Citrus Sinensis ID: 046569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 255570494 | 523 | peptidylprolyl isomerase, putative [Rici | 0.995 | 0.384 | 0.669 | 2e-78 | |
| 359481570 | 523 | PREDICTED: LOW QUALITY PROTEIN: 70 kDa p | 0.985 | 0.380 | 0.635 | 5e-76 | |
| 356503354 | 538 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.990 | 0.371 | 0.665 | 1e-72 | |
| 224147353 | 548 | predicted protein [Populus trichocarpa] | 0.876 | 0.322 | 0.576 | 7e-66 | |
| 356570407 | 533 | PREDICTED: LOW QUALITY PROTEIN: 70 kDa p | 0.980 | 0.371 | 0.572 | 1e-59 | |
| 356504412 | 470 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.990 | 0.425 | 0.529 | 4e-55 | |
| 356558981 | 574 | PREDICTED: 70 kDa peptidyl-prolyl isomer | 0.990 | 0.348 | 0.520 | 8e-55 | |
| 355329948 | 573 | FK506-binding protein [Nicotiana tabacum | 0.990 | 0.349 | 0.515 | 2e-54 | |
| 255589766 | 574 | peptidylprolyl isomerase, putative [Rici | 0.990 | 0.348 | 0.511 | 2e-53 | |
| 449463204 | 553 | PREDICTED: peptidyl-prolyl cis-trans iso | 0.990 | 0.361 | 0.515 | 5e-53 |
| >gi|255570494|ref|XP_002526205.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223534483|gb|EEF36184.1| peptidylprolyl isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 296 bits (759), Expect = 2e-78, Method: Compositional matrix adjust.
Identities = 146/218 (66%), Positives = 172/218 (78%), Gaps = 17/218 (7%)
Query: 2 VNEGLERAIMTMKKEEQATVTISAEYLCGHEVSELVCANSVLYYEVTLIDFTKEKPFWKM 61
+NEGL+RAIMTMK+ E VT++AEYL H+ S+++ ANSVL+YEV LIDF K+KPFWKM
Sbjct: 306 INEGLDRAIMTMKRGEHCLVTVTAEYLSDHDSSDVLPANSVLHYEVQLIDFIKDKPFWKM 365
Query: 62 DTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKATN-----------------GLRLSC 104
D EK+EACE KK DGN+LF+AGK+WRASKKYEKATN GLRLSC
Sbjct: 366 DASEKLEACEIKKLDGNVLFKAGKFWRASKKYEKATNIVEYDHPFTDDQKCLAKGLRLSC 425
Query: 105 YLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALFRRSQAYLKTSELEKDEADIKRALT 164
YLNNAACKLKL +Y EAS LCTKVLE +P NVKALFRRS+AYLK +ELEK EADI +AL
Sbjct: 426 YLNNAACKLKLGEYCEASRLCTKVLEQDPFNVKALFRRSEAYLKITELEKAEADINKALI 485
Query: 165 IDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKMG 202
IDPNNRDVKL Y ELK+ QR YAK+QA++F +M S+MG
Sbjct: 486 IDPNNRDVKLKYKELKDKQRVYAKHQAKLFSTMFSRMG 523
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359481570|ref|XP_003632641.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356503354|ref|XP_003520475.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224147353|ref|XP_002336458.1| predicted protein [Populus trichocarpa] gi|222835069|gb|EEE73518.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356570407|ref|XP_003553380.1| PREDICTED: LOW QUALITY PROTEIN: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356504412|ref|XP_003520990.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356558981|ref|XP_003547780.1| PREDICTED: 70 kDa peptidyl-prolyl isomerase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|355329948|dbj|BAL14273.1| FK506-binding protein [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|255589766|ref|XP_002535081.1| peptidylprolyl isomerase, putative [Ricinus communis] gi|223524081|gb|EEF27302.1| peptidylprolyl isomerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449463204|ref|XP_004149324.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] gi|449515125|ref|XP_004164600.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP62-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:2090265 | 562 | ROF1 "AT3G25230" [Arabidopsis | 0.554 | 0.199 | 0.535 | 1.4e-50 | |
| UNIPROTKB|Q9XFE4 | 585 | OSJNBa0091C07.4 "OSJNBa0091C07 | 0.589 | 0.203 | 0.536 | 4e-50 | |
| UNIPROTKB|Q7F1F2 | 580 | OJ1191_A10.119 "cDNA clone:J03 | 0.554 | 0.193 | 0.562 | 8.5e-50 | |
| UNIPROTKB|Q6K5Q1 | 682 | P0579G08.8 "Putative peptidylp | 0.554 | 0.164 | 0.5 | 9e-47 | |
| TAIR|locus:2152561 | 578 | ROF2 "AT5G48570" [Arabidopsis | 0.534 | 0.186 | 0.537 | 1.7e-31 | |
| UNIPROTKB|A8J0I6 | 569 | FKB62 "Peptidyl-prolyl cis-tra | 0.495 | 0.175 | 0.39 | 1.1e-29 | |
| TAIR|locus:2037650 | 164 | TPR6 "AT1G58450" [Arabidopsis | 0.698 | 0.859 | 0.452 | 1.9e-28 | |
| UNIPROTKB|F1NIM4 | 442 | FKBP4 "Uncharacterized protein | 0.554 | 0.253 | 0.312 | 3.5e-26 | |
| UNIPROTKB|F1NP08 | 464 | FKBP4 "Uncharacterized protein | 0.554 | 0.241 | 0.312 | 4.4e-26 | |
| ZFIN|ZDB-GENE-030616-630 | 453 | fkbp5 "FK506 binding protein 5 | 0.544 | 0.242 | 0.327 | 5.8e-25 |
| TAIR|locus:2090265 ROF1 "AT3G25230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 322 (118.4 bits), Expect = 1.4e-50, Sum P(2) = 1.4e-50
Identities = 60/112 (53%), Positives = 86/112 (76%)
Query: 90 SKKYEKATNGLRLSCYLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALFRRSQAYLKT 149
S++ +K L+++C LN+AACKLKL+DY +A LCTKVLELE NVKAL+RR+QAY++
Sbjct: 437 SEEEKKQAKALKVACNLNDAACKLKLKDYKQAEKLCTKVLELESTNVKALYRRAQAYMEL 496
Query: 150 SELEKDEADIKRALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKM 201
S+L+ E D+K+AL IDPNNR+VKL LKE +E+ K +A+ +G+M +K+
Sbjct: 497 SDLDLAEFDVKKALEIDPNNREVKLEQKRLKEKMKEFNKKEAKFYGNMFAKL 548
|
|
| UNIPROTKB|Q9XFE4 OSJNBa0091C07.4 "OSJNBa0091C07.4 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7F1F2 OJ1191_A10.119 "cDNA clone:J033121G16, full insert sequence" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6K5Q1 P0579G08.8 "Putative peptidylprolyl isomerase" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152561 ROF2 "AT5G48570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8J0I6 FKB62 "Peptidyl-prolyl cis-trans isomerase, FKBP-type" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037650 TPR6 "AT1G58450" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NIM4 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NP08 FKBP4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-630 fkbp5 "FK506 binding protein 5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-10 | |
| cd00189 | 100 | cd00189, TPR, Tetratricopeptide repeat domain; typ | 4e-07 | |
| pfam13414 | 69 | pfam13414, TPR_11, TPR repeat | 2e-06 | |
| pfam00254 | 94 | pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t | 4e-05 | |
| TIGR00990 | 615 | TIGR00990, 3a0801s09, mitochondrial precursor prot | 5e-05 | |
| pfam13432 | 65 | pfam13432, TPR_16, Tetratricopeptide repeat | 6e-04 | |
| TIGR02917 | 899 | TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system | 0.001 | |
| PLN03088 | 356 | PLN03088, PLN03088, SGT1, suppressor of G2 allele | 0.003 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
Score = 54.3 bits (131), Expect = 4e-10
Identities = 36/94 (38%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
Query: 77 GNLLFRAGKYWRASKKYEKA--TNGLRLSCYLNNAACKLKLEDYSEASSLCTKVLELEPL 134
GNL ++ G Y A + YEKA + Y N AA KL Y EA K LEL+P
Sbjct: 7 GNLYYKLGDYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDPD 66
Query: 135 NVKALFRRSQAYLKTSELEKDEADIKRALTIDPN 168
N KA + AY K + E+ ++AL +DPN
Sbjct: 67 NAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100
|
Length = 100 |
| >gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here | Back alignment and domain information |
|---|
| >gnl|CDD|222112 pfam13414, TPR_11, TPR repeat | Back alignment and domain information |
|---|
| >gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 100.0 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 99.95 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.88 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 99.81 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.74 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.74 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 99.72 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 99.71 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.69 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.66 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 99.66 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.65 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.65 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.62 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.61 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.58 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 99.57 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.57 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.5 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.5 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.49 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 99.48 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.46 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 99.42 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 99.41 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 99.41 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.4 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.39 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.38 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.37 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 99.37 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.37 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.36 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 99.36 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.35 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.35 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.34 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 99.34 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.33 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.33 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.33 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.32 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 99.32 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.31 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.31 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 99.3 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.3 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.3 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.3 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 99.3 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.29 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.28 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.27 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.26 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.26 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.26 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 99.25 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 99.25 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.23 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.21 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.21 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.21 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 99.21 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.2 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 99.2 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 99.19 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 99.19 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 99.18 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 99.17 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 99.17 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.16 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 99.16 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.16 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.14 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.14 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.14 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.13 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.13 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.12 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 99.11 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 99.09 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.08 | |
| KOG0546 | 372 | consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos | 99.08 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 99.08 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.07 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.06 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.04 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 99.03 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 99.01 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 99.0 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.99 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.99 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.99 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.98 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 98.98 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.96 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.96 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.95 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.95 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.95 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.93 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.92 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.92 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.92 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.9 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.9 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.89 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.88 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.88 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.88 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.87 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.87 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 98.86 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.83 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.82 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.8 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.76 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.75 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.73 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.72 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.72 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.71 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.71 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.71 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.7 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.7 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.7 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.69 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.66 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 98.66 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.64 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.64 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.59 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.57 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.56 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.55 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.54 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.54 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.53 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.52 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.51 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 98.51 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.5 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.49 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.49 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.48 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 98.48 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 98.48 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.48 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 98.45 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.45 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.43 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 98.43 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.42 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.42 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 98.4 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 98.4 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.39 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.38 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.36 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 98.35 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 98.35 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.35 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.34 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.33 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.32 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 98.3 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.28 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.27 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.25 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 98.25 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.23 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.23 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 98.22 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.21 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.16 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 98.14 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 98.13 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.12 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 98.11 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 98.1 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 98.1 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 98.09 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 98.07 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.02 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 98.01 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.97 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 97.95 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 97.93 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.91 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 97.87 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 97.86 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.84 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.83 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 97.83 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.81 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 97.8 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 97.79 | |
| KOG4151 | 748 | consensus Myosin assembly protein/sexual cycle pro | 97.75 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.73 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.69 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.66 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 97.65 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.65 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.65 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 97.64 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 97.62 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 97.61 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.6 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.6 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.56 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 97.55 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.5 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.47 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.45 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.44 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.44 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 97.43 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.42 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 97.42 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.4 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 97.4 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.4 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.36 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 97.34 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.34 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 97.33 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 97.29 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.28 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 97.27 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 97.27 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.23 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 97.23 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 97.21 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 97.2 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 97.14 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 97.13 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.12 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.11 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 97.09 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 97.07 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.05 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 97.04 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 97.04 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 97.03 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 97.01 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 96.97 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.95 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.94 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.92 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.88 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 96.86 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 96.85 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.82 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 96.8 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 96.77 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.76 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.69 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 96.68 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 96.67 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.64 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 96.57 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 96.56 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.55 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.45 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 96.31 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.31 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 96.27 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.25 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 96.23 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 96.2 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 96.18 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 96.18 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 95.98 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 95.86 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 95.81 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 95.76 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 95.68 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.42 | |
| KOG4814 | 872 | consensus Uncharacterized conserved protein [Funct | 95.41 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 95.37 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 95.36 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 95.33 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 95.3 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 95.27 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 95.21 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 95.18 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 95.14 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 95.13 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 94.99 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 94.87 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 94.83 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 94.78 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 94.76 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 94.71 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 94.53 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 94.48 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 94.46 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 94.42 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 94.42 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 94.33 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 94.31 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 94.03 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 93.83 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 93.67 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 93.66 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 93.64 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 93.62 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 93.37 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 93.37 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 93.35 | |
| PF06957 | 422 | COPI_C: Coatomer (COPI) alpha subunit C-terminus; | 93.34 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 93.31 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 93.21 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 93.17 | |
| PF10952 | 140 | DUF2753: Protein of unknown function (DUF2753); In | 93.12 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 93.11 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 93.1 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 93.1 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 93.07 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 93.06 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 93.03 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 93.01 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 92.96 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 92.78 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 92.66 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 92.64 | |
| PHA02537 | 230 | M terminase endonuclease subunit; Provisional | 92.63 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 92.5 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 92.32 | |
| cd02678 | 75 | MIT_VPS4 MIT: domain contained within Microtubule | 92.25 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 92.22 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 92.2 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 92.12 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 91.98 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 91.92 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 91.88 | |
| PF11817 | 247 | Foie-gras_1: Foie gras liver health family 1; Inte | 91.6 | |
| cd02684 | 75 | MIT_2 MIT: domain contained within Microtubule Int | 91.52 | |
| cd02656 | 75 | MIT MIT: domain contained within Microtubule Inter | 91.45 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 91.33 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 91.33 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 91.22 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 91.21 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 91.13 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 91.11 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 91.02 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 90.49 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 89.99 | |
| COG4455 | 273 | ImpE Protein of avirulence locus involved in tempe | 89.97 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 89.95 | |
| cd02680 | 75 | MIT_calpain7_2 MIT: domain contained within Microt | 89.91 | |
| PF10373 | 278 | EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP | 89.86 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 89.62 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 89.61 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 89.48 | |
| TIGR03504 | 44 | FimV_Cterm FimV C-terminal domain. This protein is | 89.23 | |
| COG3914 | 620 | Spy Predicted O-linked N-acetylglucosamine transfe | 89.09 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 89.0 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 88.99 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 88.53 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 88.34 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 88.22 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 87.72 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 87.59 | |
| COG1047 | 174 | SlpA FKBP-type peptidyl-prolyl cis-trans isomerase | 87.56 | |
| PF12652 | 78 | CotJB: CotJB protein; InterPro: IPR024207 The cotJ | 87.52 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 87.21 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 87.0 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 86.9 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 86.83 | |
| KOG1839 | 1236 | consensus Uncharacterized protein CLU1/cluA/TIF31 | 86.79 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 86.58 | |
| PF09670 | 379 | Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 | 86.58 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 86.29 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 85.79 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 85.66 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 85.56 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 85.5 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 85.48 | |
| cd02677 | 75 | MIT_SNX15 MIT: domain contained within Microtubule | 84.99 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 84.89 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 84.74 | |
| KOG0292 | 1202 | consensus Vesicle coat complex COPI, alpha subunit | 84.2 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 84.12 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 84.1 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 83.65 | |
| PF12854 | 34 | PPR_1: PPR repeat | 83.29 | |
| KOG2561 | 568 | consensus Adaptor protein NUB1, contains UBA domai | 82.5 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 82.15 | |
| KOG4563 | 400 | consensus Cell cycle-regulated histone H1-binding | 81.72 | |
| KOG0889 | 3550 | consensus Histone acetyltransferase SAGA, TRRAP/TR | 81.0 |
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.6e-41 Score=266.61 Aligned_cols=202 Identities=44% Similarity=0.720 Sum_probs=194.8
Q ss_pred CcchHHHHHHhccccccEEEEEecccc-cc-cCCcccccCCCceEEEEEEEcccc-CCCCccCCCHHHHHHHHHHHHHHh
Q 046569 1 NVNEGLERAIMTMKKEEQATVTISAEY-LC-GHEVSELVCANSVLYYEVTLIDFT-KEKPFWKMDTHEKIEACERKKHDG 77 (202)
Q Consensus 1 ~v~~~~~~~~~~m~~ge~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~i~l~~~~-~~~~~~~~~~~~~~~~a~~~~~~g 77 (202)
+||+||++|+..|+.||++.|.|++.| || ..+.++.|||++++.|+|+|.++. .....|.+...+++..|...++.|
T Consensus 136 ~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~l~~A~~~ke~G 215 (397)
T KOG0543|consen 136 DVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGEPPLIPPNATLLYEVELLDFELKEDESWKMFAEERLEAADRKKERG 215 (397)
T ss_pred chhHHHHHHHHhcCccceEEEEeCcccccCCCCCCCCCCCCCceEEEEEEEEeeecCcccccccchHHHHHHHHHHHHhh
Confidence 489999999999999999999999999 99 566899999999999999999999 788899999999999999999999
Q ss_pred HHHHHcCcHHHHHHHHHHHHH-----------------hHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhhCCCChHHHH
Q 046569 78 NLLFRAGKYWRASKKYEKATN-----------------GLRLSCYLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALF 140 (202)
Q Consensus 78 ~~~~~~~~~~~A~~~y~~al~-----------------~~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~ 140 (202)
|.+|+.|+|..|...|.+|++ .....++.|++.||+++++|..|+..|+++|+++|+|++++|
T Consensus 216 n~~fK~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvLe~~~~N~KALy 295 (397)
T KOG0543|consen 216 NVLFKEGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVLELDPNNVKALY 295 (397)
T ss_pred hHHHhhchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHhcCCCchhHHH
Confidence 999999999999999999998 566778999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCC
Q 046569 141 RRSQAYLKTSELEKDEADIKRALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKMG 202 (202)
Q Consensus 141 ~~g~~~~~~~~~~~A~~~~~~a~~l~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~~ 202 (202)
++|.++..+|+|+.|+.+|+++++++|+|.++...+..|.++.+++.++++++|++||++++
T Consensus 296 RrG~A~l~~~e~~~A~~df~ka~k~~P~Nka~~~el~~l~~k~~~~~~kekk~y~~mF~k~~ 357 (397)
T KOG0543|consen 296 RRGQALLALGEYDLARDDFQKALKLEPSNKAARAELIKLKQKIREYEEKEKKMYANMFAKLA 357 (397)
T ss_pred HHHHHHHhhccHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccc
Confidence 99999999999999999999999999999999999999999999999999999999999874
|
|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG4814 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >PHA02537 M terminase endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] | Back alignment and domain information |
|---|
| >cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03504 FimV_Cterm FimV C-terminal domain | Back alignment and domain information |
|---|
| >COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12652 CotJB: CotJB protein; InterPro: IPR024207 The cotJ operon proteins affect spore coat composition, and is controlled by sigma E | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF12854 PPR_1: PPR repeat | Back alignment and domain information |
|---|
| >KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 202 | ||||
| 1kt0_A | 457 | Structure Of The Large Fkbp-like Protein, Fkbp51, I | 2e-24 | ||
| 1kt1_A | 457 | Structure Of The Large Fkbp-Like Protein, Fkbp51, I | 5e-24 | ||
| 1qz2_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Compl | 6e-24 | ||
| 1p5q_A | 336 | Crystal Structure Of Fkbp52 C-Terminal Domain Lengt | 3e-21 | ||
| 2if4_A | 338 | Crystal Structure Of A Multi-Domain Immunophilin Fr | 1e-16 | ||
| 1ihg_A | 370 | Bovine Cyclophilin 40, Monoclinic Form Length = 370 | 8e-13 | ||
| 2dba_A | 148 | The Solution Structure Of The Tetratrico Peptide Re | 1e-11 | ||
| 3kd7_A | 125 | Designed Tpr Module (Ctpr390) In Complex With Its P | 4e-11 | ||
| 2fbn_A | 198 | Plasmodium Falciparum Putative Fk506-Binding Protei | 1e-08 | ||
| 3jym_A | 377 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 9e-08 | ||
| 4apo_A | 165 | Aip Tpr Domain In Complex With Human Tomm20 Peptide | 2e-07 | ||
| 3jxv_A | 356 | Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk | 1e-06 | ||
| 1na0_A | 125 | Design Of Stable Alpha-Helical Arrays From An Ideal | 1e-06 | ||
| 3q47_B | 137 | Crystal Structure Of Tpr Domain Of Chip Complexed W | 3e-06 | ||
| 2wqh_A | 125 | Crystal Structure Of Ctpr3y3 Length = 125 | 6e-06 | ||
| 4aif_A | 144 | Aip Tpr Domain In Complex With Human Hsp90 Peptide | 7e-06 | ||
| 2c2l_A | 281 | Crystal Structure Of The Chip U-Box E3 Ubiquitin Li | 1e-05 | ||
| 1na3_A | 91 | Design Of Stable Alpha-Helical Arrays From An Ideal | 5e-05 | ||
| 4gco_A | 126 | Central Domain Of Stress-Induced Protein-1 (Sti-1) | 2e-04 | ||
| 3rkv_A | 162 | C-Terminal Domain Of Protein C56c10.10, A Putative | 2e-04 | ||
| 2fo7_A | 136 | Crystal Structure Of An 8 Repeat Consensus Tpr Supe | 3e-04 | ||
| 2lni_A | 133 | Solution Nmr Structure Of Stress-Induced-Phosphopro | 4e-04 |
| >pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
|
| >pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 | Back alignment and structure |
| >pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 | Back alignment and structure |
| >pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 | Back alignment and structure |
| >pdb|2IF4|A Chain A, Crystal Structure Of A Multi-Domain Immunophilin From Arabidopsis Thaliana Length = 338 | Back alignment and structure |
| >pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 | Back alignment and structure |
| >pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 | Back alignment and structure |
| >pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 | Back alignment and structure |
| >pdb|2FBN|A Chain A, Plasmodium Falciparum Putative Fk506-Binding Protein Pfl2275c, C-Terminal Tpr-Containing Domain Length = 198 | Back alignment and structure |
| >pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 | Back alignment and structure |
| >pdb|4APO|A Chain A, Aip Tpr Domain In Complex With Human Tomm20 Peptide Length = 165 | Back alignment and structure |
| >pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 | Back alignment and structure |
| >pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 | Back alignment and structure |
| >pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 | Back alignment and structure |
| >pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 | Back alignment and structure |
| >pdb|4AIF|A Chain A, Aip Tpr Domain In Complex With Human Hsp90 Peptide Length = 144 | Back alignment and structure |
| >pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 | Back alignment and structure |
| >pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 | Back alignment and structure |
| >pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 | Back alignment and structure |
| >pdb|3RKV|A Chain A, C-Terminal Domain Of Protein C56c10.10, A Putative Peptidylprolyl Isomerase, From Caenorhabditis Elegans Length = 162 | Back alignment and structure |
| >pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 | Back alignment and structure |
| >pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 1e-58 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 1e-57 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 3e-50 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 5e-43 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 9e-38 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 2e-33 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 6e-32 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 4e-23 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 9e-22 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 1e-21 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 2e-21 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 7e-21 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 1e-20 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 6e-20 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 7e-20 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 2e-18 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 1e-17 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-16 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 5e-13 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 1e-12 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 3e-07 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-16 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-15 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-12 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 2e-09 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-08 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 4e-05 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 3e-04 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 7e-04 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 2e-14 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 2e-13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 9e-13 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-11 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 7e-07 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 2e-06 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 3e-12 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 3e-12 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 1e-11 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 5e-08 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 1e-04 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-10 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-09 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 6e-08 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 2e-07 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 1e-06 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 7e-04 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 1e-10 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 4e-10 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 1e-09 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 6e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-09 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-08 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 7e-06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 1e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 6e-05 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 2e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-09 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 8e-09 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 2e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 3e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 9e-08 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 4e-07 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-06 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 2e-09 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 3e-08 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-06 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-05 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 7e-04 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 9e-04 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-09 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 8e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 9e-08 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 2e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 3e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 4e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 5e-07 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 6e-07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 7e-09 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 5e-08 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 2e-07 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 5e-07 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 6e-08 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 8e-04 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 7e-08 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 7e-08 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 1e-07 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 8e-04 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 1e-07 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 5e-06 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 9e-06 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 2e-05 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 3e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 7e-07 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 2e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 3e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 6e-06 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 5e-05 | |
| 3ugm_A | 1047 | TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan | 1e-04 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-07 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 4e-05 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 7e-05 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 4e-07 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 1e-04 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 6e-07 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 2e-04 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 8e-07 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 1e-06 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 1e-04 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-06 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-06 | |
| 3tax_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 1e-04 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 4e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 6e-06 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 3e-05 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 3e-06 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 6e-04 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 9e-04 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 4e-06 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 4e-06 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 5e-06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 6e-06 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 8e-05 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 1e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-05 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 2e-04 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 5e-04 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 3e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 4e-05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 9e-04 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 6e-05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 8e-05 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 1e-04 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 1e-04 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 1e-04 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 1e-04 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 2e-04 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 7e-04 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 8e-04 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 9e-04 |
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 | Back alignment and structure |
|---|
Score = 189 bits (481), Expect = 1e-58
Identities = 66/221 (29%), Positives = 108/221 (48%), Gaps = 19/221 (8%)
Query: 1 NVNEGLERAIMTMKKEEQATVTISAEYLCGHEVSEL--VCANSVLYYEVTLIDFTKEKPF 58
++ G+++A+ M++EEQ + + Y G + N+ L YEVTL F K K
Sbjct: 197 DIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKES 256
Query: 59 WKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKA-----------------TNGLR 101
W+MDT EK+E K G + F+ GKY +A +Y K +
Sbjct: 257 WEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFL 316
Query: 102 LSCYLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALFRRSQAYLKTSELEKDEADIKR 161
L+ +LN A C LKL +Y++A C K L L+ N K L+RR +A L +E E + D ++
Sbjct: 317 LAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEK 376
Query: 162 ALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKMG 202
L ++P N+ +L ++ +E+ + I+ +M K
Sbjct: 377 VLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFA 417
|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.98 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.97 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.97 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.93 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.91 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.9 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.88 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.85 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.84 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.84 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.82 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.81 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.81 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.8 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.8 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.79 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.77 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.77 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.76 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.74 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.74 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.73 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.73 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.72 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.72 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.72 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.71 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.71 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.7 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.69 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.69 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.68 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.68 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.67 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.66 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 99.66 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.65 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.65 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.64 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.64 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.64 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.63 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.63 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.63 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.63 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.61 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.6 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.59 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.59 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.58 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.58 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.58 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.57 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.57 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.56 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.55 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.55 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.55 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.55 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.54 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.54 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.54 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.53 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.52 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.52 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.51 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.51 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.51 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.51 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.51 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.5 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.5 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.5 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.5 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.5 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.5 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.5 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.49 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 99.49 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.49 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.49 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.49 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.48 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.48 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.48 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.48 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.48 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.48 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.48 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.47 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.47 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.47 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.46 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.46 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.46 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.45 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.45 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.44 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.44 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.44 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.43 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.43 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.43 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.43 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 99.43 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.42 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.42 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.41 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.4 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 99.39 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.38 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.37 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.37 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.36 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 99.36 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.36 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.36 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.36 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.35 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.35 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 99.33 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.33 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.33 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.31 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.3 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.3 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.29 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.29 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.29 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.29 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.29 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.28 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 99.28 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.27 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.27 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.27 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.27 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.26 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.26 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.25 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.25 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.25 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 99.25 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.24 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.24 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.24 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.21 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.21 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.21 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.2 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.2 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 99.2 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.2 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.2 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.19 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 99.19 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.19 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.19 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.18 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.18 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 99.18 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 99.18 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.17 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.17 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.16 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.16 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.16 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.15 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.15 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.13 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 99.13 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 99.13 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.13 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 99.1 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 99.09 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 99.09 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.06 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.06 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.02 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.02 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.01 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.0 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.99 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.99 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.99 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.96 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.94 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.93 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.92 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.91 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.9 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.88 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 98.88 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.84 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.82 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.79 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 98.79 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.76 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.75 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 98.69 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 98.67 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.64 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 98.62 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 98.62 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 98.62 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 98.62 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 98.61 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.61 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.6 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.59 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 98.58 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 98.58 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 98.57 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 98.57 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 98.55 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 98.54 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 98.52 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 98.52 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 98.5 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.48 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 98.45 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 98.44 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.43 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 98.42 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.39 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 98.38 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 98.37 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.37 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.36 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 98.35 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.35 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 98.34 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.33 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 98.23 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 98.22 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.22 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 98.22 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 98.18 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 98.17 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 98.13 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 97.98 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 97.75 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 97.73 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.72 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 97.6 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.44 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 97.44 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.43 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.43 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 97.42 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 97.34 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 97.29 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 97.17 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 96.94 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 96.81 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 96.81 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 96.28 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 96.21 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 95.9 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.89 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 95.77 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.67 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 95.6 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.54 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 95.54 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 95.4 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 95.2 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 95.19 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 95.18 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 95.09 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 95.0 | |
| 2v6y_A | 83 | AAA family ATPase, P60 katanin; MIT, VPS4, archaea | 94.57 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 94.42 | |
| 1ya0_A | 497 | SMG-7 transcript variant 2; alpha-helical repeat, | 94.32 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 94.08 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 93.9 | |
| 1w26_A | 432 | Trigger factor, TF; chaperone, protein folding, ri | 93.15 | |
| 2v6x_A | 85 | Vacuolar protein sorting-associated protein 4; pro | 92.58 | |
| 3lpz_A | 336 | GET4 (YOR164C homolog); protein targeting, tail-an | 92.39 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 92.13 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 91.67 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 91.6 | |
| 1wfd_A | 93 | Hypothetical protein 1500032H18; MIT domain, struc | 91.49 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 90.67 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 90.33 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 90.18 | |
| 2cpt_A | 117 | SKD1 protein, vacuolar sorting protein 4B; MIT, he | 90.01 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 89.51 | |
| 3mkr_B | 320 | Coatomer subunit alpha; tetratricopeptide repeats | 89.36 | |
| 3mv2_A | 325 | Coatomer subunit alpha; vesicular membrane coat CO | 88.84 | |
| 4h7y_A | 161 | Dual specificity protein kinase TTK; mitotic check | 88.28 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 87.74 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 87.01 | |
| 2wpv_A | 312 | GET4, UPF0363 protein YOR164C; golgi-ER traffickin | 86.69 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 86.41 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 86.31 | |
| 1qsa_A | 618 | Protein (soluble lytic transglycosylase SLT70); al | 85.25 | |
| 2crb_A | 97 | Nuclear receptor binding factor 2; NRBF-2, MIT dom | 84.68 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 84.3 | |
| 3spa_A | 1134 | Mtrpol, DNA-directed RNA polymerase, mitochondrial | 84.22 | |
| 3ax2_A | 73 | Mitochondrial import receptor subunit TOM20 homol; | 84.17 | |
| 1t11_A | 392 | Trigger factor, TF; helix-turn-helix, four-helix-b | 83.14 | |
| 2crb_A | 97 | Nuclear receptor binding factor 2; NRBF-2, MIT dom | 82.69 | |
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 82.68 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 81.89 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 81.42 | |
| 2vkj_A | 106 | TM1634; membrane protein, TPR motif joint center f | 80.96 |
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
Probab=99.98 E-value=3.9e-30 Score=206.33 Aligned_cols=200 Identities=33% Similarity=0.515 Sum_probs=191.8
Q ss_pred cchHHHHHHhccccccEEEEEecccc-cccCCccc-ccCCCceEEEEEEEccccCCCCccCCCHHHHHHHHHHHHHHhHH
Q 046569 2 VNEGLERAIMTMKKEEQATVTISAEY-LCGHEVSE-LVCANSVLYYEVTLIDFTKEKPFWKMDTHEKIEACERKKHDGNL 79 (202)
Q Consensus 2 v~~~~~~~~~~m~~ge~~~~~~~~~~-~~~~~~~~-~~~~~~~~~~~i~l~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~ 79 (202)
++.+|+.++..|+.||++.+.++|.+ |+..|... .+|+++.+.|.+.+..+......+.......+..+..+...|+.
T Consensus 77 ~~~~~e~al~~~~~Ge~~~l~i~p~~ayg~~g~~~~~i~~~~~l~f~~~L~~~~~A~~~~~~a~~~~p~~a~~~~~~g~~ 156 (336)
T 1p5q_A 77 LPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTV 156 (336)
T ss_dssp CCHHHHHHHTTCCTTCEEEEEECTTTTTTTTCBGGGTBCSSCCEEEEEEEEEEECCCCGGGCCHHHHHHHHHHHHHHHHH
T ss_pred cchHHHHHHhcCCCCCeEEEEECCccccCcCCCCccCCCCCCeEEEEEEEeecccccchhcCCHHHHHHHHHHHHHHHHH
Confidence 58899999999999999999999999 99999665 69999999999999999999999999999999999999999999
Q ss_pred HHHcCcHHHHHHHHHHHHH--hHH---------------HHHHHHHHHHHHHhcCHHHHHHHHHHHhhhCCCChHHHHHH
Q 046569 80 LFRAGKYWRASKKYEKATN--GLR---------------LSCYLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALFRR 142 (202)
Q Consensus 80 ~~~~~~~~~A~~~y~~al~--~~~---------------~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~~ 142 (202)
++..|+|++|+..|.+++. |.. ..++.++|.||..+|+|++|+.+|+++++++|+++.+++++
T Consensus 157 ~~~~g~~~~A~~~y~~Al~~~p~~~~~~~~~~~~~~~~~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~l 236 (336)
T 1p5q_A 157 YFKEGKYKQALLQYKKIVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLSRR 236 (336)
T ss_dssp HHHHTCHHHHHHHHHHHHHHTTTCCCCCSHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHH
T ss_pred HHHCCCHHHHHHHHHHHHHHhhccccCChHHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHH
Confidence 9999999999999999999 555 68999999999999999999999999999999999999999
Q ss_pred HHHHhcCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcC
Q 046569 143 SQAYLKTSELEKDEADIKRALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKM 201 (202)
Q Consensus 143 g~~~~~~~~~~~A~~~~~~a~~l~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~ 201 (202)
|.+|..+|++++|+.+|++++.++|++..+...+..+...+.+..+++++.|++||+++
T Consensus 237 g~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~l~~~~~~~~~~~~a~~~~~~~~~~~~ 295 (336)
T 1p5q_A 237 GEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERL 295 (336)
T ss_dssp HHHHHHTTCHHHHHHHHHHHHHHCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999875
|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 | Back alignment and structure |
|---|
| >2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A | Back alignment and structure |
|---|
| >4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* | Back alignment and structure |
|---|
| >2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A | Back alignment and structure |
|---|
| >1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A | Back alignment and structure |
|---|
| >2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 | Back alignment and structure |
|---|
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1kt1a1 | 168 | a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M | 1e-14 | |
| d1p5qa1 | 170 | a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d | 3e-12 | |
| d2fbna1 | 153 | a.118.8.1 (A:22-174) Putative 70 kda peptidylproly | 6e-10 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-08 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 5e-06 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 9e-05 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 1e-04 | |
| d1ihga1 | 169 | a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau | 3e-08 | |
| d1a17a_ | 159 | a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo | 1e-06 | |
| d2c2la1 | 201 | a.118.8.1 (A:24-224) STIP1 homology and U box-cont | 2e-06 | |
| d1q1ca2 | 117 | d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H | 3e-05 | |
| d1hh8a_ | 192 | a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- | 5e-05 | |
| d1zbpa1 | 264 | e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V | 5e-05 | |
| d1ya0a1 | 497 | a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T | 1e-04 | |
| d1r9ha_ | 118 | d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd | 1e-04 | |
| d1q6ha_ | 210 | d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase | 3e-04 | |
| d1elwa_ | 117 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 3e-04 | |
| d1kt1a3 | 115 | d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M | 5e-04 | |
| d1elra_ | 128 | a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 | 7e-04 | |
| d2ppna1 | 107 | d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) | 7e-04 | |
| d1q1ca1 | 120 | d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu | 0.002 | |
| d1jvwa_ | 160 | d.26.1.1 (A:) Macrophage infectivity potentiator p | 0.002 | |
| d1fcha_ | 323 | a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting | 0.002 |
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP51, C-terminal domain species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Score = 66.5 bits (161), Expect = 1e-14
Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 17/163 (10%)
Query: 56 KPFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKAT-----------------N 98
K W+MDT EK+E K G + F+ GKY +A +Y K
Sbjct: 1 KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASE 60
Query: 99 GLRLSCYLNNAACKLKLEDYSEASSLCTKVLELEPLNVKALFRRSQAYLKTSELEKDEAD 158
L+ +LN A C LKL +Y++A C K L L+ N K L+RR +A L +E E + D
Sbjct: 61 SFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGD 120
Query: 159 IKRALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLSKM 201
++ L ++P N+ +L ++ +E+ + + +M K
Sbjct: 121 FEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFKKF 163
|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.96 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.96 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.93 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.91 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.89 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.84 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.81 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.78 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.75 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.73 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.69 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.68 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 99.65 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.61 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.6 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.6 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.59 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.59 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.57 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.53 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.53 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 99.52 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.52 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.5 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.49 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.44 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 99.42 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.27 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 99.24 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.21 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.2 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.2 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.07 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.06 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.04 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 99.01 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 98.99 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.98 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.98 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 98.92 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 98.89 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 98.86 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 98.85 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 98.85 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 98.83 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 98.8 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.78 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.76 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 98.74 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.74 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.74 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.64 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.6 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.57 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.54 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.53 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.41 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 98.31 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 98.16 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 98.13 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.05 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.87 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 96.44 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 94.41 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 94.12 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 93.17 | |
| d1wr0a1 | 77 | Vacuolar sorting protein 4b (VPS4B, SKD1 protein) | 92.32 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 90.44 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 85.29 | |
| d1qsaa1 | 450 | 70 KDa soluble lytic transglycosylase (SLT70), sup | 84.7 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 84.4 | |
| d1l1pa_ | 106 | Trigger factor PPIase domain {Escherichia coli [Ta | 83.38 |
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: FKBP51, C-terminal domain species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Probab=99.96 E-value=3.4e-28 Score=175.10 Aligned_cols=145 Identities=32% Similarity=0.599 Sum_probs=139.5
Q ss_pred CccCCCHHHHHHHHHHHHHHhHHHHHcCcHHHHHHHHHHHHH-----------------hHHHHHHHHHHHHHHHhcCHH
Q 046569 57 PFWKMDTHEKIEACERKKHDGNLLFRAGKYWRASKKYEKATN-----------------GLRLSCYLNNAACKLKLEDYS 119 (202)
Q Consensus 57 ~~~~~~~~~~~~~a~~~~~~g~~~~~~~~~~~A~~~y~~al~-----------------~~~~~~~~~~a~~~~~~~~~~ 119 (202)
..|.|+..+++..+..+++.|+.+|+.|+|.+|+..|.+||. +....++.|+|.||+++|+|+
T Consensus 2 e~~~m~~~E~~~~a~~~~e~G~~~~~~~~~~~A~~~Y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~Nla~~~~~l~~~~ 81 (168)
T d1kt1a1 2 ESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYT 81 (168)
T ss_dssp CGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCHH
T ss_pred CcccCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhccchhhhhhcchhHHHHHHhHHHHHHHhhhcc
Confidence 579999999999999999999999999999999999999996 556778999999999999999
Q ss_pred HHHHHHHHHhhhCCCChHHHHHHHHHHhcCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Q 046569 120 EASSLCTKVLELEPLNVKALFRRSQAYLKTSELEKDEADIKRALTIDPNNRDVKLVYMELKENQREYAKYQAEIFGSMLS 199 (202)
Q Consensus 120 ~A~~~~~~al~~~p~~~~~~~~~g~~~~~~~~~~~A~~~~~~a~~l~p~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~f~ 199 (202)
+|+.+|+++++++|+++++++++|.++..+|++++|+.+|++++.++|+|+.+...+..+...+++..+++++.|++||.
T Consensus 82 ~Ai~~~~~al~l~p~~~~a~~~~~~~~~~l~~~~~A~~~~~~al~l~P~n~~~~~~l~~~~~~~~~~~e~~kk~~~~~f~ 161 (168)
T d1kt1a1 82 KAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQIFMCQKKAKEHNERDRRTYANMFK 161 (168)
T ss_dssp HHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHSCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred cchhhhhhhhhcccchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred cC
Q 046569 200 KM 201 (202)
Q Consensus 200 ~~ 201 (202)
++
T Consensus 162 ~~ 163 (168)
T d1kt1a1 162 KF 163 (168)
T ss_dssp HH
T ss_pred hh
Confidence 75
|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|