Citrus Sinensis ID: 046441

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-----
CPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGIQCSNSSSSSRRYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKEEDSIN
ccccEEEcccccccHHHHHccccccccEEEEEcccccEEccccccccccccEEEEEccccccccccccccccccEEEEEEccccEEEcccccccccccccEEEEEEcccccccccccccccccEEEEcccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEEccccccccHHcccccccccEEEEEcccccccccccccccccccEEEEEEccccEEccccccccccccEEEEEcccccccccccccccccccEEEEEccccccccccccccccccEEEEcccccccccHHHHcccccccccccEEEEccccccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccHHHHHHHcccccccccccccccEEEEccEEEccccc
cccHHHccccccccccccccccccccEEEEccccccHHcccccccccccccEEEccccccHcccccccccccccEEEccccccHccccHHccccccccccEEEEcccccccccccccccccccEEEccccccHHcccHHHccccHHHHccccccccccccEccccccccHHcccHHcccccccccccccccccccEEEEEcccccHHccccHccccccccEEEEcccccHccccccccccccccEEEccccccHccccccccccccccEEEEcccHHHHcccccccccccccEEEEcccccccccccccccccccEEEEcccHHHHHHHHHccccHcccccccEEEEcccccHcccccHHcccccHHccccccccEEEEcccccHHHccHHccccccccEEEEcccccHccccccccccHHcEEEEcccHHHHHcccccccccccccccccEEEEcccccccccc
cpklqslvAEEEKDQQQQLCELSCRLEYLRLRYCEGLvklpqsslslsslreieickcsslvsfpevalpsklkkIRISSCDAlkslpeawmcdtnsslEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEegiqcsnssssSRRYISSLLEHleigncrsltcifsknelpatleslevgnlppslkvldiygcpklESIAErldnntsletISILCCENLKILPSGLHNLRQLQEIsiekcgnlesfpegglpcaklsklriYGCERLEALPKGLHNLKSLQELrigrgvelpsleedglptnlhsleidGNMEIWKSTIEWGRGFHRFSSLRCLaisgcdddmvsfpledkrlgtalplpACLASlmignfpnlerlsssivdlqnltelylgdcpklkyfpekglpssLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLakeedsin
cpklqslvaeeekdqQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLtveegiqcsnssssSRRYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVelpsleedglptnlhsleidGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVlidlakeedsin
CPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQsslslsslREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGIQCsnsssssrryissLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKEEDSIN
******************LCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEG************YISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLA*****************LGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDL********
CPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEG***********RYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKE*****
*****************QLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGI**********RYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKEEDSIN
CPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGIQCSNSSSSSRRYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLA*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CPKLQSLVAEEEKDQQQQLCELSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGIQCSNSSSSSRRYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKEEDSIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query465 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.701 0.228 0.323 1e-26
O23530 1301 Protein SUPPRESSOR OF npr no no 0.855 0.305 0.251 2e-08
Q7XA39988 Putative disease resistan N/A no 0.172 0.080 0.419 7e-08
Q7XBQ9970 Disease resistance protei N/A no 0.249 0.119 0.341 4e-07
Q7XA40992 Putative disease resistan N/A no 0.286 0.134 0.325 1e-06
Q9FKZ0815 Probable disease resistan no no 0.307 0.175 0.287 1e-06
Q9FKZ1809 Probable disease resistan no no 0.378 0.217 0.272 4e-06
Q9LZ25811 Probable disease resistan no no 0.260 0.149 0.294 3e-05
Q42484909 Disease resistance protei no no 0.408 0.209 0.280 5e-05
Q9LVT1623 Putative disease resistan no no 0.172 0.128 0.281 7e-05
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 127/393 (32%), Positives = 184/393 (46%), Gaps = 67/393 (17%)

Query: 69   LPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHIL 128
            LP  L+ + I SCD L SLPE  + ++  +L  L I  C SL    G   P +LK L+I 
Sbjct: 1089 LPQNLQSLHIDSCDGLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIR 1147

Query: 129  LCNNIRTLTVEEGIQCSNSSSSSRRYISSLLEHLEIGN-CRSLTCIFSKNELPATLESLE 187
             C   + L   E +Q + S S         LE+L IG+ C +L                 
Sbjct: 1148 DC---KKLNFTESLQPTRSYSQ--------LEYLFIGSSCSNLV---------------- 1180

Query: 188  VGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILP--SGLHNLR-QLQ 244
              N P SL        PKL S+             SI  CE+ K     +GL + R  L+
Sbjct: 1181 --NFPLSL-------FPKLRSL-------------SIRDCESFKTFSIHAGLGDDRIALE 1218

Query: 245  EISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPS 304
             + I  C NLE+FP+GGLP  KLS + +  C++L+ALP+ L  L SL  L I +  E+ +
Sbjct: 1219 SLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLFGLTSLLSLFIIKCPEIET 1278

Query: 305  LEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRL 364
            +   G P+NL +L I    ++    IEW  G     +LR L I G ++D+ SFP E    
Sbjct: 1279 IPGGGFPSNLRTLCISLCDKL-TPRIEW--GLRDLENLRNLEIDGGNEDIESFPEEGL-- 1333

Query: 365  GTALPLPACLASLMIGNFPNLERLS-SSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLR 423
                 LP  + SL I  F NL+ L+     D + +  + +  C KL+   ++ LP  L  
Sbjct: 1334 -----LPKSVFSLRISRFENLKTLNRKGFHDTKAIETMEISGCDKLQISIDEDLP-PLSC 1387

Query: 424  LYIDECPLIAEKCRKDGGQYWDLLTHIPSVLID 456
            L I  C L+ E   +   +++ +L +IP V ID
Sbjct: 1388 LRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q9FKZ0|DRL43_ARATH Probable disease resistance protein At5g66910 OS=Arabidopsis thaliana GN=At5g66910 PE=2 SV=1 Back     alignment and function description
>sp|Q9FKZ1|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1 Back     alignment and function description
>sp|Q9LZ25|DRL30_ARATH Probable disease resistance protein At5g04720 OS=Arabidopsis thaliana GN=At5g04720 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT1|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
356554923 1399 PREDICTED: putative disease resistance R 0.808 0.268 0.442 4e-68
224132254552 predicted protein [Populus trichocarpa] 0.937 0.789 0.421 2e-67
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.907 0.296 0.398 9e-62
45826061 739 resistance protein [Quercus suber] 0.886 0.557 0.391 1e-58
400131587 1388 FB_MR5 [Malus x robusta] 0.810 0.271 0.378 2e-53
359487255 1336 PREDICTED: putative disease resistance p 0.782 0.272 0.362 7e-53
147777746 1199 hypothetical protein VITISV_010202 [Viti 0.767 0.297 0.364 2e-52
224059584 1418 cc-nbs-lrr resistance protein [Populus t 0.840 0.275 0.371 2e-50
225449649 1418 PREDICTED: putative disease resistance p 0.868 0.284 0.364 3e-49
296085123 1278 unnamed protein product [Vitis vinifera] 0.825 0.300 0.359 3e-49
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  265 bits (677), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 181/409 (44%), Positives = 242/409 (59%), Gaps = 33/409 (8%)

Query: 68   ALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQLPRSLKRLHI 127
             L S L+ I I +C+ +KS+P+  M +++  LE L I  C S+ ++   QLP SLK L I
Sbjct: 993  GLSSILRLIEIRNCNIMKSIPKVLMVNSHF-LERLYICHCDSIVFVTMDQLPHSLKSLEI 1051

Query: 128  LLCNNIRTLTVEEGIQCSNSS----SSSRRYISSLLEHLE---IGNCRSLTCIFSKNELP 180
              C N+R L ++ G  C++SS      + ++ S+++ HLE   IG C SLTCI    ELP
Sbjct: 1052 SNCKNLRCL-LDNG-TCTSSSIIMHDDNVQHGSTIISHLEYVYIGWCPSLTCISRSGELP 1109

Query: 181  ATLESLEV------------GNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCE 228
             +++ L +            G LP S++ L+I  CPKLESIA RL  NTSLE+I I  CE
Sbjct: 1110 ESVKHLFIWNCSELSCLSMKGQLPKSIERLEIQSCPKLESIANRLHRNTSLESIQIWNCE 1169

Query: 229  NLKILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNL 288
            NLK LP GLH L  L+EI I  C NL SFPE GLP + LS+L I  CE+L ALP  ++NL
Sbjct: 1170 NLKSLPEGLHFLVNLKEIKIIGCPNLVSFPEEGLPASSLSELSIMSCEKLVALPNSMYNL 1229

Query: 289  KSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAIS 348
             SL+EL IG    +    E   P NL SL I+ +    ++   W  G ++ S LR L I 
Sbjct: 1230 DSLKELEIGYCPSIQYFPEINFPDNLTSLWINDHNAC-EAMFNW--GLYKLSFLRDLTII 1286

Query: 349  GCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSS-SIVDLQNLTELYLGDCP 407
            G +  M   PLE  +LGT   LP+ L SL +  FP+LE LSS     L +L++L + +CP
Sbjct: 1287 GGNLFM---PLE--KLGTM--LPSTLTSLTVQGFPHLENLSSEGFHKLTSLSKLSIYNCP 1339

Query: 408  KLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLID 456
            KL   PEKGLPSSLL LYI +CP + E+CRKD G+ W  +  +P V ID
Sbjct: 1340 KLLCLPEKGLPSSLLELYIQDCPFLKEQCRKDKGRDWLKIADVPYVEID 1388

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224132254|ref|XP_002328223.1| predicted protein [Populus trichocarpa] gi|222837738|gb|EEE76103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
>gi|359487255|ref|XP_002269744.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147777746|emb|CAN60302.1| hypothetical protein VITISV_010202 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224059584|ref|XP_002299919.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222847177|gb|EEE84724.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085123|emb|CBI28618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query465
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.780 0.254 0.291 4.9e-25
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.804 0.289 0.270 4.3e-16
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.754 0.288 0.266 6.7e-16
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.780 0.183 0.25 2.1e-15
TAIR|locus:2205804 1556 AT1G27180 [Arabidopsis thalian 0.827 0.247 0.261 9.1e-15
TAIR|locus:2098110 1219 AT3G44670 [Arabidopsis thalian 0.436 0.166 0.318 1.1e-13
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.610 0.239 0.261 1.4e-13
TAIR|locus:2205824 1384 AT1G27170 [Arabidopsis thalian 0.823 0.276 0.257 9.9e-13
TAIR|locus:21479921189 AT5G11250 [Arabidopsis thalian 0.593 0.232 0.267 5.9e-12
TAIR|locus:2028681 1161 AT1G31540 [Arabidopsis thalian 0.494 0.198 0.290 2.7e-11
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 293 (108.2 bits), Expect = 4.9e-25, Sum P(2) = 4.9e-25
 Identities = 121/415 (29%), Positives = 201/415 (48%)

Query:    59 SSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEILEIWICCSLTYIAGVQL 118
             SS   + +  + S +   R  S +A+K  P  +  D  + +E L++     ++++  ++L
Sbjct:  1040 SSSYQYHQYGIKSSVPSPR--SSEAIK--PSQYD-DDETDMEYLKV---TDISHL--MEL 1089

Query:   119 PRSLKRLHILLCNNIRTL--TVEEG---------IQCXXXXXXXXXXXXXLLEHLEIGNC 167
             P++L+ LHI  C+ + +L   + E          I C              L+ L I +C
Sbjct:  1090 PQNLQSLHIDSCDGLTSLPENLTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDC 1149

Query:   168 RSLTCIFSKNELP----ATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETIS 223
             + L   F+++  P    + LE L +G+   +L    +   PKL S++ R  +  S +T S
Sbjct:  1150 KKLN--FTESLQPTRSYSQLEYLFIGSSCSNLVNFPLSLFPKLRSLSIR--DCESFKTFS 1205

Query:   224 ILCCENLKILPSGLHNLR-QLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALP 282
             I          +GL + R  L+ + I  C NLE+FP+GGLP  KLS + +  C++L+ALP
Sbjct:  1206 I---------HAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALP 1256

Query:   283 KGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSL 342
             + L  L SL  L I +  E+ ++   G P+NL +L I    ++    IEWG       +L
Sbjct:  1257 EKLFGLTSLLSLFIIKCPEIETIPGGGFPSNLRTLCISLCDKL-TPRIEWG--LRDLENL 1313

Query:   343 RCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLS-SSIVDLQNLTEL 401
             R L I G ++D+ SFP E    G    LP  + SL I  F NL+ L+     D + +  +
Sbjct:  1314 RNLEIDGGNEDIESFPEE----GL---LPKSVFSLRISRFENLKTLNRKGFHDTKAIETM 1366

Query:   402 YLGDCPKLKYFPEKGLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLID 456
              +  C KL+   ++ LP  L  L I  C L+ E   +   +++ +L +IP V ID
Sbjct:  1367 EISGCDKLQISIDEDLPP-LSCLRISSCSLLTETFAEVETEFFKVL-NIPYVEID 1419
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205804 AT1G27180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205824 AT1G27170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028681 AT1G31540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00660113
hypothetical protein (552 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
PLN03210 1153 PLN03210, PLN03210, Resistant to P 9e-11
PLN03210 1153 PLN03210, PLN03210, Resistant to P 3e-10
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-08
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 64.1 bits (156), Expect = 9e-11
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 41/238 (17%)

Query: 195 LKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNL 254
           L+ +D+ G   L+ I + L   T+LET+ +  C +L  LPS +  L +L+++ + +C NL
Sbjct: 636 LRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL 694

Query: 255 ESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNL 314
           E  P G +    L +L + GC RL++ P    N+  L        ++  ++EE   P+NL
Sbjct: 695 EILPTG-INLKSLYRLNLSGCSRLKSFPDISTNISWLD-------LDETAIEE--FPSNL 744

Query: 315 HSLEIDG-NMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLEDKRLGTAL--PLP 371
               +D   +   KS   W R                            +  T L   L 
Sbjct: 745 RLENLDELILCEMKSEKLWER---------------------------VQPLTPLMTMLS 777

Query: 372 ACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSLLRLYIDEC 429
             L  L + + P+L  L SSI +L  L  L + +C  L+  P      SL  L +  C
Sbjct: 778 PSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 465
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.77
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.49
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.47
KOG4341483 consensus F-box protein containing LRR [General fu 99.42
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.25
KOG4341483 consensus F-box protein containing LRR [General fu 99.21
KOG4237498 consensus Extracellular matrix protein slit, conta 99.2
KOG0617264 consensus Ras suppressor protein (contains leucine 99.17
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.16
KOG0617264 consensus Ras suppressor protein (contains leucine 99.14
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.9
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.88
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.84
PRK15386 426 type III secretion protein GogB; Provisional 98.65
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.65
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.6
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.59
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.53
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.42
PRK15386426 type III secretion protein GogB; Provisional 98.42
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.39
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.39
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.32
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.26
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.25
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.05
PLN03150623 hypothetical protein; Provisional 98.04
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.98
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.94
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.92
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.86
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.84
PLN03150623 hypothetical protein; Provisional 97.81
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.75
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.55
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.54
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.43
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.4
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.09
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.94
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.46
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.19
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.27
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.88
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.33
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.04
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 94.02
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.42
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 93.32
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.82
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.81
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.75
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.0
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.64
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.95  E-value=3.6e-27  Score=255.51  Aligned_cols=413  Identities=17%  Similarity=0.139  Sum_probs=197.4

Q ss_pred             cccccceeecccCCCCcccccccccCCCCcEEEecCCCCCCCCC-CCcCcCcccEEEccCCccccccccccccCCCCCcc
Q 046441           22 LSCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFP-EVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLE  100 (465)
Q Consensus        22 ~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~-~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~  100 (465)
                      .+++|++|++++|.....+|..++++++|++|++++|.....+| .++.+++|++|++++|.....+|..+  ...++|+
T Consensus       138 ~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l--~~l~~L~  215 (968)
T PLN00113        138 SIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPREL--GQMKSLK  215 (968)
T ss_pred             ccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHH--cCcCCcc
Confidence            35778888888777645667777777888888887774444455 45567777777777765433444432  2346677


Q ss_pred             EEEecCCcCcceecCc-cCCCCccEEeeccccCccccccccccccCC-------------CCCCchhhhcccCCeeeccC
Q 046441          101 ILEIWICCSLTYIAGV-QLPRSLKRLHILLCNNIRTLTVEEGIQCSN-------------SSSSSRRYISSLLEHLEIGN  166 (465)
Q Consensus       101 ~L~l~~~~~l~~~~~~-~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~-------------~~~~~~~~~~~~L~~L~l~~  166 (465)
                      .|+++++.....++.. ..+++|+.|++++|.-...+  |..+....             ...+.....+++|++|++++
T Consensus       216 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~--p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~  293 (968)
T PLN00113        216 WIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPI--PSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSD  293 (968)
T ss_pred             EEECcCCccCCcCChhHhcCCCCCEEECcCceecccc--ChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcC
Confidence            7777766322233322 44566666666665322223  33333200             00000000133444444443


Q ss_pred             CCCccccccCCCcchhhhhcccCCCCCCccEEEecCCCChhhhhhhhcCCCCCcEEeccccccccccccccccCccccEE
Q 046441          167 CRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEI  246 (465)
Q Consensus       167 c~~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~~~~~~~L~~L  246 (465)
                      + .+..     .+|..+     ..+ ++|+.|++.+|...+.+|..+..+++|+.|++++|...+.+|..+..+++|+.|
T Consensus       294 n-~l~~-----~~p~~~-----~~l-~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L  361 (968)
T PLN00113        294 N-SLSG-----EIPELV-----IQL-QNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVL  361 (968)
T ss_pred             C-eecc-----CCChhH-----cCC-CCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEE
Confidence            2 2211     111111     122 445555555544333444445555555555555554444444445555555555


Q ss_pred             ecccCcccccCCCCCCCCCCCceEEEecCCCcCcccccccCCCcccceeeccCCCCCccCC-CCCCCccceeeecCCccc
Q 046441          247 SIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEE-DGLPTNLHSLEIDGNMEI  325 (465)
Q Consensus       247 ~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~-~~~~~~L~~L~l~~~~~~  325 (465)
                      ++++|.....+|.....+++|+.|++++|.....+|..++.+++|+.|++++|......+. ...+++|+.|++++|.. 
T Consensus       362 ~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l-  440 (968)
T PLN00113        362 DLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNL-  440 (968)
T ss_pred             ECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcc-
Confidence            5555432223333333333444444444443334444444455555555555432222221 12334444444444441 


Q ss_pred             ccccccccccCCCCCCccEEEecCCCCccccccccc------------ccc----cCCCCCccccceEeccCCCCCc-cc
Q 046441          326 WKSTIEWGRGFHRFSSLRCLAISGCDDDMVSFPLED------------KRL----GTALPLPACLASLMIGNFPNLE-RL  388 (465)
Q Consensus       326 ~~~~~~~~~~~~~~~~L~~L~l~~~~~~l~~~~~~~------------~~~----~~~~~~~~~L~~L~l~~c~~l~-~l  388 (465)
                      ....+..   +..+++|++|++++| .-...+|...            +.+    ...+..+++|++|+++++ ++. .+
T Consensus       441 ~~~~~~~---~~~l~~L~~L~L~~n-~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N-~l~~~~  515 (968)
T PLN00113        441 QGRINSR---KWDMPSLQMLSLARN-KFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN-KLSGEI  515 (968)
T ss_pred             cCccChh---hccCCCCcEEECcCc-eeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCC-cceeeC
Confidence            1111111   223444444444443 0001111100            000    011234567777777774 444 55


Q ss_pred             cccccCCCCcceEEecCCCCCCcCCCC-CCcccccEEeecCCchHHHHHhhcCCCcccccCCcceEeecCchhh
Q 046441          389 SSSIVDLQNLTELYLGDCPKLKYFPEK-GLPSSLLRLYIDECPLIAEKCRKDGGQYWDLLTHIPSVLIDLAKEE  461 (465)
Q Consensus       389 ~~~~~~l~~L~~L~l~~c~~l~~l~~~-~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  461 (465)
                      |..+.++++|++|++++|.--..+|.. .-+++|++|++++|.....     .......+..+..+.+.++...
T Consensus       516 p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~-----~p~~l~~l~~L~~l~ls~N~l~  584 (968)
T PLN00113        516 PDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGE-----IPKNLGNVESLVQVNISHNHLH  584 (968)
T ss_pred             ChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCccccc-----CChhHhcCcccCEEeccCCcce
Confidence            666777788888888875433334442 1257788888887754321     1112334455556666655443

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query465
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 88.1 bits (219), Expect = 2e-19
 Identities = 55/321 (17%), Positives = 100/321 (31%), Gaps = 43/321 (13%)

Query: 26  LEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALK 85
            E L  +    L                +  +  S          S   +I   +  ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 86  SLPEAWMCDTNSSLEILEIWICCSLTYI-AGVQLPRSLKRLHILLCNNIRTLTVEEGIQC 144
           +  +     T      LE+     L            L+ +  +    +  L      Q 
Sbjct: 70  ATADLLEDATQPGRVALELR-SVPLPQFPDQAFRLSHLQHMT-IDAAGLMELPDTMQ-QF 126

Query: 145 SNSSSSSRRYISSLLEHL------------EIGNCRSLTCI-FSKN----ELPATLESLE 187
           +             LE L             I +   L  +         ELP  L S +
Sbjct: 127 AG------------LETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTD 174

Query: 188 VGNLP---PSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQ 244
                    +L+ L +     + S+   + N  +L+++ I     L  L   +H+L +L+
Sbjct: 175 ASGEHQGLVNLQSLRLEWT-GIRSLPASIANLQNLKSLKIRNS-PLSALGPAIHHLPKLE 232

Query: 245 EISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPS 304
           E+ +  C  L ++P      A L +L +  C  L  LP  +H L  L++L +   V L  
Sbjct: 233 ELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSR 292

Query: 305 L-EEDGLPTNLHSLEIDGNME 324
           L            + +  +++
Sbjct: 293 LPSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.95
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.88
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.81
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.81
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.81
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.81
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.8
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.8
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.78
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.76
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.69
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.67
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.65
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.64
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.64
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.63
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.57
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.5
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.47
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.45
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.45
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.44
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.42
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.41
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.41
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.39
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.35
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.32
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.27
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.27
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.25
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.14
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.13
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.1
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.97
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.94
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.93
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.9
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.88
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.88
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.87
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.81
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.62
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.62
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.61
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.55
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.22
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.05
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.0
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.23
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.17
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.08
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.71
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.2
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.05
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 88.52
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=281.88  Aligned_cols=390  Identities=18%  Similarity=0.154  Sum_probs=225.3

Q ss_pred             ccccceeecccCCCCccccccccc-CCCCcEEEecCCCCCCCCC-CCcCcCcccEEEccCCccccccccccccCCCCCcc
Q 046441           23 SCRLEYLRLRYCEGLVKLPQSSLS-LSSLREIEICKCSSLVSFP-EVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLE  100 (465)
Q Consensus        23 ~~~L~~L~l~~~~~l~~l~~~~~~-l~~L~~L~l~~~~~l~~~~-~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~  100 (465)
                      +++|++|++++|.....+|..+.. +++|++|++++|..-..+| .++.+++|++|++++|.....++.... ...++|+
T Consensus       268 l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l-~~l~~L~  346 (768)
T 3rgz_A          268 LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTL-LKMRGLK  346 (768)
T ss_dssp             CTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHH-TTCTTCC
T ss_pred             cCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHH-hcCCCCC
Confidence            456666666666553355555444 3666666666653222333 344456666666666542224443211 2335555


Q ss_pred             EEEecCCcCcc-eecCc-cC---------------------------CCCccEEeeccccCccccccccccccCCCCCCc
Q 046441          101 ILEIWICCSLT-YIAGV-QL---------------------------PRSLKRLHILLCNNIRTLTVEEGIQCSNSSSSS  151 (465)
Q Consensus       101 ~L~l~~~~~l~-~~~~~-~~---------------------------~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~  151 (465)
                      +|++++|. +. .++.. ..                           +++|+.|++.+|.-...+  |..+..       
T Consensus       347 ~L~Ls~n~-l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~--p~~l~~-------  416 (768)
T 3rgz_A          347 VLDLSFNE-FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI--PPTLSN-------  416 (768)
T ss_dssp             EEECCSSE-EEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEEC--CGGGGG-------
T ss_pred             EEeCcCCc-cCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccccc--CHHHhc-------
Confidence            55555542 22 22221 11                           234555555443222222  333333       


Q ss_pred             hhhhcccCCeeeccCCCCccccccCCCcchhhhhcccCCCCCCccEEEecCCCChhhhhhhhcCCCCCcEEecccccccc
Q 046441          152 RRYISSLLEHLEIGNCRSLTCIFSKNELPATLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLK  231 (465)
Q Consensus       152 ~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~l~~~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~  231 (465)
                          +++|++|++++ +.++.     .+|..+     ..+ ++|+.|++.+|...+.+|..+..+++|++|++++|...+
T Consensus       417 ----l~~L~~L~Ls~-N~l~~-----~~p~~l-----~~l-~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~  480 (768)
T 3rgz_A          417 ----CSELVSLHLSF-NYLSG-----TIPSSL-----GSL-SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTG  480 (768)
T ss_dssp             ----CTTCCEEECCS-SEEES-----CCCGGG-----GGC-TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCS
T ss_pred             ----CCCCCEEECcC-CcccC-----cccHHH-----hcC-CCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccC
Confidence                56677777766 34432     222233     333 677777777766555667777777788888888777666


Q ss_pred             ccccccccCccccEEecccCcccccCCCCCCCCCCCceEEEecCCCcCcccccccCCCcccceeeccCCCCCccCC----
Q 046441          232 ILPSGLHNLRQLQEISIEKCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEE----  307 (465)
Q Consensus       232 ~l~~~~~~~~~L~~L~l~~~~~l~~l~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~----  307 (465)
                      .+|..+..+++|++|++++|.....+|..+..+++|+.|++++|.....+|..++.+++|++|++++|.....+|.    
T Consensus       481 ~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~  560 (768)
T 3rgz_A          481 EIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFK  560 (768)
T ss_dssp             CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGT
T ss_pred             cCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhc
Confidence            6777777778888888887754446666666677788888888776667777777778888888777642222211    


Q ss_pred             -------------------------------------------------------------------CCCCCccceeeec
Q 046441          308 -------------------------------------------------------------------DGLPTNLHSLEID  320 (465)
Q Consensus       308 -------------------------------------------------------------------~~~~~~L~~L~l~  320 (465)
                                                                                         .+.+++|++|+++
T Consensus       561 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs  640 (768)
T 3rgz_A          561 QSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS  640 (768)
T ss_dssp             TTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECC
T ss_pred             ccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECc
Confidence                                                                               1223567778887


Q ss_pred             CCcccccccccccccCCCCCCccEEEecCCCCccc-ccccccccccCCCCCccccceEeccCCCCCc-cccccccCCCCc
Q 046441          321 GNMEIWKSTIEWGRGFHRFSSLRCLAISGCDDDMV-SFPLEDKRLGTALPLPACLASLMIGNFPNLE-RLSSSIVDLQNL  398 (465)
Q Consensus       321 ~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~l~-~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~-~l~~~~~~l~~L  398 (465)
                      +|. +....+..   +..+++|+.|++++|  .+. .+|...       ..+++|+.|++++ ++++ .+|..+..++.|
T Consensus       641 ~N~-l~g~ip~~---l~~l~~L~~L~Ls~N--~l~g~ip~~l-------~~L~~L~~LdLs~-N~l~g~ip~~l~~l~~L  706 (768)
T 3rgz_A          641 YNM-LSGYIPKE---IGSMPYLFILNLGHN--DISGSIPDEV-------GDLRGLNILDLSS-NKLDGRIPQAMSALTML  706 (768)
T ss_dssp             SSC-CBSCCCGG---GGGCTTCCEEECCSS--CCCSCCCGGG-------GGCTTCCEEECCS-SCCEECCCGGGGGCCCC
T ss_pred             CCc-ccccCCHH---HhccccCCEEeCcCC--ccCCCCChHH-------hCCCCCCEEECCC-CcccCcCChHHhCCCCC
Confidence            776 33333322   567788888888886  443 455544       3567888888888 5666 667788888888


Q ss_pred             ceEEecCCCCCCcCCCCCCcccccEEeecCCchHH----HHHhhcCCCcccccCCcceE
Q 046441          399 TELYLGDCPKLKYFPEKGLPSSLLRLYIDECPLIA----EKCRKDGGQYWDLLTHIPSV  453 (465)
Q Consensus       399 ~~L~l~~c~~l~~l~~~~~~~~L~~L~l~~c~~l~----~~~~~~~~~~~~~~~~~~~~  453 (465)
                      ++|++++|+--..+|....+.++....+.+|+.|-    ..|....+++|+++.|++++
T Consensus       707 ~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~  765 (768)
T 3rgz_A          707 TEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHH  765 (768)
T ss_dssp             SEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC-------------
T ss_pred             CEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCcccc
Confidence            88888885544457776666667666676765332    25778888999999999974
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 465
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 38.9 bits (89), Expect = 0.001
 Identities = 34/161 (21%), Positives = 61/161 (37%), Gaps = 7/161 (4%)

Query: 190 NLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIE 249
           +LPP   +LD+      E       N  +L T+ ++  +  KI P     L +L+ + + 
Sbjct: 28  DLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLS 87

Query: 250 KCGNLESFPEGGLPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDG 309
           K   L+  PE      +  +LR++  E  +      + L  +  + +G      S  E+G
Sbjct: 88  KN-QLKELPEKMPKTLQ--ELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENG 144

Query: 310 LPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSSLRCLAISGC 350
               +  L      +   +TI  G       SL  L + G 
Sbjct: 145 AFQGMKKLSYIRIADTNITTIPQG----LPPSLTELHLDGN 181

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query465
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.6
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.45
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.37
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.99
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.98
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.98
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.94
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.94
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.67
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.38
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.02
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.73
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.28
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.0
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.32
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.87  E-value=2.6e-20  Score=177.58  Aligned_cols=340  Identities=19%  Similarity=0.203  Sum_probs=208.6

Q ss_pred             ccccceeecccCCCCcccccccccCCCCcEEEecCCCCCCCCCCCcCcCcccEEEccCCccccccccccccCCCCCccEE
Q 046441           23 SCRLEYLRLRYCEGLVKLPQSSLSLSSLREIEICKCSSLVSFPEVALPSKLKKIRISSCDALKSLPEAWMCDTNSSLEIL  102 (465)
Q Consensus        23 ~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~L~~L  102 (465)
                      ..+|++|++++++. +.+. +++.+++|++|++++| .++++++++.+++|++|++++|. +.+++..   ..+++|+.|
T Consensus        43 l~~l~~L~l~~~~I-~~l~-gl~~L~nL~~L~Ls~N-~l~~l~~l~~L~~L~~L~L~~n~-i~~i~~l---~~l~~L~~L  115 (384)
T d2omza2          43 LDQVTTLQADRLGI-KSID-GVEYLNNLTQINFSNN-QLTDITPLKNLTKLVDILMNNNQ-IADITPL---ANLTNLTGL  115 (384)
T ss_dssp             HTTCCEEECCSSCC-CCCT-TGGGCTTCCEEECCSS-CCCCCGGGTTCTTCCEEECCSSC-CCCCGGG---TTCTTCCEE
T ss_pred             hCCCCEEECCCCCC-CCcc-ccccCCCCCEEeCcCC-cCCCCccccCCcccccccccccc-ccccccc---ccccccccc
Confidence            36788888888876 6653 5778888999999887 67888878888889999988865 6666543   556888888


Q ss_pred             EecCCcCcceecCccCCCCccEEeeccccCccccccccccccCCCCCCchhhhcccCCeeecc-CCCCccccccCCCcch
Q 046441          103 EIWICCSLTYIAGVQLPRSLKRLHILLCNNIRTLTVEEGIQCSNSSSSSRRYISSLLEHLEIG-NCRSLTCIFSKNELPA  181 (465)
Q Consensus       103 ~l~~~~~l~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~-~c~~l~~~~~~~~~~~  181 (465)
                      ++.++ .+..+........+........ .+...  ......            ......... ....+.. +       
T Consensus       116 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~-~l~~~--~~~~~~------------~~~~~~~~~~~~~~~~~-~-------  171 (384)
T d2omza2         116 TLFNN-QITDIDPLKNLTNLNRLELSSN-TISDI--SALSGL------------TSLQQLSFGNQVTDLKP-L-------  171 (384)
T ss_dssp             ECCSS-CCCCCGGGTTCTTCSEEEEEEE-EECCC--GGGTTC------------TTCSEEEEEESCCCCGG-G-------
T ss_pred             ccccc-cccccccccccccccccccccc-ccccc--cccccc------------ccccccccccccchhhh-h-------
Confidence            88776 4544444433334444433221 11111  000000            000000000 0011111 0       


Q ss_pred             hhhhcccCCCCCCccEEEecCCCChhhhhhhhcCCCCCcEEeccccccccccccccccCccccEEecccCcccccCCCCC
Q 046441          182 TLESLEVGNLPPSLKVLDIYGCPKLESIAERLDNNTSLETISILCCENLKILPSGLHNLRQLQEISIEKCGNLESFPEGG  261 (465)
Q Consensus       182 ~~~~l~~~~~~~~L~~L~l~~~~~l~~~~~~~~~l~~L~~L~l~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~l~~~~  261 (465)
                             ... +.........+.  ......+..+++++.++++++.... +++ ...+++|++|++++| .++.++ ..
T Consensus       172 -------~~~-~~~~~~~~~~~~--~~~~~~~~~l~~~~~l~l~~n~i~~-~~~-~~~~~~L~~L~l~~n-~l~~~~-~l  237 (384)
T d2omza2         172 -------ANL-TTLERLDISSNK--VSDISVLAKLTNLESLIATNNQISD-ITP-LGILTNLDELSLNGN-QLKDIG-TL  237 (384)
T ss_dssp             -------TTC-TTCCEEECCSSC--CCCCGGGGGCTTCSEEECCSSCCCC-CGG-GGGCTTCCEEECCSS-CCCCCG-GG
T ss_pred             -------ccc-cccccccccccc--cccccccccccccceeeccCCccCC-CCc-ccccCCCCEEECCCC-CCCCcc-hh
Confidence                   111 223333333322  1123345677788888888765433 222 445677888888877 455554 23


Q ss_pred             CCCCCCceEEEecCCCcCcccccccCCCcccceeeccCCCCCccCCCCCCCccceeeecCCcccccccccccccCCCCCC
Q 046441          262 LPCAKLSKLRIYGCERLEALPKGLHNLKSLQELRIGRGVELPSLEEDGLPTNLHSLEIDGNMEIWKSTIEWGRGFHRFSS  341 (465)
Q Consensus       262 ~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~  341 (465)
                      ..+++|+.+++++|. +..++ .++.+++|++|+++++. +..++....++.++.+.+..|.. .....     +..+++
T Consensus       238 ~~l~~L~~L~l~~n~-l~~~~-~~~~~~~L~~L~l~~~~-l~~~~~~~~~~~l~~l~~~~n~l-~~~~~-----~~~~~~  308 (384)
T d2omza2         238 ASLTNLTDLDLANNQ-ISNLA-PLSGLTKLTELKLGANQ-ISNISPLAGLTALTNLELNENQL-EDISP-----ISNLKN  308 (384)
T ss_dssp             GGCTTCSEEECCSSC-CCCCG-GGTTCTTCSEEECCSSC-CCCCGGGTTCTTCSEEECCSSCC-SCCGG-----GGGCTT
T ss_pred             hcccccchhccccCc-cCCCC-cccccccCCEeeccCcc-cCCCCcccccccccccccccccc-ccccc-----cchhcc
Confidence            445688888888875 44454 36777888888888763 44444455567788888877763 22211     456788


Q ss_pred             ccEEEecCCCCcccccccccccccCCCCCccccceEeccCCCCCccccccccCCCCcceEEecCCCCCCcCCCCCCcccc
Q 046441          342 LRCLAISGCDDDMVSFPLEDKRLGTALPLPACLASLMIGNFPNLERLSSSIVDLQNLTELYLGDCPKLKYFPEKGLPSSL  421 (465)
Q Consensus       342 L~~L~l~~~~~~l~~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~l~~L~~L~l~~c~~l~~l~~~~~~~~L  421 (465)
                      +++|+++++  .+..++.-.        .+++|++|++++| +++.++ .+.++++|++|++++ ++++.+++..-+++|
T Consensus       309 l~~L~ls~n--~l~~l~~l~--------~l~~L~~L~L~~n-~l~~l~-~l~~l~~L~~L~l~~-N~l~~l~~l~~l~~L  375 (384)
T d2omza2         309 LTYLTLYFN--NISDISPVS--------SLTKLQRLFFANN-KVSDVS-SLANLTNINWLSAGH-NQISDLTPLANLTRI  375 (384)
T ss_dssp             CSEEECCSS--CCSCCGGGG--------GCTTCCEEECCSS-CCCCCG-GGGGCTTCCEEECCS-SCCCBCGGGTTCTTC
T ss_pred             cCeEECCCC--CCCCCcccc--------cCCCCCEEECCCC-CCCCCh-hHcCCCCCCEEECCC-CcCCCChhhccCCCC
Confidence            888888886  555554322        5568999999885 788877 477889999999988 478887664446889


Q ss_pred             cEEeecCC
Q 046441          422 LRLYIDEC  429 (465)
Q Consensus       422 ~~L~l~~c  429 (465)
                      ++|+++++
T Consensus       376 ~~L~L~~N  383 (384)
T d2omza2         376 TQLGLNDQ  383 (384)
T ss_dssp             SEEECCCE
T ss_pred             CEeeCCCC
Confidence            99888763
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure