glyoxalase/bleomycin resis protein/dioxygenase superfamily, structural genomics; HET: UNL; 2.10A {Bacillus halodurans c-125} Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>1mpy_A Catechol 2,3-dioxygenase; extradiol dioxygenase, non heme iron dioxygenase, metapyrocatechase, oxidoreductase; 2.80A {Pseudomonas putida} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>3pkv_A Toxoflavin lyase (TFLA); metalloenzyme, vicinal oxygen chelate superfamily; 1.34A {Paenibacillus polymyxa} PDB: 3pkw_A 3pkx_A* 3oul_A 3oum_A* Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>3lm4_A Catechol 2,3-dioxygenase; NYSGXRC, PSI-II, protein structure initiative, 2hydroxyl 6 OXO 6 phenyl hexa 2-4 dienoic acid, peroxide; HET: HPX; 1.80A {Rhodococcus jostii} Back     alignment and structure
>3hpy_A Catechol 2,3-dioxygenase; repeated motifs, aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.94A {Pseudomonas SP} PDB: 3hpv_A 3hq0_A* Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>1zsw_A Metallo protein, glyoxalase family protein; hypothetical protein from glyoxalase family, structural GENO PSI, protein structure initiative; 1.65A {Bacillus cereus} SCOP: d.32.1.10 d.32.1.10 Back     alignment and structure
>3b59_A Glyoxalase/bleomycin resistance protein/dioxygena; 11004Z, NYSGXRC, PSI-2, structural genomics, Pro structure initiative; 2.53A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zyq_A Probable biphenyl-2,3-DIOL 1,2-dioxygenase BPHC; extradiol, DHSA, TB, catechol, cholesterol, steroid, aromatic hydrocarbons catabolism; HET: TAR; 2.00A {Mycobacterium tuberculosis} PDB: 2zi8_A* Back     alignment and structure
>1f1u_A Homoprotocatechuate 2,3-dioxygenase; extradiol, manganese, biodegradation, aromatic, oxidoreductase; 1.50A {Arthrobacter globiformis} SCOP: d.32.1.3 d.32.1.3 PDB: 1f1r_A 1f1v_A* 1f1x_A Back     alignment and structure
>1lgt_A Biphenyl-2,3-DIOL 1,2-dioxygenase; extradiol dioxygenase, 2,3-dihydroxybiphenyl, non-heme iron, anaerobic, PCB biodegradation; HET: BP3; 1.70A {Burkholderia xenovorans} SCOP: d.32.1.3 d.32.1.3 PDB: 1kmy_A* 1knd_A 1knf_A 1han_A* 1lkd_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>3zi1_A Glyoxalase domain-containing protein 4; isomerase; 1.90A {Homo sapiens} Back     alignment and structure
>1kw3_B 2,3-dihydroxybiphenyl dioxygenase; four TIME repetitions of the beta-alpha-beta-BETA-beta motif oxidoreductase; 1.45A {Pseudomonas SP} SCOP: d.32.1.3 d.32.1.3 PDB: 1dhy_A 1eiq_A 1eir_A* 1eil_A 1kw6_B* 1kw8_B* 1kw9_B* 1kwb_B 1kwc_B* Back     alignment and structure
>2wl9_A Catechol 2,3-dioxygenase; aromatic hydrocarbons catabolism, iron, oxidoreductase; 1.90A {Rhodococcus SP} PDB: 2wl3_A Back     alignment and structure
>2ehz_A 1,2-dihydroxynaphthalene dioxygenase; extradiol dioxygenase, protein substrate complex, oxidoreduc; 1.35A {Pseudomonas SP} PDB: 2ei0_A* 2ei1_A* 2ei3_A* 2ei2_A Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>3oaj_A Putative ring-cleaving dioxygenase MHQO; structural genomics, protein structure initiative, PSI-biolo unknown function; 1.40A {Bacillus subtilis subsp} Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>2r5v_A PCZA361.1; dioxygenase, non-heme iron, vancomycin, oxidoreductase; HET: HHH; 2.30A {Amycolatopsis orientalis} Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>4ghg_A Homoprotocatechuate 2,3-dioxygenase; oxygen activation, Fe(II), 2-His-1-carboxylate triad, 4-nitrocatechol, OXY complex, oxidoreductase; HET: P6G PG4 DHY; 1.50A {Brevibacterium fuscum} PDB: 1q0o_A 1q0c_A 2iga_A* 2ig9_A 3ojj_A* 3bza_A* 3ojk_A* 3ojt_A* 3ojn_A* 4ghh_A* 4ghc_A 4ghd_A* 4ghe_A* 4ghf_A* 3eck_A* 3ecj_A* Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>3e0r_A C3-degrading proteinase (CPPA protein); MCSG, PSI, SAD, structural GE protein structure initiative; 2.30A {Streptococcus pneumoniae} Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1sqd_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 1.80A {Arabidopsis thaliana} SCOP: d.32.1.3 d.32.1.3 PDB: 1tfz_A* 1tg5_A* 1sp9_A Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1cjx_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase, iron; 2.40A {Pseudomonas fluorescens} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>1t47_A 4-hydroxyphenylpyruvate dioxygenase; triketone inhibitor, iron, oxidoreductase; HET: NTD; 2.50A {Streptomyces avermitilis} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure
>3isq_A 4-hydroxyphenylpyruvate dioxygenase; tyrosine metabolism, DIS mutation, iron, mental retardation, metal-binding, oxidored phenylalanine catabolism; 1.75A {Homo sapiens} PDB: 1sqi_A* Back     alignment and structure
>1sp8_A 4-hydroxyphenylpyruvate dioxygenase; oxidoreductase; 2.00A {Zea mays} SCOP: d.32.1.3 d.32.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1xy7a_135 d.32.1.9 (A:) Hypothetical protein At5g48480 {Thal 4e-04
d1u7ia_134 d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudom 0.001
d1tsja_129 d.32.1.7 (A:) Hypothetical protein MW1090 {Staphyl 0.002
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 135 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: Hypothetical protein At5g48480
domain: Hypothetical protein At5g48480
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 34.9 bits (79), Expect = 4e-04
 Identities = 34/127 (26%), Positives = 46/127 (36%), Gaps = 37/127 (29%)

Query: 1   MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLSLTFPMIL 60
            K  LLVEA KV DAV  YK+AFGA+E   ++  KRK +QEL   L +   L+ +  ++ 
Sbjct: 7   FKQMLLVEAQKVGDAVTFYKSAFGAIESGHSLYPKRKLDQELPHVLSSELNLAGSSFVVC 66

Query: 61  LQLR-------------------------------------MLELLLRWAARRVGKVKDP 83
                                                    +            GKV DP
Sbjct: 67  DVSSLPGFSTAKSEGSGVTFLLGTKDAEAAVAKAVDAGAVKVEVTEAEVELGFKGKVTDP 126

Query: 84  CGFTWLI 90
            G TW+ 
Sbjct: 127 FGVTWIF 133
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1tsja_129 Hypothetical protein MW1090 {Staphylococcus aureus 99.96
d1u7ia_134 Hypothetical protein PA1358 {Pseudomonas aeruginos 99.96
d1u6la_137 Hypothetical protein PA1353 {Pseudomonas aeruginos 99.95
d1xy7a_135 Hypothetical protein At5g48480 {Thale cress (Arabi 99.92
d1u69a_156 Hypothetical protein PA2721 {Pseudomonas aeruginos 99.9
d2pjsa1111 Uncharacterized protein Atu1953 {Agrobacterium tum 99.3
d2i7ra1115 Hypotheical protein SP0731 {Streptococcus pneumoni 99.28
d1ecsa_120 Bleomycin resistance protein, BRP {Klebsiella pneu 99.24
d1jifa_122 Bleomycin resistance protein, BRP {Streptomyces ve 99.23
d1xrka_120 Bleomycin resistance protein, BRP {Streptoalloteic 99.14
d1r9ca_130 Fosfomycin resistance protein FosX {Mesorhizobium 99.0
d1f9za_135 Glyoxalase I (lactoylglutathione lyase) {Escherich 98.97
d1klla_128 Mitomycin resistance protein D, MRD {Streptomyces 98.97
d2c21a1139 Glyoxalase I (lactoylglutathione lyase) {Leishmani 98.93
d1twua_137 Hypothetical protein YycE {Bacillus subtilis [TaxI 98.73
d1ss4a_149 Hypothetical protein BC1747 {Bacillus cereus (stra 98.71
d1qipa_176 Glyoxalase I (lactoylglutathione lyase) {Human (Ho 98.6
d1nkia_134 Fosfomycin resistance protein A (FosA) {Pseudomona 98.57
d1xqaa_113 Hypothetical protein BC3580 {Bacillus cereus [TaxI 98.55
d1mpya2162 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 98.55
d1npba_140 Fosfomycin resistance protein A (FosA) {Serratia m 98.54
d1zswa1144 Hypothetical protein BC1024 {Bacillus cereus [TaxI 98.5
d1mpya1145 Catechol 2,3-dioxygenase (metapyrocatechase) {Pseu 98.42
d1lgta1131 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 98.39
d1jc4a_145 Methylmalonyl-CoA epimerase {Propionibacterium she 98.34
d1f1ua1146 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 98.32
d1t47a1163 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 98.21
d1kw3b1132 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 98.18
d1sqia1149 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 98.15
d1zswa2170 Hypothetical protein BC1024 {Bacillus cereus [TaxI 98.06
d1f1ua2176 Homoprotocatechuate 2,3-dioxygenase {Arthrobacter 98.05
d1sqda1167 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 97.91
d1kw3b2156 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzy 97.81
d1sp8a1172 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 97.79
d1cjxa2203 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 94.95
d1sp8a2 224 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Z 94.55
d1cjxa1150 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudom 93.1
d1sqia2210 4-hydroxyphenylpyruvate dioxygenase, HppD {Human ( 89.51
d1sqda2 230 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-e 88.2
d1t47a2199 4-hydroxyphenylpyruvate dioxygenase, HppD {Strepto 88.17
>d1tsja_ d.32.1.7 (A:) Hypothetical protein MW1090 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
superfamily: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
family: 3-demethylubiquinone-9 3-methyltransferase
domain: Hypothetical protein MW1090
species: Staphylococcus aureus [TaxId: 1280]

Probab=99.96  E-value=1.2e-29  Score=166.04  Aligned_cols=92  Identities=16%  Similarity=0.232  Sum_probs=71.2

Q ss_pred             CeeEEEeCCCCHHHHHHHHHHhhCCeEEEEecCcccccccccCceEEEEEeeC-Cee------------eEEEEeeCcHH
Q 046408            1 MKPQLLVEASKVTDAVQCYKTAFGAVEINRNMETKRKAEQELNSRLPAPFFLS-LTF------------PMILLQLRMLE   67 (102)
Q Consensus         1 ~~PyL~~~~~~~~eAi~FY~~~fG~~~~~~~~~~~~~~~~~~~~i~ha~l~i~-~~i------------~~l~l~~~d~~   67 (102)
                      |+|||+|+|| |+||++||+++||++++.........+.+..++||||+|+++ ..+            +++++.+++.+
T Consensus         6 i~Pyl~f~g~-a~eAi~FY~~vFg~~~v~~~~~~~~~~~~~~g~i~ha~l~i~g~~~~~~d~~~~~~~~~s~~v~~~~~~   84 (129)
T d1tsja_           6 ITTFLMFNNQ-AEEAVKLYTSLFEDSEIITMAKYGENGPGDPGTVQHSIFTLNGQVFMAIDANSGTELPISLFVTVKDTI   84 (129)
T ss_dssp             EEEEEECSSC-HHHHHHHHHHHSSSCEEEEEEECC-----CTTSEEEEEEEETTEEEEEEC-------CCCEEEECSSHH
T ss_pred             EEEEEEECCC-HHHHHHHHHHHcCCcEEEEEEecCCCCCCCCCcEEEEEEEECCEEEEeecCCCCCCCCEEEEeccCCHH
Confidence            5899999987 999999999999876554312111111223368999999999 666            68888888776


Q ss_pred             HH---H---------------hhhcCeEEEEEcCCCCEEEEecc
Q 046408           68 LL---L---------------RWAARRVGKVKDPCGFTWLICSP   93 (102)
Q Consensus        68 ~~---~---------------~~wG~~~g~v~D~fGv~W~i~~~   93 (102)
                      ++   |               +|||.|||+|+||||+.|+|+.|
T Consensus        85 e~~~~~~~L~~gg~v~~p~~~~~~g~~~g~v~D~fGv~W~i~~p  128 (129)
T d1tsja_          85 EMERLFNGLKDEGAILMPKTNMPPYREFAWVQDKFGVSFQLALP  128 (129)
T ss_dssp             HHHHHHHHHHTTCEEEEEEEEETTEEEEEEEECTTSCEEEEEEC
T ss_pred             HHHHHHHHhccCCEEecccccccccceEEEEECCCCCEEEEeCC
Confidence            54   3               79999999999999999999986
>d1u7ia_ d.32.1.7 (A:) Hypothetical protein PA1358 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u6la_ d.32.1.7 (A:) Hypothetical protein PA1353 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xy7a_ d.32.1.9 (A:) Hypothetical protein At5g48480 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1u69a_ d.32.1.7 (A:) Hypothetical protein PA2721 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2i7ra1 d.32.1.2 (A:1-115) Hypotheical protein SP0731 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ecsa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1jifa_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptomyces verticillus [TaxId: 29309]} Back     information, alignment and structure
>d1xrka_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Streptoalloteichus hindustanus [TaxId: 2017]} Back     information, alignment and structure
>d1r9ca_ d.32.1.2 (A:) Fosfomycin resistance protein FosX {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1f9za_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klla_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d2c21a1 d.32.1.1 (A:3-141) Glyoxalase I (lactoylglutathione lyase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1twua_ d.32.1.8 (A:) Hypothetical protein YycE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ss4a_ d.32.1.6 (A:) Hypothetical protein BC1747 {Bacillus cereus (strain ATCC 14579 / DSM 31) [TaxId: 226900]} Back     information, alignment and structure
>d1qipa_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkia_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mpya2 d.32.1.3 (A:146-307) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1npba_ d.32.1.2 (A:) Fosfomycin resistance protein A (FosA) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1zswa1 d.32.1.10 (A:1-144) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mpya1 d.32.1.3 (A:1-145) Catechol 2,3-dioxygenase (metapyrocatechase) {Pseudomonas putida, mt2 [TaxId: 303]} Back     information, alignment and structure
>d1lgta1 d.32.1.3 (A:2-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Burkholderia cepacia, formerly Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1jc4a_ d.32.1.4 (A:) Methylmalonyl-CoA epimerase {Propionibacterium shermanii [TaxId: 1752]} Back     information, alignment and structure
>d1f1ua1 d.32.1.3 (A:2-147) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1t47a1 d.32.1.3 (A:16-178) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1kw3b1 d.32.1.3 (B:1-132) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1sqia1 d.32.1.3 (A:8-156) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zswa2 d.32.1.10 (A:145-314) Hypothetical protein BC1024 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1f1ua2 d.32.1.3 (A:148-323) Homoprotocatechuate 2,3-dioxygenase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1sqda1 d.32.1.3 (A:14-180) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kw3b2 d.32.1.3 (B:133-288) 2,3-Dihydroxybiphenyl dioxygenase (DHBD, BPHC enzyme) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1sp8a1 d.32.1.3 (A:36-207) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1cjxa2 d.32.1.3 (A:154-356) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sp8a2 d.32.1.3 (A:208-431) 4-hydroxyphenylpyruvate dioxygenase, HppD {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1cjxa1 d.32.1.3 (A:4-153) 4-hydroxyphenylpyruvate dioxygenase, HppD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1sqia2 d.32.1.3 (A:157-366) 4-hydroxyphenylpyruvate dioxygenase, HppD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sqda2 d.32.1.3 (A:181-410) 4-hydroxyphenylpyruvate dioxygenase, HppD {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t47a2 d.32.1.3 (A:179-377) 4-hydroxyphenylpyruvate dioxygenase, HppD {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure