Citrus Sinensis ID: 046552

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
cccccccccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccccccEEEEEEEcccccEEEEEcccccccccccEEEEEEEEcccccccccccccccccEEEEEccccccccccccccccEEEccccccEEEEEEccccHHHHHHHHHHHHcccccccEEEEEEEEcccccEEcc
ccHHcccccHHHHHEcccHEHHccccccccccEEEEEEEccccHHHccccccccEcccccccEEEEEEEEcccEEEEEEEcccccccccccccEEEEEccccHHHHHHHccccccEEEEEccccEEEEEccccccEcccccHHccEEEEEEEHHHHHHHHHHHHHHHHccccccEEEEEEEEEEHHHcccH
MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVtkkpkgcldpekfnEFKLIKRIlglpigqhiscrgrddlgeevikpytpatldsdiGYFELVIKMypqgrmshhvhelqegdylplkgpdpsrrfdslllkgrfkyqpgqveafgtltgdtgiaPMFQVARAIlenpndktnvYLIYANVTFYDILLK
MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPytpatldsdiGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILenpndktnvylIYANVTFYDILLK
MDISQSHGVEMMRliiavalvaigagTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
********VEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYL**********FDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILL*
*************LIIAVALVAIGAGTAYYFYVTKKP*GCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
*****SHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
ooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q9ZNT1281 NADH--cytochrome b5 reduc yes no 0.795 0.540 0.620 7e-58
Q59P03294 NADH-cytochrome b5 reduct N/A no 0.869 0.564 0.409 3e-33
Q6BUX2284 NADH-cytochrome b5 reduct yes no 0.869 0.584 0.409 5e-33
A3GF86284 NADH-cytochrome b5 reduct yes no 0.790 0.531 0.428 2e-32
Q54NC1286 NADH-cytochrome b5 reduct yes no 0.869 0.580 0.382 3e-32
Q6CA86290 NADH-cytochrome b5 reduct yes no 0.858 0.565 0.422 3e-31
A5DQ25284 NADH-cytochrome b5 reduct N/A no 0.790 0.531 0.428 6e-31
B0CQN7308 NADH-cytochrome b5 reduct N/A no 0.769 0.477 0.424 4e-30
Q6CID0281 NADH-cytochrome b5 reduct yes no 0.774 0.526 0.411 8e-30
Q4PGW7324 NADH-cytochrome b5 reduct N/A no 0.879 0.518 0.351 6e-29
>sp|Q9ZNT1|NB5R1_ARATH NADH--cytochrome b5 reductase 1 OS=Arabidopsis thaliana GN=CBR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  223 bits (567), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 128/182 (70%), Gaps = 30/182 (16%)

Query: 29  YYFYVTKKPKGCLDPEKFNEFKLIKR-------------------ILGLPIGQHISCRGR 69
           Y+   +KK + CLDPE F EFKL+KR                   +LGLPIGQHISCRG+
Sbjct: 30  YFLTSSKKRRVCLDPENFKEFKLVKRHQLSHNVAKFVFELPTSTSVLGLPIGQHISCRGK 89

Query: 70  DDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFD 129
           D  GE+VIKPYTP TLDSD+G FELVIKMYPQGRMSHH  E++ GD+L +KGP       
Sbjct: 90  DGQGEDVIKPYTPTTLDSDVGRFELVIKMYPQGRMSHHFREMRVGDHLAVKGP------- 142

Query: 130 SLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDIL 189
               KGRFKYQPGQ  AFG L G +GI PMFQVARAILENP DKT V+LIYANVT+ DIL
Sbjct: 143 ----KGRFKYQPGQFRAFGMLAGGSGITPMFQVARAILENPTDKTKVHLIYANVTYDDIL 198

Query: 190 LK 191
           LK
Sbjct: 199 LK 200
Reductase transfering electrons from NADH to cytochrome b5. Required for the NADH-dependent electron transfer involved in the desaturation and hydroxylation of fatty acids and in the desaturation of sterol precursors. No activity with NADPH as electron donor.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 6EC: .EC: 2EC: .EC: 2
>sp|Q59P03|NCB5R_CANAL NADH-cytochrome b5 reductase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBR1 PE=3 SV=1 Back     alignment and function description
>sp|Q6BUX2|NCB5R_DEBHA NADH-cytochrome b5 reductase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBR1 PE=3 SV=1 Back     alignment and function description
>sp|A3GF86|NCB5R_PICST NADH-cytochrome b5 reductase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CBR1 PE=3 SV=2 Back     alignment and function description
>sp|Q54NC1|NCB5R_DICDI NADH-cytochrome b5 reductase 1 OS=Dictyostelium discoideum GN=cyb5r1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CA86|NCB5R_YARLI NADH-cytochrome b5 reductase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CBR1 PE=3 SV=1 Back     alignment and function description
>sp|A5DQ25|NCB5R_PICGU NADH-cytochrome b5 reductase 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CBR1 PE=3 SV=1 Back     alignment and function description
>sp|B0CQN7|NCB5R_LACBS NADH-cytochrome b5 reductase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=MCR1.1 PE=3 SV=1 Back     alignment and function description
>sp|Q6CID0|NCB5R_KLULA NADH-cytochrome b5 reductase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CBR1 PE=3 SV=1 Back     alignment and function description
>sp|Q4PGW7|NCB5R_USTMA NADH-cytochrome b5 reductase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CBR1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
224149651219 predicted protein [Populus trichocarpa] 0.931 0.812 0.661 2e-72
255573283279 NADH-cytochrome B5 reductase, putative [ 0.931 0.637 0.663 8e-72
224131714278 predicted protein [Populus trichocarpa] 0.931 0.640 0.661 2e-71
55979113279 NADH:cytochrome b5 reductase [Vernicia f 0.931 0.637 0.682 3e-71
356577450278 PREDICTED: NADH-cytochrome b5 reductase 0.931 0.640 0.652 7e-71
357443909278 NADH cytochrome b5 reductase [Medicago t 0.931 0.640 0.657 1e-70
225436003278 PREDICTED: NADH-cytochrome b5 reductase 0.931 0.640 0.661 4e-70
55979111280 NADH:cytochrome b5 reductase [Vernicia f 0.937 0.639 0.606 8e-64
356504288278 PREDICTED: NADH-cytochrome b5 reductase 0.801 0.550 0.644 6e-60
255637950278 unknown [Glycine max] 0.801 0.550 0.644 8e-60
>gi|224149651|ref|XP_002336843.1| predicted protein [Populus trichocarpa] gi|222836993|gb|EEE75386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  277 bits (709), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 158/210 (75%), Gaps = 32/210 (15%)

Query: 1   MDISQSHGVEMMRLIIAVALVAIGAGTAYYFYVTKKPKGCLDPEKFNEFKLIKR------ 54
           M+  QSH VEM+   IAVALVAIGAGTA+YFY+TKKPKGCLDPE F E+KL+KR      
Sbjct: 1   MESLQSHRVEMIS--IAVALVAIGAGTAFYFYITKKPKGCLDPENFKEYKLVKRTELSHN 58

Query: 55  -------------ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQ 101
                        +LGLPIGQH+SCRG+D +GEEV+KPYTP TLDSDIGYFELVIKMYPQ
Sbjct: 59  VAKFKFALPTPNSVLGLPIGQHMSCRGQDSVGEEVVKPYTPTTLDSDIGYFELVIKMYPQ 118

Query: 102 GRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQ 161
           GRMSHH  E++EGDYL +KGP           KGRFKYQP QV AFG + G TGI PMFQ
Sbjct: 119 GRMSHHFREMREGDYLAVKGP-----------KGRFKYQPNQVRAFGMIAGGTGITPMFQ 167

Query: 162 VARAILENPNDKTNVYLIYANVTFYDILLK 191
           V RAILENP+DKT ++LIYANVT+ DILLK
Sbjct: 168 VTRAILENPDDKTKIHLIYANVTYEDILLK 197

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255573283|ref|XP_002527570.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] gi|223533062|gb|EEF34822.1| NADH-cytochrome B5 reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224131714|ref|XP_002328090.1| predicted protein [Populus trichocarpa] gi|222837605|gb|EEE75970.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|55979113|gb|AAV69020.1| NADH:cytochrome b5 reductase [Vernicia fordii] Back     alignment and taxonomy information
>gi|356577450|ref|XP_003556838.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357443909|ref|XP_003592232.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|357462095|ref|XP_003601329.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|355481280|gb|AES62483.1| NADH cytochrome b5 reductase [Medicago truncatula] gi|355490377|gb|AES71580.1| NADH cytochrome b5 reductase [Medicago truncatula] Back     alignment and taxonomy information
>gi|225436003|ref|XP_002273225.1| PREDICTED: NADH-cytochrome b5 reductase 1 [Vitis vinifera] gi|296083963|emb|CBI24351.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|55979111|gb|AAV69019.1| NADH:cytochrome b5 reductase [Vernicia fordii] gi|55979115|gb|AAV69021.1| NADH:cytochrome b5 reductase [Vernicia fordii] Back     alignment and taxonomy information
>gi|356504288|ref|XP_003520929.1| PREDICTED: NADH-cytochrome b5 reductase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255637950|gb|ACU19291.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2176001281 CBR "NADH:cytochrome B5 reduct 0.659 0.448 0.715 2.6e-55
DICTYBASE|DDB_G0285399286 cyb5r1 "NADH-cytochrome b5 red 0.654 0.437 0.496 1.8e-31
CGD|CAL0001574294 CBR1 [Candida albicans (taxid: 0.790 0.513 0.426 3.8e-30
UNIPROTKB|Q59P03294 CBR1 "NADH-cytochrome b5 reduc 0.790 0.513 0.426 3.8e-30
ASPGD|ASPL0000000398310 AN6366 [Emericella nidulans (t 0.659 0.406 0.433 1.3e-25
POMBASE|SPCC970.03301 SPCC970.03 "cytochrome b5 redu 0.654 0.415 0.423 1.1e-23
UNIPROTKB|A4R935309 CBR1 "NADH-cytochrome b5 reduc 0.659 0.407 0.454 1e-22
UNIPROTKB|F1S4N2305 CYB5R1 "Uncharacterized protei 0.696 0.436 0.396 1.6e-22
SGD|S000001305284 CBR1 "Microsomal cytochrome b 0.654 0.440 0.413 1.6e-22
UNIPROTKB|G5E5N5303 CYB5R1 "NADH-cytochrome b5 red 0.696 0.438 0.409 2.1e-22
TAIR|locus:2176001 CBR "NADH:cytochrome B5 reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 500 (181.1 bits), Expect = 2.6e-55, Sum P(2) = 2.6e-55
 Identities = 98/137 (71%), Positives = 109/137 (79%)

Query:    55 ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEG 114
             +LGLPIGQHISCRG+D  GE+VIKPYTP TLDSD+G FELVIKMYPQGRMSHH  E++ G
Sbjct:    75 VLGLPIGQHISCRGKDGQGEDVIKPYTPTTLDSDVGRFELVIKMYPQGRMSHHFREMRVG 134

Query:   115 DYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKT 174
             D+L +KGP           KGRFKYQPGQ  AFG L G +GI PMFQVARAILENP DKT
Sbjct:   135 DHLAVKGP-----------KGRFKYQPGQFRAFGMLAGGSGITPMFQVARAILENPTDKT 183

Query:   175 NVYLIYANVTFYDILLK 191
              V+LIYANVT+ DILLK
Sbjct:   184 KVHLIYANVTYDDILLK 200
GO:0005737 "cytoplasm" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0004128 "cytochrome-b5 reductase activity, acting on NAD(P)H" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0006499 "N-terminal protein myristoylation" evidence=RCA
GO:0042732 "D-xylose metabolic process" evidence=RCA
GO:0022900 "electron transport chain" evidence=IDA
DICTYBASE|DDB_G0285399 cyb5r1 "NADH-cytochrome b5 reductase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0001574 CBR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59P03 CBR1 "NADH-cytochrome b5 reductase 1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
ASPGD|ASPL0000000398 AN6366 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPCC970.03 SPCC970.03 "cytochrome b5 reductase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|A4R935 CBR1 "NADH-cytochrome b5 reductase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4N2 CYB5R1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
SGD|S000001305 CBR1 "Microsomal cytochrome b reductase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5N5 CYB5R1 "NADH-cytochrome b5 reductase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
cd06183234 cd06183, cyt_b5_reduct_like, Cytochrome b5 reducta 3e-51
PTZ00319300 PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; 1e-36
PLN02252888 PLN02252, PLN02252, nitrate reductase [NADPH] 4e-33
pfam0097099 pfam00970, FAD_binding_6, Oxidoreductase FAD-bindi 5e-25
COG0543252 COG0543, UbiB, 2-polyprenylphenol hydroxylase and 4e-15
cd00322223 cd00322, FNR_like, Ferredoxin reductase (FNR), an 1e-13
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 2e-10
PTZ00274 325 PTZ00274, PTZ00274, cytochrome b5 reductase; Provi 6e-10
cd06217235 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur bi 4e-09
cd06194222 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulf 9e-08
cd06214241 cd06214, PA_degradation_oxidoreductase_like, NAD(P 6e-07
cd06215231 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur bi 8e-07
COG1018 266 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NA 4e-06
pfam00175106 pfam00175, NAD_binding_1, Oxidoreductase NAD-bindi 7e-06
cd06221 253 cd06221, sulfite_reductase_like, Anaerobic sulfite 3e-05
cd06191231 cd06191, FNR_iron_sulfur_binding, Iron-sulfur bind 4e-05
cd06216243 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur bi 1e-04
cd06187224 cd06187, O2ase_reductase_like, The oxygenase reduc 2e-04
cd06196218 cd06196, FNR_like_1, Ferredoxin reductase-like pro 3e-04
PRK08345 289 PRK08345, PRK08345, cytochrome-c3 hydrogenase subu 7e-04
cd06211238 cd06211, phenol_2-monooxygenase_like, Phenol 2-mon 0.001
cd06212232 cd06212, monooxygenase_like, The oxygenase reducta 0.001
cd06210236 cd06210, MMO_FAD_NAD_binding, Methane monooxygenas 0.002
>gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information 
 Score =  164 bits (417), Expect = 3e-51
 Identities = 66/138 (47%), Positives = 96/138 (69%), Gaps = 13/138 (9%)

Query: 55  ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEG 114
           +LGLP+GQH+  +  DD GE+V++PYTP + D D GYF+L+IK+YP G+MS ++H L+ G
Sbjct: 26  VLGLPVGQHVELKAPDD-GEQVVRPYTPISPDDDKGYFDLLIKIYPGGKMSQYLHSLKPG 84

Query: 115 DYLPLKGPDPSRRFDSLLLKGRFKYQP-GQVEAFGTLTGDTGIAPMFQVARAILENPNDK 173
           D + ++GP            G+F+Y+P G+V+  G + G TGI PM Q+ RAIL++P DK
Sbjct: 85  DTVEIRGP-----------FGKFEYKPNGKVKHIGMIAGGTGITPMLQLIRAILKDPEDK 133

Query: 174 TNVYLIYANVTFYDILLK 191
           T + L+YAN T  DILL+
Sbjct: 134 TKISLLYANRTEEDILLR 151

Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH. Length = 234
>gnl|CDD|173521 PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information
>gnl|CDD|216220 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain Back     alignment and domain information
>gnl|CDD|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|140300 PTZ00274, PTZ00274, cytochrome b5 reductase; Provisional Back     alignment and domain information
>gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|223949 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215769 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain Back     alignment and domain information
>gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>gnl|CDD|236247 PRK08345, PRK08345, cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>gnl|CDD|99806 cd06210, MMO_FAD_NAD_binding, Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG0534286 consensus NADH-cytochrome b-5 reductase [Coenzyme 100.0
PTZ00319300 NADH-cytochrome B5 reductase; Provisional 99.96
PTZ00274 325 cytochrome b5 reductase; Provisional 99.95
COG1018 266 Hmp Flavodoxin reductases (ferredoxin-NADPH reduct 99.94
cd00322223 FNR_like Ferredoxin reductase (FNR), an FAD and NA 99.94
cd06195241 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c 99.94
cd06211238 phenol_2-monooxygenase_like Phenol 2-monooxygenase 99.94
cd06210236 MMO_FAD_NAD_binding Methane monooxygenase (MMO) re 99.94
cd06215231 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr 99.94
cd06190232 T4MO_e_transfer_like Toluene-4-monoxygenase electr 99.94
PLN02252888 nitrate reductase [NADPH] 99.94
cd06212232 monooxygenase_like The oxygenase reductase FAD/NAD 99.94
cd06189224 flavin_oxioreductase NAD(P)H dependent flavin oxid 99.94
PRK10684 332 HCP oxidoreductase, NADH-dependent; Provisional 99.94
cd06183234 cyt_b5_reduct_like Cytochrome b5 reductase catalyz 99.94
cd06191231 FNR_iron_sulfur_binding Iron-sulfur binding Ferred 99.94
cd06216243 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr 99.94
cd06209228 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD 99.94
cd06187224 O2ase_reductase_like The oxygenase reductase FAD/N 99.94
cd06217235 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr 99.93
PRK10926248 ferredoxin-NADP reductase; Provisional 99.93
cd06213227 oxygenase_e_transfer_subunit The oxygenase reducta 99.93
PRK11872340 antC anthranilate dioxygenase reductase; Provision 99.93
cd06188283 NADH_quinone_reductase Na+-translocating NADH:quin 99.93
PRK07609339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 99.93
cd06194222 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding 99.93
cd06184247 flavohem_like_fad_nad_binding FAD_NAD(P)H binding 99.93
cd06196218 FNR_like_1 Ferredoxin reductase-like proteins cata 99.93
PRK13289399 bifunctional nitric oxide dioxygenase/dihydropteri 99.93
cd06192 243 DHOD_e_trans_like FAD/NAD binding domain (electron 99.93
cd06198216 FNR_like_3 NAD(P) binding domain of ferredoxin red 99.93
TIGR02160 352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 99.92
PRK08345 289 cytochrome-c3 hydrogenase subunit gamma; Provision 99.92
cd06197220 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin 99.92
cd06214241 PA_degradation_oxidoreductase_like NAD(P) binding 99.92
PRK05713312 hypothetical protein; Provisional 99.92
cd06182 267 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) 99.92
cd06218 246 DHOD_e_trans FAD/NAD binding domain in the electro 99.92
PRK05464409 Na(+)-translocating NADH-quinone reductase subunit 99.92
COG0543252 UbiB 2-polyprenylphenol hydroxylase and related fl 99.92
cd06221 253 sulfite_reductase_like Anaerobic sulfite reductase 99.91
PRK08221 263 anaerobic sulfite reductase subunit B; Provisional 99.91
PRK08051232 fre FMN reductase; Validated 99.91
TIGR01941405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 99.91
PLN03116307 ferredoxin--NADP+ reductase; Provisional 99.91
cd06208286 CYPOR_like_FNR These ferredoxin reductases are rel 99.91
PRK06222 281 ferredoxin-NADP(+) reductase subunit alpha; Review 99.9
cd06185211 PDR_like Phthalate dioxygenase reductase (PDR) is 99.9
cd06219 248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 99.9
cd06201289 SiR_like2 Cytochrome p450- like alpha subunits of 99.9
TIGR02911 261 sulfite_red_B sulfite reductase, subunit B. Member 99.9
PRK05802 320 hypothetical protein; Provisional 99.9
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.9
cd06200245 SiR_like1 Cytochrome p450- like alpha subunits of 99.9
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 99.9
PLN03115 367 ferredoxin--NADP(+) reductase; Provisional 99.89
PRK00054 250 dihydroorotate dehydrogenase electron transfer sub 99.89
cd06186210 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz 99.89
cd06220 233 DHOD_e_trans_like2 FAD/NAD binding domain in the e 99.89
cd06193235 siderophore_interacting Siderophore interacting pr 99.88
PLN02292 702 ferric-chelate reductase 99.85
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 99.85
PLN02631 699 ferric-chelate reductase 99.84
COG4097438 Predicted ferric reductase [Inorganic ion transpor 99.84
PLN02844 722 oxidoreductase/ferric-chelate reductase 99.81
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.79
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.79
cd06199360 SiR Cytochrome p450- like alpha subunits of E. col 99.76
TIGR01931597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 99.75
cd06207 382 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) 99.75
cd06206 384 bifunctional_CYPOR These bifunctional proteins fus 99.74
PF0097099 FAD_binding_6: Oxidoreductase FAD-binding domain; 99.73
KOG0039 646 consensus Ferric reductase, NADH/NADPH oxidase and 99.7
cd06203 398 methionine_synthase_red Human methionine synthase 99.69
PRK10953600 cysJ sulfite reductase subunit alpha; Provisional 99.68
cd06204416 CYPOR NADPH cytochrome p450 reductase (CYPOR) serv 99.65
cd06202 406 Nitric_oxide_synthase The ferredoxin-reductase (FN 99.64
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 99.61
PRK06214530 sulfite reductase; Provisional 99.59
PRK065671028 putative bifunctional glutamate synthase subunit b 99.38
KOG3378385 consensus Globins and related hemoproteins [Energy 99.36
COG0369587 CysJ Sulfite reductase, alpha subunit (flavoprotei 99.34
KOG1159574 consensus NADP-dependent flavoprotein reductase [E 99.14
KOG1158 645 consensus NADP/FAD dependent oxidoreductase [Energ 99.11
PF00175109 NAD_binding_1: Oxidoreductase NAD-binding domain ; 99.03
PF08022105 FAD_binding_8: FAD-binding domain; InterPro: IPR01 98.89
COG2375265 ViuB Siderophore-interacting protein [Inorganic io 98.7
PF08021117 FAD_binding_9: Siderophore-interacting FAD-binding 98.15
>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-34  Score=240.04  Aligned_cols=144  Identities=49%  Similarity=0.925  Sum_probs=135.5

Q ss_pred             CCCcCCCCCCeEEEEEeee-------------------ecCCCCCcEEEEEeeCCCCCeeeeeeecCcCCCCCCEEEEEE
Q 046552           36 KPKGCLDPEKFNEFKLIKR-------------------ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVI   96 (191)
Q Consensus        36 ~~~~~l~p~~~~~~~l~~~-------------------~~~~~pGQ~v~l~~~~~~g~~~~rpyT~~s~~~~~~~l~l~V   96 (191)
                      ..+...+|+.|.+|++.++                   .++++.|||+.+..+ .+|....|||||.|.+.+.|+++|+|
T Consensus        41 ~~~~~~~~~~~~~~~l~~k~~~shdt~~f~f~lp~~~~~l~lp~g~hv~~~~~-i~g~~vvRpYTPvs~~~~~g~~~l~V  119 (286)
T KOG0534|consen   41 GKKTLVDPESYYPFRLIDKTELSHDTSLFRFVLPSADHVLGLPIGQHVVLKAP-IGGKLVVRPYTPVSLDDDKGYFDLVV  119 (286)
T ss_pred             CcccccCCcceEEEEEEEEEeccCCceeEEEecCCchhccCcccceEEEEEec-CCCcEEEEecCCccCccccceEEEEE
Confidence            4566677888999999766                   789999999999999 77899999999999999889999999


Q ss_pred             EEeCCCccccccccCCCCCEEEEeCCCCCccccccccccceEeCCCCCceEEEEecCCCHHHHHHHHHHHHhCCCCCceE
Q 046552           97 KMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNV  176 (191)
Q Consensus        97 k~~~~G~~S~~L~~l~~Gd~v~i~gP~~~~~~~~~~~~G~~~~~~~~~~~lvlIagGtGItP~~~il~~l~~~~~~~~~i  176 (191)
                      |.|++|.||+||++|++||+|+++||           .|++.++++..++++|||||||||||+|+++++++++.|.+++
T Consensus       120 K~Y~~G~mS~~l~~LkiGd~ve~rGP-----------~G~~~~~~~~~~~l~miAgGtGItPmlqii~~il~~~~d~tki  188 (286)
T KOG0534|consen  120 KVYPKGKMSQHLDSLKIGDTVEFRGP-----------IGEFKYDPQKAKHLGMIAGGTGITPMLQLIRAILKDPEDTTKI  188 (286)
T ss_pred             EeccCCcccHHHhcCCCCCEEEEecC-----------ccceEecCCCcceEEEEecccchhhHHHHHHHHhcCCCCCcEE
Confidence            99999999999999999999999999           9999999988999999999999999999999999999899999


Q ss_pred             EEEEeeCCCCceecC
Q 046552          177 YLIYANVTFYDILLK  191 (191)
Q Consensus       177 ~Li~~~r~~~di~~~  191 (191)
                      +|+|+|++++|+++|
T Consensus       189 ~lly~N~te~DILlr  203 (286)
T KOG0534|consen  189 SLLYANKTEDDILLR  203 (286)
T ss_pred             EEEEecCCccccchH
Confidence            999999999999986

>PTZ00319 NADH-cytochrome B5 reductase; Provisional Back     alignment and domain information
>PTZ00274 cytochrome b5 reductase; Provisional Back     alignment and domain information
>COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] Back     alignment and domain information
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I Back     alignment and domain information
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin Back     alignment and domain information
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol Back     alignment and domain information
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol Back     alignment and domain information
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor Back     alignment and domain information
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain Back     alignment and domain information
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain Back     alignment and domain information
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant Back     alignment and domain information
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain Back     alignment and domain information
>PRK10926 ferredoxin-NADP reductase; Provisional Back     alignment and domain information
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain Back     alignment and domain information
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin Back     alignment and domain information
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional Back     alignment and domain information
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional Back     alignment and domain information
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins Back     alignment and domain information
>cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases Back     alignment and domain information
>PRK08221 anaerobic sulfite reductase subunit B; Provisional Back     alignment and domain information
>PRK08051 fre FMN reductase; Validated Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PLN03116 ferredoxin--NADP+ reductase; Provisional Back     alignment and domain information
>cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain Back     alignment and domain information
>PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed Back     alignment and domain information
>cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>TIGR02911 sulfite_red_B sulfite reductase, subunit B Back     alignment and domain information
>PRK05802 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PLN03115 ferredoxin--NADP(+) reductase; Provisional Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide Back     alignment and domain information
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family Back     alignment and domain information
>PLN02292 ferric-chelate reductase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02631 ferric-chelate reductase Back     alignment and domain information
>COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02844 oxidoreductase/ferric-chelate reductase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd06199 SiR Cytochrome p450- like alpha subunits of E Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) Back     alignment and domain information
>PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain Back     alignment and domain information
>KOG0039 consensus Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information
>cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases Back     alignment and domain information
>cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>PRK06214 sulfite reductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>KOG3378 consensus Globins and related hemoproteins [Energy production and conversion] Back     alignment and domain information
>COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1159 consensus NADP-dependent flavoprotein reductase [Energy production and conversion] Back     alignment and domain information
>KOG1158 consensus NADP/FAD dependent oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes Back     alignment and domain information
>PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 Back     alignment and domain information
>COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08021 FAD_binding_9: Siderophore-interacting FAD-binding domain; InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2eix_A243 The Structure Of Physarum Polycephalum Cytochrome B 3e-31
1umk_A275 The Structure Of Human Erythrocyte Nadh-Cytochrome 3e-23
1ndh_A272 Crystal Structure Of Nadh-Cytochrome B5 Reductase F 3e-23
1ib0_A274 Crystal Structure Of Rat B5r In Complex With Fad An 1e-22
1qx4_A274 Structrue Of S127p Mutant Of Cytochrome B5 Reductas 4e-22
1cnf_A270 Structural Studies On Corn Nitrate Reductase: Refin 2e-15
1cne_A270 Structural Studies On Corn Nitrate Reductase: Refin 2e-15
1tvc_A250 Fad And Nadh Binding Domain Of Methane Monooxygenas 5e-04
>pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 Reductase Length = 243 Back     alignment and structure 
Iteration: 1

 Score =  131 bits (329), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 64/137 (46%), Positives = 93/137 (67%), Gaps = 12/137 (8%)
Query: 55  ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEG 114
           ++GLPIGQH+S +   D G+E+ +PYTP + D + GYF+L+IK+Y +G+MS ++  L  G
Sbjct: 39  VVGLPIGQHMSVKATVD-GKEIYRPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPG 97
Query: 115 DYLPLKGPDPSRRFDSLLLKGRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKT 174
           D+L ++GP           KG+F Y+P  V+  G + G TGI PM QVARAI++NP +KT
Sbjct: 98  DFLQVRGP-----------KGQFDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKT 146
Query: 175 NVYLIYANVTFYDILLK 191
            + LI+ANV   DILL+
Sbjct: 147 IINLIFANVNEDDILLR 163
>pdb|1UMK|A Chain A, The Structure Of Human Erythrocyte Nadh-Cytochrome B5 Reductase Length = 275 Back     alignment and structure
>pdb|1NDH|A Chain A, Crystal Structure Of Nadh-Cytochrome B5 Reductase From Pig Liver At 2.4 Angstroms Resolution Length = 272 Back     alignment and structure
>pdb|1IB0|A Chain A, Crystal Structure Of Rat B5r In Complex With Fad And Nad Length = 274 Back     alignment and structure
>pdb|1QX4|A Chain A, Structrue Of S127p Mutant Of Cytochrome B5 Reductase Length = 274 Back     alignment and structure
>pdb|1CNF|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>pdb|1CNE|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 Back     alignment and structure
>pdb|1TVC|A Chain A, Fad And Nadh Binding Domain Of Methane Monooxygenase Reductase From Methylococcus Capsulatus (Bath) Length = 250 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 1e-64
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 2e-48
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 1e-44
1tvc_A250 Methane monooxygenase component C, methane monooxy 3e-11
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 8e-09
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 8e-09
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 2e-08
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 5e-08
4fk8_A 271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 9e-08
2bgi_A 272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 1e-07
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 2e-07
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 2e-07
2qdx_A 257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 4e-07
1ep3_B 262 Dihydroorotate dehydrogenase B (PYRK subunit); het 3e-05
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Length = 243 Back     alignment and structure
 Score =  198 bits (506), Expect = 1e-64
 Identities = 69/175 (39%), Positives = 104/175 (59%), Gaps = 31/175 (17%)

Query: 36  KPKGCLDPEKFNEFKLIKRI-------------------LGLPIGQHISCRGRDDLGEEV 76
           K +  L+P ++ +F L ++                    +GLPIGQH+S +   D G+E+
Sbjct: 1   KREPALNPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATVD-GKEI 59

Query: 77  IKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGR 136
            +PYTP + D + GYF+L+IK+Y +G+MS ++  L  GD+L ++GP           KG+
Sbjct: 60  YRPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGP-----------KGQ 108

Query: 137 FKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILLK 191
           F Y+P  V+  G + G TGI PM QVARAI++NP +KT + LI+ANV   DILL+
Sbjct: 109 FDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLR 163
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Length = 275 Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Length = 270 Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250 Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Length = 248 Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Length = 271 Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Length = 290 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257 Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Length = 262 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
2eix_A243 NADH-cytochrome B5 reductase; flavoprotein, FAD-bi 99.96
1umk_A275 B5R, NADH-cytochrome B5 reductase; flavoprotein, b 99.95
1fdr_A248 Flavodoxin reductase; ferredoxin reductase, flavin 99.94
2cnd_A270 NADH-dependent nitrate reductase; nitrate assimila 99.93
1ep3_B 262 Dihydroorotate dehydrogenase B (PYRK subunit); het 99.93
1tvc_A250 Methane monooxygenase component C, methane monooxy 99.93
2r6h_A290 NADH:ubiquinone oxidoreductase, Na translocating, 99.93
4eh1_A243 Flavohemoprotein; structural genomics, niaid, nati 99.93
1qfj_A232 Protein (flavin reductase); riboflavin, ferredoxin 99.93
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 99.92
2pia_A 321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 99.92
2bgi_A 272 Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi 99.92
2qdx_A 257 Ferredoxin reductase; oxidoreductase; HET: FAD; 1. 99.92
4fk8_A 271 Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st 99.92
3vo2_A 310 Putative uncharacterized protein; rossmann fold, o 99.92
3lo8_A311 Ferredoxin--NADP reductase; electron transport, ox 99.92
1gvh_A396 Flavohemoprotein; oxidoreductase, NADP, heme, flav 99.92
1cqx_A403 Flavohemoprotein; globin fold, six-stranded antipa 99.92
3jqq_A316 Ferredoxin NADP reductase; FAD, oxidoreductase; HE 99.91
4g1v_A399 Flavohemoglobin; three domains: globin fold, antip 99.91
2rc5_A314 Ferredoxin-NADP reductase; FAD, oxidoreductase; HE 99.9
1fnb_A 314 Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( 99.9
2bmw_A 304 Ferredoxin--NADP reductase; oxidoreductase, flavop 99.9
2b5o_A 402 FNR, ferredoxin--NADP reductase; complex with FAD, 99.89
2gpj_A252 Siderophore-interacting protein; structural genomi 99.87
1ddg_A374 Sulfite reductase (NADPH) flavoprotein alpha- comp 99.84
4dql_A 393 Bifunctional P-450/NADPH-P450 reductase; rossmann 99.77
1f20_A 435 Nitric-oxide synthase; nitric-xoide synthase, redu 99.73
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 99.7
2qtl_A 539 MSR;, methionine synthase reductase; alpha-beta-al 99.69
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 99.66
3qfs_A 458 CPR, P450R, NADPH--cytochrome P450 reductase; flav 99.66
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 99.65
3lrx_A158 Putative hydrogenase; alpha-beta protein, structur 99.41
3a1f_A 186 Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi 99.28
3lyu_A142 Putative hydrogenase; the C-terminal has AN alpha- 99.24
>2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Back     alignment and structure
Probab=99.96  E-value=9e-29  Score=202.27  Aligned_cols=124  Identities=51%  Similarity=0.970  Sum_probs=111.1

Q ss_pred             ecCCCCCcEEEEEeeCCCCCeeeeeeecCcCCCCCCEEEEEEEEeCCCccccccccCCCCCEEEEeCCCCCccccccccc
Q 046552           55 ILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLPLKGPDPSRRFDSLLLK  134 (191)
Q Consensus        55 ~~~~~pGQ~v~l~~~~~~g~~~~rpyT~~s~~~~~~~l~l~Vk~~~~G~~S~~L~~l~~Gd~v~i~gP~~~~~~~~~~~~  134 (191)
                      .+.++||||+.++++ .++....|+|||+|.+.+.+.++|+||++++|.+|+||+++++||+|.++||           +
T Consensus        39 ~~~~~pGq~v~l~~~-~~g~~~~R~ysi~s~~~~~~~~~l~vk~~~~G~~S~~l~~l~~Gd~v~v~gP-----------~  106 (243)
T 2eix_A           39 VVGLPIGQHMSVKAT-VDGKEIYRPYTPVSSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGP-----------K  106 (243)
T ss_dssp             CCCCCTTCEEEEEEE-ETTEEEEEEECCCSCTTCCSEEEEEEECCTTCHHHHHHHTCCTTCEEEEEEE-----------E
T ss_pred             ccCcCCceEEEEEEe-eCCCEEEeeeeecCCCCCCCEEEEEEEEcCCCCcchHhhcCCCCCEEEEECC-----------e
Confidence            367899999999998 3466789999999998877999999999999999999999999999999999           9


Q ss_pred             cceEeCCCCCceEEEEecCCCHHHHHHHHHHHHhCCCCCceEEEEEeeCCCCceec
Q 046552          135 GRFKYQPGQVEAFGTLTGDTGIAPMFQVARAILENPNDKTNVYLIYANVTFYDILL  190 (191)
Q Consensus       135 G~~~~~~~~~~~lvlIagGtGItP~~~il~~l~~~~~~~~~i~Li~~~r~~~di~~  190 (191)
                      |+|.+..+..++++||||||||||+++|++++++++.+..+++|+|++|+.+|+++
T Consensus       107 G~f~~~~~~~~~~vliagG~GiaP~~~~l~~l~~~~~~~~~v~l~~~~r~~~~~~~  162 (243)
T 2eix_A          107 GQFDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILL  162 (243)
T ss_dssp             CSCCCCTTSSSEEEEEEEGGGHHHHHHHHHHHHTCTTCCCEEEEEEEEEEGGGCTT
T ss_pred             EEEEeCCCCCcEEEEEecCccHHHHHHHHHHHHhCCCCCcEEEEEEEcCCHHHhhH
Confidence            99887766678999999999999999999999876434578999999999999865
>1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Back     alignment and structure
>1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Back     alignment and structure
>2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Back     alignment and structure
>1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Back     alignment and structure
>1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Back     alignment and structure
>2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Back     alignment and structure
>4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Back     alignment and structure
>2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Back     alignment and structure
>4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Back     alignment and structure
>3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* Back     alignment and structure
>3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* Back     alignment and structure
>1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Back     alignment and structure
>1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Back     alignment and structure
>3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* Back     alignment and structure
>4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* Back     alignment and structure
>2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* Back     alignment and structure
>1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* Back     alignment and structure
>2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... Back     alignment and structure
>2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} Back     alignment and structure
>2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} Back     alignment and structure
>1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* Back     alignment and structure
>4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* Back     alignment and structure
>1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Back     alignment and structure
>2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure
>3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Back     alignment and structure
>3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} Back     alignment and structure
>3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} Back     alignment and structure
>3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d2cnda1114 b.43.4.2 (A:11-124) Nitrate reductase core domain 7e-10
d1umka1124 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human 2e-08
d1gvha2107 b.43.4.2 (A:147-253) Flavohemoglobin, central doma 1e-07
d1cqxa2111 b.43.4.2 (A:151-261) Flavohemoglobin, central doma 5e-07
d1a8pa199 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi 6e-07
d1tvca1109 b.43.4.2 (A:2-110) Methane monooxygenase component 1e-06
d1umka2147 c.25.1.1 (A:154-300) cytochrome b5 reductase {Huma 3e-06
d1fdra199 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi 6e-06
d1ep3b1101 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, 1e-05
d2piaa1103 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase 6e-05
d1qfja197 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {E 1e-04
>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Length = 114 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Ferredoxin reductase FAD-binding domain-like
domain: Nitrate reductase core domain
species: Corn (Zea mays) [TaxId: 4577]

 Score = 52.0 bits (124), Expect = 7e-10
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 21/98 (21%)

Query: 53  KRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQ---------GR 103
            ++LGLPIG+HI      + G+  ++ YTP ++  +IG+F+L++K+Y +         G 
Sbjct: 28  DQVLGLPIGKHIFVCATIE-GKLCMRAYTPTSMVDEIGHFDLLVKVYFKNEHPKFPNGGL 86

Query: 104 MSHHVHELQEGDYLPLKGPDPSRRFDSLLLKGRFKYQP 141
           M+ ++  L  G Y+ +KGP            G  +Y  
Sbjct: 87  MTQYLDSLPVGSYIDVKGP-----------LGHVEYTG 113
>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Length = 107 Back     information, alignment and structure
>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 111 Back     information, alignment and structure
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Length = 99 Back     information, alignment and structure
>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Length = 109 Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Length = 99 Back     information, alignment and structure
>d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 101 Back     information, alignment and structure
>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 103 Back     information, alignment and structure
>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1fdra199 Ferredoxin reductase (flavodoxin reductase) N-term 99.69
d1a8pa199 Ferredoxin reductase (flavodoxin reductase) N-term 99.65
d1umka1124 cytochrome b5 reductase {Human (Homo sapiens) [Tax 99.64
d2cnda1114 Nitrate reductase core domain {Corn (Zea mays) [Ta 99.63
d1qfja197 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 99.58
d1krha1100 Benzoate dioxygenase reductase {Acinetobacter sp. 99.57
d1ep3b1101 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 99.57
d1tvca1109 Methane monooxygenase component C, MmoC {Methyloco 99.56
d1gvha2107 Flavohemoglobin, central domain {Escherichia coli 99.55
d1cqxa2111 Flavohemoglobin, central domain {Alcaligenes eutro 99.55
d2piaa1103 Phthalate dioxygenase reductase {Pseudomonas cepac 99.52
d2bmwa1133 Ferredoxin reductase (flavodoxin reductase) N-term 99.37
d1fnda1136 Ferredoxin reductase (flavodoxin reductase) N-term 99.35
d1umka2147 cytochrome b5 reductase {Human (Homo sapiens) [Tax 99.34
d1tvca2141 Methane monooxygenase component C, MmoC {Methyloco 99.24
d2cnda2146 Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} 99.23
d1krha2133 Benzoate dioxygenase reductase {Acinetobacter sp. 99.19
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 99.16
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 99.14
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 99.13
d1fdra2148 Ferredoxin reductase (flavodoxin reductase) {Esche 99.11
d1gvha3143 Flavohemoglobin, C-terminal domain {Escherichia co 99.05
d1fnda2 160 Ferredoxin reductase (flavodoxin reductase) {Spina 99.03
d1ja1a3 160 NADPH-cytochrome p450 reductase {Rat (Rattus norve 98.91
d1a8pa2 158 Ferredoxin reductase (flavodoxin reductase) {Azoto 98.88
d1ddga2153 Sulfite reductase flavoprotein {Escherichia coli [ 98.86
d1jb9a1157 Ferredoxin reductase (flavodoxin reductase) N-term 98.83
d1f20a2 165 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 98.73
d1ep3b2 160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 97.82
d1f20a1270 Neuronal nitric-oxide synthase FAD/NADP+ domain {R 96.35
d1ddga1221 Sulfite reductase flavoprotein {Escherichia coli [ 95.75
d1ja1a1279 NADPH-cytochrome p450 reductase {Rat (Rattus norve 91.11
>d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin synthase domain-like
family: Ferredoxin reductase FAD-binding domain-like
domain: Ferredoxin reductase (flavodoxin reductase) N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.69  E-value=4.4e-17  Score=115.45  Aligned_cols=81  Identities=19%  Similarity=0.266  Sum_probs=68.4

Q ss_pred             cCCCCCCeEEEEEeeeecCCCCCcEEEEEeeCCCCCeeeeeeecCcCCCCCCEEEEEEEEeCCCccccccccCCCCCEEE
Q 046552           39 GCLDPEKFNEFKLIKRILGLPIGQHISCRGRDDLGEEVIKPYTPATLDSDIGYFELVIKMYPQGRMSHHVHELQEGDYLP  118 (191)
Q Consensus        39 ~~l~p~~~~~~~l~~~~~~~~pGQ~v~l~~~~~~g~~~~rpyT~~s~~~~~~~l~l~Vk~~~~G~~S~~L~~l~~Gd~v~  118 (191)
                      ..++++.+ .+++....+.++||||+.+.++ .+|+...|+|||+|.|.+ +.++++||++++|.+|++|+++++||+|.
T Consensus        12 ~~~t~~v~-~l~~~~p~~~f~pGQ~v~l~~~-~~g~~~~R~YSi~s~p~~-~~~~~~vk~~~~G~~S~~l~~lk~GD~v~   88 (99)
T d1fdra1          12 QNWTDALF-SLTVHAPVLPFTAGQFTKLGLE-IDGERVQRAYSYVNSPDN-PDLEFYLVTVPDGKLSPRLAALKPGDEVQ   88 (99)
T ss_dssp             EECSSSEE-EEEEECCCCCCCTTCEEEEEEC-C---CEEEEEECCSCTTC-SSEEEEEECCTTCSSHHHHHTCCTTCEEE
T ss_pred             EEcCCCEE-EEEEcCCCCCCCCCcEEEeccC-CCCCcEEEEEccCCCCCC-ceeEEEEEEecCcHHHHHHhhCCCCCEEE
Confidence            34555554 5777666789999999999998 567788999999999887 78999999999999999999999999999


Q ss_pred             EeCC
Q 046552          119 LKGP  122 (191)
Q Consensus       119 i~gP  122 (191)
                      |+||
T Consensus        89 v~gP   92 (99)
T d1fdra1          89 VVSE   92 (99)
T ss_dssp             EESS
T ss_pred             ECcC
Confidence            9997
>d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Back     information, alignment and structure
>d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} Back     information, alignment and structure
>d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ja1a1 b.43.4.1 (A:240-518) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure