Citrus Sinensis ID: 046633

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MEQRRSSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
cccccccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccccHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cccccccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccHccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHccccEEEEEEEEEEcccHHHHHccHHHHHHHHHccHHHHHHHHcHHHHcccEEccc
meqrrssklnvaiihpdlgiggAERLIVDAAVELVSHGHnvhvftahhdkrrcfeetvngtfpvtvygdflprhFFYRLHALCAYLRCLFVALCVLLRsssydviiaDQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
meqrrssklnvaiihpdlgigGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
MEQRRSSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQIlelllfevlfflARYYSTVIFRICYWLNTQLFLGGYIGSL
********LNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYI***
************IIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
********LNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
******SKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQRRSSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVIFRICYWLNTQLFLGGYIGSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query176 2.2.26 [Sep-21-2011]
O94738 455 Alpha-1,3/1,6-mannosyltra N/A no 0.681 0.263 0.528 1e-29
Q7KWM5 420 Alpha-1,3/1,6-mannosyltra yes no 0.693 0.290 0.5 1e-28
Q96WW6 506 Alpha-1,3/1,6-mannosyltra yes no 0.693 0.241 0.491 2e-27
P43636 503 Alpha-1,3/1,6-mannosyltra yes no 0.670 0.234 0.483 4e-26
Q6FJJ9 458 Alpha-1,3/1,6-mannosyltra yes no 0.687 0.264 0.487 4e-26
Q6CWQ0 503 Alpha-1,3/1,6-mannosyltra yes no 0.687 0.240 0.471 3e-25
Q755C1 514 Alpha-1,3/1,6-mannosyltra yes no 0.664 0.227 0.470 7e-25
Q9H553 416 Alpha-1,3/1,6-mannosyltra yes no 0.846 0.358 0.417 6e-24
Q59LF2 428 Alpha-1,3/1,6-mannosyltra N/A no 0.670 0.275 0.454 1e-23
Q9DBE8 415 Alpha-1,3/1,6-mannosyltra yes no 0.801 0.339 0.413 4e-22
>sp|O94738|ALG2_RHIPU Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Rhizomucor pusillus GN=ALG2 PE=1 SV=1 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/121 (52%), Positives = 80/121 (66%), Gaps = 1/121 (0%)

Query: 6   SSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVT 65
           S  LNVA IHPDLGIGGAERL+VDAAV +   GH V  +T+HHD   CFEET +GT  V 
Sbjct: 3   SKSLNVAFIHPDLGIGGAERLVVDAAVGIQKKGHQVIFYTSHHDPNHCFEETRDGTLKVQ 62

Query: 66  VYGDFLPRHFFYRLHALCAYLRC-LFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTK 124
           V GD+LPR  F R + LCA LR  + VA  +L    SYD+   DQ+S  +P+LK  ++ K
Sbjct: 63  VRGDWLPRTIFGRFYILCAILRQFVLVASLILWERHSYDIFFVDQLSACVPLLKWFTTAK 122

Query: 125 V 125
           +
Sbjct: 123 I 123
Mannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate.
Rhizomucor pusillus (taxid: 4840)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 2EC: 5EC: 7
>sp|Q7KWM5|ALG2_DICDI Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum GN=alg2 PE=3 SV=1 Back     alignment and function description
>sp|Q96WW6|ALG2_SCHPO Alpha-1,3/1,6-mannosyltransferase alg2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg2 PE=3 SV=2 Back     alignment and function description
>sp|P43636|ALG2_YEAST Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG2 PE=1 SV=2 Back     alignment and function description
>sp|Q6FJJ9|ALG2_CANGA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q6CWQ0|ALG2_KLULA Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q755C1|ALG2_ASHGO Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q9H553|ALG2_HUMAN Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens GN=ALG2 PE=1 SV=1 Back     alignment and function description
>sp|Q59LF2|ALG2_CANAL Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG2 PE=3 SV=1 Back     alignment and function description
>sp|Q9DBE8|ALG2_MOUSE Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Mus musculus GN=Alg2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
449438921 407 PREDICTED: alpha-1,3/1,6-mannosyltransfe 0.852 0.368 0.685 1e-54
359807347 407 uncharacterized protein LOC100809168 [Gl 0.857 0.371 0.698 3e-54
449483289 314 PREDICTED: alpha-1,3/1,6-mannosyltransfe 0.852 0.477 0.679 4e-54
255569305 408 alpha-1,3-mannosyltransferase, putative 0.857 0.370 0.673 7e-54
449438699 473 PREDICTED: LOW QUALITY PROTEIN: alpha-1, 0.857 0.319 0.660 2e-53
356549651 407 PREDICTED: alpha-1,3/1,6-mannosyltransfe 0.857 0.371 0.692 2e-53
297842657 405 hypothetical protein ARALYDRAFT_477043 [ 0.857 0.372 0.679 4e-53
22330726 403 alpha-1,3/alpha-1,6-mannosyltransferase 0.857 0.374 0.666 4e-53
20856587 403 At1g78800/F9K20_16 [Arabidopsis thaliana 0.857 0.374 0.666 5e-53
3834314 405 Similar to gene pi010 glycosyltransferas 0.857 0.372 0.666 5e-53
>gi|449438921|ref|XP_004137236.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  217 bits (553), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 107/156 (68%), Positives = 123/156 (78%), Gaps = 6/156 (3%)

Query: 1   MEQRRSSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNG 60
           MEQRRS K+ +AIIHPDLGIGGAERLIVDAAVEL S GHNVH+FT+HHDK RCFEET+ G
Sbjct: 1   MEQRRS-KMRIAIIHPDLGIGGAERLIVDAAVELASQGHNVHIFTSHHDKNRCFEETLAG 59

Query: 61  TFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLR 120
           TFPVTVYGDFLPRH FYRLHA+CAYLRC+FV LC+L   SS+DV++ADQVSVV+P+LKLR
Sbjct: 60  TFPVTVYGDFLPRHIFYRLHAVCAYLRCIFVTLCMLFMWSSFDVVLADQVSVVVPILKLR 119

Query: 121 SSTKVFMLNIARYMQILELLLFEVLFFLARYYSTVI 156
            S+KV       Y    +LLL +    L R Y   I
Sbjct: 120 RSSKVVF-----YCHFPDLLLAKHTTILRRLYRKPI 150

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359807347|ref|NP_001241379.1| uncharacterized protein LOC100809168 [Glycine max] gi|255642391|gb|ACU21459.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449483289|ref|XP_004156546.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255569305|ref|XP_002525620.1| alpha-1,3-mannosyltransferase, putative [Ricinus communis] gi|223535056|gb|EEF36738.1| alpha-1,3-mannosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449438699|ref|XP_004137125.1| PREDICTED: LOW QUALITY PROTEIN: alpha-1,3/1,6-mannosyltransferase ALG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356549651|ref|XP_003543205.1| PREDICTED: alpha-1,3/1,6-mannosyltransferase ALG2-like [Glycine max] Back     alignment and taxonomy information
>gi|297842657|ref|XP_002889210.1| hypothetical protein ARALYDRAFT_477043 [Arabidopsis lyrata subsp. lyrata] gi|297335051|gb|EFH65469.1| hypothetical protein ARALYDRAFT_477043 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|22330726|ref|NP_178001.2| alpha-1,3/alpha-1,6-mannosyltransferase [Arabidopsis thaliana] gi|332198034|gb|AEE36155.1| alpha-1,3/alpha-1,6-mannosyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|20856587|gb|AAM26674.1| At1g78800/F9K20_16 [Arabidopsis thaliana] gi|23308431|gb|AAN18185.1| At1g78800/F9K20_16 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3834314|gb|AAC83030.1| Similar to gene pi010 glycosyltransferase gi|2257490 from S. pombe clone 1750 gb|AB004534. ESTs gb|T46079 and gb|AA394466 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query176
TAIR|locus:2037608 403 AT1G78800 [Arabidopsis thalian 0.710 0.310 0.768 8.3e-51
DICTYBASE|DDB_G0272730 420 alg2 "alpha-1,3-mannosyltransf 0.670 0.280 0.516 1e-27
FB|FBgn0035401 424 CG1291 [Drosophila melanogaste 0.625 0.259 0.522 1.7e-27
ZFIN|ZDB-GENE-060502-2 455 alg2 "asparagine-linked glycos 0.687 0.265 0.495 7.6e-27
POMBASE|SPBC11B10.01 506 alg2 "mannosyltransferase comp 0.693 0.241 0.491 7.7e-26
SGD|S000003033 503 ALG2 "Mannosyltransferase in t 0.676 0.236 0.491 4.5e-25
CGD|CAL0002829 428 ALG2 [Candida albicans (taxid: 0.664 0.273 0.475 8.8e-24
UNIPROTKB|Q59LF2 428 ALG2 "Alpha-1,3/1,6-mannosyltr 0.664 0.273 0.475 8.8e-24
UNIPROTKB|F1NWX1 398 ALG2 "Uncharacterized protein" 0.642 0.283 0.521 5.3e-23
UNIPROTKB|F1SSE6 416 ALG2 "Uncharacterized protein" 0.653 0.276 0.475 1.8e-22
TAIR|locus:2037608 AT1G78800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 8.3e-51, P = 8.3e-51
 Identities = 96/125 (76%), Positives = 112/125 (89%)

Query:     1 MEQRRSSKLNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNG 60
             M ++  SK+N+AIIHPDLGIGGAERLIVDAAVEL SHGH VH+FT+HHDK RCFEET++G
Sbjct:     1 MAKKEGSKMNIAIIHPDLGIGGAERLIVDAAVELASHGHKVHIFTSHHDKSRCFEETLSG 60

Query:    61 TFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLR 120
              F VTVYG FLPRH FYRLHA+CAYLRCLFVALCVLL  SS+DV++ADQVSVV+P+LKL+
Sbjct:    61 IFQVTVYGSFLPRHIFYRLHAVCAYLRCLFVALCVLLGWSSFDVVLADQVSVVVPLLKLK 120

Query:   121 SSTKV 125
              S+KV
Sbjct:   121 RSSKV 125
GO:0009058 "biosynthetic process" evidence=IEA
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
DICTYBASE|DDB_G0272730 alg2 "alpha-1,3-mannosyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0035401 CG1291 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060502-2 alg2 "asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPBC11B10.01 alg2 "mannosyltransferase complex subunit Alg2 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
SGD|S000003033 ALG2 "Mannosyltransferase in the N-linked glycosylation pathway" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0002829 ALG2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59LF2 ALG2 "Alpha-1,3/1,6-mannosyltransferase ALG2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWX1 ALG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSE6 ALG2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.2__2173__AT1G78800.1
annotation not avaliable (405 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
Al_scaffold_0001_1715
annotation not avaliable (465 aa)
    ••• 0.497
fgenesh2_kg.6__3502__AT1G16570.1
annotation not avaliable (442 aa)
    ••• 0.472
scaffold_403530.1
annotation not avaliable (246 aa)
      • 0.436
fgenesh2_kg.108__2__AT2G40190.1
annotation not avaliable (463 aa)
    ••••0.433

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
cd03805 392 cd03805, GT1_ALG2_like, This family is most closel 7e-65
cd03811 353 cd03811, GT1_WabH_like, This family is most closel 1e-09
cd03820 348 cd03820, GT1_amsD_like, This family is most closel 7e-07
cd03801 374 cd03801, GT1_YqgM_like, This family is most closel 4e-06
cd03794 394 cd03794, GT1_wbuB_like, This family is most closel 2e-04
cd03798 377 cd03798, GT1_wlbH_like, This family is most closel 0.003
pfam13579158 pfam13579, Glyco_trans_4_4, Glycosyl transferase 4 0.004
>gnl|CDD|99977 cd03805, GT1_ALG2_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information 
 Score =  203 bits (518), Expect = 7e-65
 Identities = 72/118 (61%), Positives = 86/118 (72%), Gaps = 1/118 (0%)

Query: 9   LNVAIIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYG 68
           L VA IHPDLGIGGAERL+VDAA+ L S GH V ++T+HHD   CFEET +GT PV V G
Sbjct: 1   LRVAFIHPDLGIGGAERLVVDAALALQSRGHEVTIYTSHHDPSHCFEETKDGTLPVRVRG 60

Query: 69  DFLPRHFFYRLHALCAYLRCLFVALCVLLRSS-SYDVIIADQVSVVIPVLKLRSSTKV 125
           D+LPR  F R H LCAYLR L++AL +LL     YDV I DQVS  +P+LKL S +K+
Sbjct: 61  DWLPRSIFGRFHILCAYLRMLYLALYLLLLPDEKYDVFIVDQVSACVPLLKLFSPSKI 118

ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans. Length = 392
>gnl|CDD|99982 cd03811, GT1_WabH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99990 cd03820, GT1_amsD_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99974 cd03801, GT1_YqgM_like, This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>gnl|CDD|99968 cd03794, GT1_wbuB_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|99971 cd03798, GT1_wlbH_like, This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>gnl|CDD|222237 pfam13579, Glyco_trans_4_4, Glycosyl transferase 4-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 176
PLN02949 463 transferase, transferring glycosyl groups 100.0
cd03806 419 GT1_ALG11_like This family is most closely related 99.98
KOG0853 495 consensus Glycosyltransferase [Cell wall/membrane/ 99.96
cd03805 392 GT1_ALG2_like This family is most closely related 99.94
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 98.85
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 98.74
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.6
cd03794 394 GT1_wbuB_like This family is most closely related 98.56
cd03820 348 GT1_amsD_like This family is most closely related 98.56
cd03804 351 GT1_wbaZ_like This family is most closely related 98.55
PRK10307 412 putative glycosyl transferase; Provisional 98.52
cd04955 363 GT1_like_6 This family is most closely related to 98.5
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.5
cd03802 335 GT1_AviGT4_like This family is most closely relate 98.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.46
PRK10125 405 putative glycosyl transferase; Provisional 98.36
cd04951 360 GT1_WbdM_like This family is most closely related 98.34
cd03822 366 GT1_ecORF704_like This family is most closely rela 98.33
cd03809 365 GT1_mtfB_like This family is most closely related 98.31
cd03807 365 GT1_WbnK_like This family is most closely related 98.27
cd03811 353 GT1_WabH_like This family is most closely related 98.26
cd03812 358 GT1_CapH_like This family is most closely related 98.23
cd04962 371 GT1_like_5 This family is most closely related to 98.21
cd03816 415 GT1_ALG1_like This family is most closely related 98.2
cd03800 398 GT1_Sucrose_synthase This family is most closely r 98.15
cd03819 355 GT1_WavL_like This family is most closely related 98.14
cd03825 365 GT1_wcfI_like This family is most closely related 98.12
cd03823 359 GT1_ExpE7_like This family is most closely related 98.1
cd03821 375 GT1_Bme6_like This family is most closely related 98.06
TIGR03088 374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 98.02
cd03796 398 GT1_PIG-A_like This family is most closely related 98.01
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 98.0
cd03792 372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 97.91
cd01635 229 Glycosyltransferase_GTB_type Glycosyltransferases 97.9
cd03795 357 GT1_like_4 This family is most closely related to 97.89
cd03808 359 GT1_cap1E_like This family is most closely related 97.88
cd03801 374 GT1_YqgM_like This family is most closely related 97.87
KOG1387 465 consensus Glycosyltransferase [Cell wall/membrane/ 97.87
TIGR02472 439 sucr_P_syn_N sucrose-phosphate synthase, putative, 97.87
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 97.86
cd03818 396 GT1_ExpC_like This family is most closely related 97.83
cd03817 374 GT1_UGDG_like This family is most closely related 97.75
cd03798 377 GT1_wlbH_like This family is most closely related 97.74
PRK09922 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.66
PF09314185 DUF1972: Domain of unknown function (DUF1972); Int 97.63
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 97.58
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 97.57
cd03814 364 GT1_like_2 This family is most closely related to 97.53
cd03799 355 GT1_amsK_like This is a family of GT1 glycosyltran 97.52
cd03791 476 GT1_Glycogen_synthase_DULL1_like This family is mo 97.39
PF13528 318 Glyco_trans_1_3: Glycosyl transferase family 1 97.23
PLN02275 371 transferase, transferring glycosyl groups 97.2
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 97.08
TIGR02149 388 glgA_Coryne glycogen synthase, Corynebacterium fam 97.05
PRK15490 578 Vi polysaccharide biosynthesis protein TviE; Provi 96.9
cd05844 367 GT1_like_7 Glycosyltransferases catalyze the trans 96.56
PRK15484 380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 95.87
PLN02939 977 transferase, transferring glycosyl groups 95.79
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 95.7
PRK00654 466 glgA glycogen synthase; Provisional 95.67
TIGR02095 473 glgA glycogen/starch synthases, ADP-glucose type. 95.56
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 95.53
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 95.53
PLN02316 1036 synthase/transferase 95.1
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 94.84
TIGR00661 321 MJ1255 conserved hypothetical protein. This model 94.58
COG4671 400 Predicted glycosyl transferase [General function p 93.94
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 93.49
PF04007 335 DUF354: Protein of unknown function (DUF354); Inte 93.3
PF06564243 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ p 92.51
TIGR03590 279 PseG pseudaminic acid biosynthesis-associated prot 92.1
TIGR02470 784 sucr_synth sucrose synthase. This model represents 92.0
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 91.29
PRK10037250 cell division protein; Provisional 90.27
PLN02846 462 digalactosyldiacylglycerol synthase 89.2
PF08323245 Glyco_transf_5: Starch synthase catalytic domain; 88.83
PF02441129 Flavoprotein: Flavoprotein; InterPro: IPR003382 Th 88.52
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 88.51
PRK15427 406 colanic acid biosynthesis glycosyltransferase WcaL 88.45
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 88.3
PRK14099 485 glycogen synthase; Provisional 87.76
PF01975196 SurE: Survival protein SurE; InterPro: IPR002828 T 87.32
PRK14098 489 glycogen synthase; Provisional 86.9
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 84.41
KOG2941 444 consensus Beta-1,4-mannosyltransferase [Posttransl 83.54
PRK13886241 conjugal transfer protein TraL; Provisional 83.2
TIGR01007204 eps_fam capsular exopolysaccharide family. This mo 82.67
PLN03007 482 UDP-glucosyltransferase family protein 82.16
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 81.88
COG0489265 Mrp ATPases involved in chromosome partitioning [C 81.42
PLN02208 442 glycosyltransferase family protein 81.27
CHL00175281 minD septum-site determining protein; Validated 80.72
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information 
Probab=100.00  E-value=3.7e-34  Score=260.69  Aligned_cols=152  Identities=18%  Similarity=0.255  Sum_probs=131.0

Q ss_pred             ccCCCceEEEEeCCCCCC-chHHHHHHHHHHHHHCCC--eEEEEEeecCCCccccc----ccCCceeE---------EE-
Q 046633            4 RRSSKLNVAIIHPDLGIG-GAERLIVDAAVELVSHGH--NVHVFTAHHDKRRCFEE----TVNGTFPV---------TV-   66 (176)
Q Consensus         4 ~~~~~~kI~~~hpdLgiG-GAERlvvdlA~~l~~~Gh--~V~l~T~~~d~~hcF~E----t~~G~l~V---------~v-   66 (176)
                      ++.++++|+|+|||+|+| |||||+++++.+++++|+  +|+++|++||++|  +|    +.+ ++.|         .+ 
T Consensus        29 ~~~~~~~v~f~HP~~~~ggG~ERvl~~a~~~l~~~~~~~~v~iyt~~~d~~~--~~~l~~~~~-~~~i~~~~~~~~v~l~  105 (463)
T PLN02949         29 RRSRKRAVGFFHPYTNDGGGGERVLWCAVRAIQEENPDLDCVIYTGDHDASP--DSLAARARD-RFGVELLSPPKVVHLR  105 (463)
T ss_pred             ccCCCcEEEEECCCCCCCCChhhHHHHHHHHHHhhCCCCeEEEEcCCCCCCH--HHHHHHHHh-hcceecCCCceEEEec
Confidence            345678999999999998 999999999999999999  9999999999999  66    554 5666         56 


Q ss_pred             eCCcccchhhhhHHHHHHHHHHHHHHHHHHHhcCCCcEEEEcCCC--ccchheecccCceeeccccccccccchhhc---
Q 046633           67 YGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVS--VVIPVLKLRSSTKVFMLNIARYMQILELLL---  141 (176)
Q Consensus        67 ~Gd~lPr~i~gr~~alcA~lR~l~~~~~~~~~~~~~DVvi~Dqvs--~~iP~l~l~~~~~vlf~~~~~YcHFPd~Ll---  141 (176)
                      .|+|+|++++|||+.+|+++|++++++..+.+ ..| +|++||++  .++|++|+ .+.||+|     ||||||+++   
T Consensus       106 ~~~~~~~~~~~~~t~~~~~~~~~~l~~~~~~~-~~p-~v~vDt~~~~~~~pl~~~-~~~~v~~-----yvH~p~~~~dm~  177 (463)
T PLN02949        106 KRKWIEEETYPRFTMIGQSLGSVYLAWEALCK-FTP-LYFFDTSGYAFTYPLARL-FGCKVVC-----YTHYPTISSDMI  177 (463)
T ss_pred             cccccccccCCceehHHHHHHHHHHHHHHHHh-cCC-CEEEeCCCcccHHHHHHh-cCCcEEE-----EEeCCcchHHHH
Confidence            79999999999999999999999999886644 344 56679998  99999994 4789999     999999886   


Q ss_pred             ----------------ccch--hHHHHHHHHHHHHHHHHHhhh
Q 046633          142 ----------------FEVL--FFLARYYSTVIFRICYWLNTQ  166 (176)
Q Consensus       142 ----------------~~~~--~~lk~lYr~p~d~~Ee~t~~~  166 (176)
                                      +++.  +.+|++|+.++|++|+++++.
T Consensus       178 ~~v~~~~~~~~~~~~~a~~~~~~~~k~~Y~~~~~~l~~~~~~~  220 (463)
T PLN02949        178 SRVRDRSSMYNNDASIARSFWLSTCKILYYRAFAWMYGLVGRC  220 (463)
T ss_pred             HHHhhcccccCccchhhccchhHHHHHHHHHHHHHHHHHHcCC
Confidence                            3333  789999999999999998754

>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0853 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>KOG1387 consensus Glycosyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PF09314 DUF1972: Domain of unknown function (DUF1972); InterPro: IPR015393 This domain is functionally uncharacterised and found in bacterial glycosyltransferases and rhamnosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF06564 YhjQ: YhjQ protein; InterPro: IPR017746 The YhjQ protein is encoded immediately upstream of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae, and in several species is clearly part of the bcs operon Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PF08323 Glyco_transf_5: Starch synthase catalytic domain; InterPro: IPR013534 This region represents the catalytic domain of glycogen (or starch) synthases that use ADP-glucose (2 Back     alignment and domain information
>PF02441 Flavoprotein: Flavoprotein; InterPro: IPR003382 This entry contains a diverse range of flavoprotein enzymes, including epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN [] Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PF01975 SurE: Survival protein SurE; InterPro: IPR002828 This entry represents a SurE-like structural domain with a 3-layer alpha/bete/alpha topology that bears some topological similarity to the N-terminal domain of the glutaminase/asparaginase family Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query176
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 5e-05
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 5e-05
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 2e-04
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 4e-04
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406 Back     alignment and structure
 Score = 41.5 bits (98), Expect = 5e-05
 Identities = 15/109 (13%), Positives = 33/109 (30%), Gaps = 10/109 (9%)

Query: 1   MEQRRSSKLNVAII--HPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETV 58
               R S + + ++  +     GG +  ++  A  L   GH V V        +  +  V
Sbjct: 13  GLVPRGSHMRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVV 72

Query: 59  NGTFPVTVYGDFLPRHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIA 107
           +G   V +  +       +               +   +    +DV+  
Sbjct: 73  SGGKAVPIPYNGSVARLRFGPAT--------HRKVKKWIAEGDFDVLHI 113
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Length = 394 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Length = 394 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 98.98
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 98.8
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 98.74
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 98.71
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 98.68
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 98.6
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 98.5
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 98.47
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.42
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 98.36
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 98.33
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 98.22
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 98.2
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 98.18
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 98.16
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 98.06
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 97.95
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 97.93
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 97.83
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 97.81
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 97.78
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 97.66
3oy2_A 413 Glycosyltransferase B736L; rossmann fold, GDP-mann 97.64
2x0d_A 413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 97.48
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 97.42
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 97.34
2hy7_A 406 Glucuronosyltransferase GUMK; glycosyltransferases 96.61
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 96.53
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 96.39
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 96.26
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 96.13
3vue_A 536 GBSS-I, granule-bound starch synthase 1, chloropla 95.73
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 95.58
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 95.53
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 95.12
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 94.24
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 94.12
3end_A307 Light-independent protochlorophyllide reductase ir 92.78
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 91.35
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 90.55
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 89.99
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 88.25
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 87.35
2a5l_A200 Trp repressor binding protein WRBA; APC5760, PA094 87.1
2zki_A199 199AA long hypothetical Trp repressor binding prot 85.74
1ydg_A211 Trp repressor binding protein WRBA; tetramer, stru 85.46
3f6r_A148 Flavodoxin; FMN binding, oxidized, electron transp 85.22
2xci_A 374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 84.0
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 82.47
2xj4_A 286 MIPZ; replication, cell division, ATPase, WACA; 1. 82.05
3mc3_A134 DSRE/DSRF-like family protein; structural genomics 81.69
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 81.29
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 81.26
3hbm_A 282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 81.07
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 81.0
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 80.9
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 80.9
3b6i_A198 Flavoprotein WRBA; flavoproteins, NADH:quinone oxi 80.46
3hly_A161 Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein 80.31
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
Probab=98.98  E-value=6.5e-09  Score=86.66  Aligned_cols=44  Identities=27%  Similarity=0.504  Sum_probs=39.4

Q ss_pred             CCceEEEEeCC---CCCCchHHHHHHHHHHHHHCCCeEEEEEeecCC
Q 046633            7 SKLNVAIIHPD---LGIGGAERLIVDAAVELVSHGHNVHVFTAHHDK   50 (176)
Q Consensus         7 ~~~kI~~~hpd---LgiGGAERlvvdlA~~l~~~Gh~V~l~T~~~d~   50 (176)
                      ++|||+++.+.   ...||+|+.+.++|++|+++||+|+++|...+.
T Consensus         1 r~MkIl~v~~~~~p~~~gG~~~~~~~la~~L~~~G~~V~v~~~~~~~   47 (439)
T 3fro_A            1 RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGR   47 (439)
T ss_dssp             CCCEEEEECSCCTTSCSSSHHHHHHHHHHHHHHTTCEEEEEEECTTC
T ss_pred             CceEEEEEecccCCcccCCHHHHHHHHHHHHHHCCCeEEEEecCCCC
Confidence            47999999988   567999999999999999999999999976543
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2a5l_A Trp repressor binding protein WRBA; APC5760, PA0949, protein structure initiative, PSI, structural genomics; 1.70A {Pseudomonas aeruginosa} SCOP: c.23.5.8 PDB: 1zwk_A 1zwl_A* Back     alignment and structure
>2zki_A 199AA long hypothetical Trp repressor binding protein; alpha/beta structure, transcription; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ydg_A Trp repressor binding protein WRBA; tetramer, structural genomics, PSI, protein structure initiative; 2.00A {Deinococcus radiodurans} SCOP: c.23.5.8 PDB: 1yrh_A* Back     alignment and structure
>3f6r_A Flavodoxin; FMN binding, oxidized, electron transport, flavoprotein, FMN, transport; HET: FMN; 2.00A {Desulfovibrio desulfuricans} SCOP: c.23.5.0 PDB: 3f6s_A* 3f90_A* 3kap_A* 3kaq_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>3mc3_A DSRE/DSRF-like family protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.49A {Sulfolobus solfataricus} Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3b6i_A Flavoprotein WRBA; flavoproteins, NADH:quinone oxidoreductase, FMN; HET: FMN 15P; 1.66A {Escherichia coli} PDB: 2r96_A* 2r97_A 2rg1_A* 3b6j_A* 3b6k_A* 3b6m_A* Back     alignment and structure
>3hly_A Flavodoxin-like domain; Q5MZP6_SYNP6, flavoprotein, DFA1, SNR135D, NESG, structural genomics, PSI-2; 2.40A {Synechococcus elongatus pcc 6301} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 176
d2iw1a1 370 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynt 3e-04
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Length = 370 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Lipopolysaccharide core biosynthesis protein RfaG
species: Escherichia coli [TaxId: 562]

 Score = 38.0 bits (86), Expect = 3e-04
 Identities = 18/131 (13%), Positives = 39/131 (29%), Gaps = 3/131 (2%)

Query: 13  IIHPDLGIGGAERLIVDAAVELVSHGHNVHVFTAHHDKRRCFEETVNGTFPVTVYGDFLP 72
            ++     GG +R  +  A  + + GH+V V+T   +        +    PV  + +   
Sbjct: 5   CLYKYFPFGGLQRDFMRIASTVAARGHHVRVYTQSWEGDCPKAFELIQ-VPVKSHTNHGR 63

Query: 73  RHFFYRLHALCAYLRCLFVALCVLLRSSSYDVIIADQVSVVIPVLKLRSSTKVFMLNIAR 132
              +Y    +  +L+       V         +           +         + +  R
Sbjct: 64  NAEYYA--WVQNHLKEHPADRVVGFNKMPGLDVYFAADVCYAEKVAQEKGFLYRLTSRYR 121

Query: 133 YMQILELLLFE 143
           +    E   FE
Sbjct: 122 HYAAFERATFE 132

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query176
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 98.53
d2iw1a1 370 Lipopolysaccharide core biosynthesis protein RfaG 98.29
d1rzua_ 477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 96.84
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 96.66
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 96.36
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 95.78
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 95.3
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 94.53
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 94.23
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 94.0
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 91.05
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 90.48
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 89.28
d1uana_227 Hypothetical protein TT1542 {Thermus thermophilus 89.12
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 89.02
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 88.58
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 86.21
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 84.3
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 83.41
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 82.48
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 82.24
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 82.24
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 82.04
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 81.14
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 80.61
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 80.4
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Glycosyl transferases group 1
domain: Glycogen synthase 1, GlgA
species: Pyrococcus abyssi [TaxId: 29292]

Probab=98.53  E-value=2.3e-07  Score=75.22  Aligned_cols=41  Identities=29%  Similarity=0.488  Sum_probs=35.2

Q ss_pred             ceEEEEeC---CCCCCchHHHHHHHHHHHHHCCCeEEEEEeecC
Q 046633            9 LNVAIIHP---DLGIGGAERLIVDAAVELVSHGHNVHVFTAHHD   49 (176)
Q Consensus         9 ~kI~~~hp---dLgiGGAERlvvdlA~~l~~~Gh~V~l~T~~~d   49 (176)
                      |||+++..   ---.||+|+++-+||++|+++||+|+++|..++
T Consensus         1 MkIl~~~~~~pP~~~GG~~~~~~~La~~L~~~Gh~V~Vvtp~~~   44 (437)
T d2bisa1           1 MKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHG   44 (437)
T ss_dssp             CEEEEECSCCTTCCSSSHHHHHHHHHHHHHHTTCEEEEEEECTT
T ss_pred             CEEEEECCccCCcccCCHHHHHHHHHHHHHHcCCEEEEEecCCC
Confidence            89999983   223699999999999999999999999997544
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uana_ c.134.1.1 (A:) Hypothetical protein TT1542 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure