Citrus Sinensis ID: 046651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESLLLREITRTSRSVNNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
cccccEEEEEEccccHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcccccEEEccccccccccccccccHHHHHHcccccEEEEcHHHHHHHHHHcccEEEccccccccccEEEEcccccccccccccccccEEEEEEEEEEccccccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHHccccHHccccccccccccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHcccccccccEEEEEEEEcccccccccHHHHHHHHHccccccccEEcccccccccccccccccc
ccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccEEEEccccccccccccccccHHHHHHcccccEEEEcHHHHHHHHHcccEEEEEEEEEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEcccccccEEEEEEEccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEccEccccccccHHHHHHHHHHHccccHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHccccHHHHHHHccccccccccccccccHHHHHHHHHcccccccEEEEEcccHHHcccccccccc
KLEFVRTLLIDNYDSYTYNIYQElstingvppvvvrndewtwRDICRYLYeenafdnivispgpgspacpedIGICLRVLLecwdvpilgvclghqalgfvhgadivhapepvhgrlseivhngdrlfhdipsgqnsgfkvVRYHSLiidadslpkelipiawsnsadgfsylgtlqsgeipdayqsqSRQKILLSDISTqikngsyrhsiYSNRMRREVLMGIMhstrphygvqfhpesiatcYGSKILRNFREITEDYWKRLrspfvkernvhytgaESLLLREITRtsrsvnnsdelgrealrprqlfcdlgdrrfgiqhsrRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCelfgnnkaentfwldssstekvgflhndfcy
KLEFVRTLLIDNYDSYTYNIYQelstingvppvvVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSdistqikngsyrhsiysnRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRlrspfvkernvhytgaeslllreitrtsrsvnnsdelgrealrprqlfcdLGDRRFGIQhsrrfeiqrssigvkcLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTfwldssstekvgflhndfcy
KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESLLLREITRTSRSVNNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
***FVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEI**********KILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESLLLREIT*****************RPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDF**
**EFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYW******************************************ALRPRQLFCDLGD********************KCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESLLLREITRTSRSVNNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
**EFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQ*****************************YRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRS************AESLLLREITRTSRSVNNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESLLLREITRTSRSVNNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKVGFLHNDFCY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query392 2.2.26 [Sep-21-2011]
P32483 723 Para-aminobenzoate syntha yes no 0.494 0.268 0.403 9e-44
Q08654 589 Anthranilate synthase com yes no 0.497 0.331 0.344 1e-31
Q5V632190 Anthranilate synthase com no no 0.461 0.952 0.361 1e-30
P00902194 Anthranilate synthase com yes no 0.482 0.974 0.356 2e-30
P26923196 Anthranilate synthase com yes no 0.469 0.938 0.364 3e-29
O27693196 Anthranilate synthase com yes no 0.479 0.959 0.333 8e-29
Q06129195 Anthranilate synthase com yes no 0.466 0.938 0.361 1e-28
Q5V214207 Anthranilate synthase com no no 0.471 0.893 0.337 9e-28
Q1XDC5189 Anthranilate synthase com N/A no 0.469 0.973 0.357 1e-27
P28819194 Para-aminobenzoate/anthra yes no 0.466 0.943 0.349 2e-27
>sp|P32483|PABS_STRGR Para-aminobenzoate synthase OS=Streptomyces griseus GN=pab PE=3 SV=1 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 134/258 (51%), Gaps = 64/258 (24%)

Query: 5   VRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGP 64
           +RTLL+DNYDS+TYN++  LS  NG  P V+RND+  WR         +AFDN+V+SPGP
Sbjct: 1   MRTLLVDNYDSFTYNLFHYLSRANGREPEVIRNDDPAWRPGLL-----DAFDNVVLSPGP 55

Query: 65  GSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNG 124
           G+P  P D G+C R+  E   +P+LGVCLGHQ +   HGA +  APEP HGR S + H+G
Sbjct: 56  GTPHRPADFGLCARIAEE-GRLPVLGVCLGHQGMALAHGARVGRAPEPRHGRTSAVRHDG 114

Query: 125 DRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPDA 184
             LF  +P       +VVRYHSL +    LP EL   AWS   DG               
Sbjct: 115 TGLFEGLP----QPLEVVRYHSLAV--TELPPELEATAWSE--DG--------------- 151

Query: 185 YQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATC 244
                                              VLM + H T P +GVQFHPESI T 
Sbjct: 152 -----------------------------------VLMALRHRTLPLWGVQFHPESIGTQ 176

Query: 245 YGSKILRNFREITEDYWK 262
            G ++L NFR++TE + +
Sbjct: 177 DGHRLLANFRDLTERHGR 194
Catalyzes the biosynthesis of 4-amino-4-deoxychorismate (ADC) from chorismate and glutamine.
Streptomyces griseus (taxid: 1911)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 8EC: 5
>sp|Q08654|TRPG_THEMA Anthranilate synthase component II OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 Back     alignment and function description
>sp|Q5V632|TRPG2_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1 Back     alignment and function description
>sp|P00902|TRPG_ACIAD Anthranilate synthase component 2 OS=Acinetobacter sp. (strain ADP1) GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|P26923|TRPG_METTM Anthranilate synthase component II OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|O27693|TRPG_METTH Anthranilate synthase component II OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|Q06129|TRPG_SULSO Anthranilate synthase component II OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=trpG PE=1 SV=2 Back     alignment and function description
>sp|Q5V214|TRPG1_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG1 PE=3 SV=1 Back     alignment and function description
>sp|Q1XDC5|TRPG_PORYE Anthranilate synthase component II OS=Porphyra yezoensis GN=trpG PE=4 SV=1 Back     alignment and function description
>sp|P28819|PABA_BACSU Para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II OS=Bacillus subtilis (strain 168) GN=pabA PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
359486886 909 PREDICTED: para-aminobenzoate synthase-l 0.928 0.400 0.623 1e-132
255577381 914 p-aminobenzoate synthase, putative [Rici 0.956 0.410 0.648 1e-132
356574601 924 PREDICTED: para-aminobenzoate synthase-l 0.956 0.405 0.596 1e-131
356533973 927 PREDICTED: para-aminobenzoate synthase-l 0.956 0.404 0.595 1e-131
224109752 928 p-aminobenzoate synthase [Populus tricho 0.966 0.408 0.594 1e-125
350535751 902 aminodeoxychorismate synthase/glutamine 0.903 0.392 0.583 1e-124
296086031 853 unnamed protein product [Vitis vinifera] 0.813 0.373 0.594 1e-124
449449473 901 PREDICTED: para-aminobenzoate synthase-l 0.931 0.405 0.585 1e-122
449487191 497 PREDICTED: uncharacterized protein LOC10 0.931 0.734 0.585 1e-121
147770319 919 hypothetical protein VITISV_025570 [Viti 0.892 0.380 0.591 1e-120
>gi|359486886|ref|XP_002274386.2| PREDICTED: para-aminobenzoate synthase-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  479 bits (1233), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 242/388 (62%), Positives = 287/388 (73%), Gaps = 24/388 (6%)

Query: 1   KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVI 60
           KLEFVRTLLIDNYDSYTYNIYQELS ING+PPVVV ND+  W+++C YLYEENAFDNIVI
Sbjct: 78  KLEFVRTLLIDNYDSYTYNIYQELSIINGLPPVVVHNDDLGWKEVCHYLYEENAFDNIVI 137

Query: 61  SPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEI 120
           SPGPGSPAC  DIGICL++LLEC D+PILGVCLGHQALG+VHGA +VHA EP+HGRLSEI
Sbjct: 138 SPGPGSPACSADIGICLQLLLECRDIPILGVCLGHQALGYVHGARVVHASEPIHGRLSEI 197

Query: 121 VHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGE 180
            HNG RLFH+IPSG+NSGFKVVRYHSL++DA SLP ELIPIAW++S+D  SYL T +S  
Sbjct: 198 EHNGCRLFHNIPSGKNSGFKVVRYHSLVVDAKSLPNELIPIAWTSSSDLLSYLETQKSDI 257

Query: 181 IPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRM-RREVLMGIMHSTRPHYGVQFHPE 239
           + +AY+SQ  QK      S+++KNG+   S ++ RM    VLMGIMHSTRPHYG+QFHPE
Sbjct: 258 VLEAYESQKGQKSSFDSFSSKLKNGTSWPSRHTERMGNSRVLMGIMHSTRPHYGLQFHPE 317

Query: 240 SIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTG-----AESLLLREITRTSRSV 294
           SI T +G +I +NFRE+T+DYW R RS  V ERN  Y          L  R I +  + V
Sbjct: 318 SIGTSFGRQIFKNFREMTQDYWLRSRSSVVSERNTVYLAYVQARHAGLPFRGIPKRKQLV 377

Query: 295 NNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVG 354
           N+ D                  + FG+ +     +  S  G   LKL WRKF+HLAS VG
Sbjct: 378 NDVD----------------ARKSFGMLNLLNLSVPSS--GFTFLKLKWRKFNHLASEVG 419

Query: 355 GARNIFCELFGNNKAENTFWLDSSSTEK 382
           GARNIFC+LFG++KAENTFWLDSSSTEK
Sbjct: 420 GARNIFCKLFGDHKAENTFWLDSSSTEK 447

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577381|ref|XP_002529570.1| p-aminobenzoate synthase, putative [Ricinus communis] gi|223530946|gb|EEF32804.1| p-aminobenzoate synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356574601|ref|XP_003555434.1| PREDICTED: para-aminobenzoate synthase-like [Glycine max] Back     alignment and taxonomy information
>gi|356533973|ref|XP_003535532.1| PREDICTED: para-aminobenzoate synthase-like [Glycine max] Back     alignment and taxonomy information
>gi|224109752|ref|XP_002315300.1| p-aminobenzoate synthase [Populus trichocarpa] gi|222864340|gb|EEF01471.1| p-aminobenzoate synthase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|350535751|ref|NP_001234467.1| aminodeoxychorismate synthase/glutamine amidotransferase [Solanum lycopersicum] gi|40218381|gb|AAR83121.1| aminodeoxychorismate synthase/glutamine amidotransferase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|296086031|emb|CBI31472.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449473|ref|XP_004142489.1| PREDICTED: para-aminobenzoate synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487191|ref|XP_004157523.1| PREDICTED: uncharacterized protein LOC101227556 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147770319|emb|CAN73645.1| hypothetical protein VITISV_025570 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query392
TAIR|locus:2053255 919 emb1997 "embryo defective 1997 0.951 0.405 0.551 4.3e-109
TIGR_CMR|CHY_1931191 CHY_1931 "para-aminobenzoate/a 0.372 0.764 0.462 1.2e-35
UNIPROTKB|Q0C1A0190 trpG "Anthranilate synthase co 0.377 0.778 0.419 9e-34
TIGR_CMR|CHY_1586189 CHY_1586 "para-aminobenzoate/a 0.375 0.777 0.417 1.1e-33
UNIPROTKB|Q48NP9199 trpG "Anthranilate synthase, c 0.380 0.748 0.423 3e-33
UNIPROTKB|Q88A05199 trpG "Anthranilate synthase, c 0.380 0.748 0.423 3e-33
TIGR_CMR|BA_0069195 BA_0069 "para-aminobenzoate sy 0.377 0.758 0.407 6.2e-33
TIGR_CMR|SO_0613191 SO_0613 "para-aminobenzoate sy 0.408 0.837 0.403 7.9e-33
UNIPROTKB|Q488X6199 pabA "Anthranilate synthase co 0.377 0.743 0.426 1.3e-32
TIGR_CMR|CPS_0638199 CPS_0638 "anthranilate synthas 0.377 0.743 0.426 1.3e-32
TAIR|locus:2053255 emb1997 "embryo defective 1997" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1078 (384.5 bits), Expect = 4.3e-109, P = 4.3e-109
 Identities = 214/388 (55%), Positives = 271/388 (69%)

Query:     1 KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVI 60
             KL FVRTLLIDNYDSYT+NIYQ LSTINGVPPVV+RNDEWTW +   YLYE+ AFDNIVI
Sbjct:    81 KLGFVRTLLIDNYDSYTFNIYQALSTINGVPPVVIRNDEWTWEEAYHYLYEDVAFDNIVI 140

Query:    61 SPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEI 120
             SPGPGSP CP DIGICLR+LLEC D+PILGVCLGHQALG+VHGA +VHAPEPVHGRLS I
Sbjct:   141 SPGPGSPMCPADIGICLRLLLECRDIPILGVCLGHQALGYVHGAHVVHAPEPVHGRLSGI 200

Query:   121 VHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGE 180
              H+G+ LF DIPSG+NS FKVVRYHSLIID +SLPKEL+PIAW+   D  S+        
Sbjct:   201 EHDGNILFSDIPSGRNSDFKVVRYHSLIIDKESLPKELVPIAWTIYDDTGSFSEKNSCVP 260

Query:   181 IPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSN-RMRREVLMGIMHSTRPHYGVQFHPE 239
             + +         ++   +S +++N S+  S + N +  R +LMGIMHS+ PHYG+QFHPE
Sbjct:   261 VNNTGSPLGNGSVI--PVSEKLENRSHWPSSHVNGKQDRHILMGIMHSSFPHYGLQFHPE 318

Query:   240 SIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTGAESL-----LLREITRTSRSV 294
             SIAT YGS++ +NF++IT +YW R +S  ++ RN++ T    +     LL+E++RT  + 
Sbjct:   319 SIATTYGSQLFKNFKDITVNYWSRCKSTSLRRRNINDTANMQVPDATQLLKELSRTRCTG 378

Query:   295 NNSDELGREALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVG 354
             N S   G     P+ LF     +  G+      +        K L+L W+K + LA  VG
Sbjct:   379 NGSSYFGN----PKSLF---SAKTNGVDVFDMVDSSYPKPHTKLLRLKWKKHERLAHKVG 431

Query:   355 GARNIFCELFGNNKAENTFWLDSSSTEK 382
             G RNIF ELFG N+  +TFWLD+SS++K
Sbjct:   432 GVRNIFMELFGKNRGNDTFWLDTSSSDK 459
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0009396 "folic acid-containing compound biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0016833 "oxo-acid-lyase activity" evidence=IEA
GO:0008153 "para-aminobenzoic acid biosynthetic process" evidence=NAS
GO:0046417 "chorismate metabolic process" evidence=IDA
GO:0046656 "folic acid biosynthetic process" evidence=NAS
GO:0046820 "4-amino-4-deoxychorismate synthase activity" evidence=IDA
TIGR_CMR|CHY_1931 CHY_1931 "para-aminobenzoate/anthranilate synthase glutamine amidotransferase, component II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C1A0 trpG "Anthranilate synthase component II" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1586 CHY_1586 "para-aminobenzoate/anthranilate synthase glutamine amidotransferase, component II" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q48NP9 trpG "Anthranilate synthase, component II" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q88A05 trpG "Anthranilate synthase, component II" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0069 BA_0069 "para-aminobenzoate synthase glutamine amidotransferase, component II" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SO_0613 SO_0613 "para-aminobenzoate synthase glutamine amidotransferase, component II" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q488X6 pabA "Anthranilate synthase component II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_0638 CPS_0638 "anthranilate synthase component II" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
PABAS
p-aminobenzoate synthase (928 aa)
(Populus trichocarpa)
Predicted Functional Partners:
ASA2
anthranilate synthase, alpha subunit 2 (EC-4.1.3.27) (530 aa)
  •  •••0.814
ASA1
anthranilate synthase, alpha subunit 1 (EC-4.1.3.27) (532 aa)
  •  •••0.814
ASB1
anthranilate synthase, beta subunit, ASB1 (EC-4.1.3.27) (276 aa)
 ••  • •0.811
ASB2
anthranilate synthase, beta subunit, ASB2 (EC-4.1.3.27) (240 aa)
  •  •••0.809
CM1|CM
chorismate mutase (EC-5.4.99.5) (258 aa)
     •  0.800
CM1
chorismate mutase (EC-5.4.99.5) (257 aa)
     •  0.800
CS1
chorismate synthase (EC-4.2.3.5) (438 aa)
     •  0.800
CM2
chorismate mutase (EC-5.4.99.5) (255 aa)
     •  0.800
CS2
RecName- Full=Chorismate synthase; EC=4.2.3.5; (437 aa)
     •  0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
PLN02889 918 PLN02889, PLN02889, oxo-acid-lyase/anthranilate sy 0.0
cd01743184 cd01743, GATase1_Anthranilate_Synthase, Type 1 glu 9e-77
PRK05670189 PRK05670, PRK05670, anthranilate synthase componen 5e-72
COG0512191 COG0512, PabA, Anthranilate/para-aminobenzoate syn 1e-70
PRK14607 534 PRK14607, PRK14607, bifunctional glutamine amidotr 1e-57
CHL00101190 CHL00101, trpG, anthranilate synthase component 2 4e-50
PRK07765214 PRK07765, PRK07765, para-aminobenzoate synthase co 1e-44
PRK07649195 PRK07649, PRK07649, para-aminobenzoate/anthranilat 2e-44
PRK06774191 PRK06774, PRK06774, para-aminobenzoate synthase co 3e-44
pfam00117186 pfam00117, GATase, Glutamine amidotransferase clas 8e-44
TIGR00566188 TIGR00566, trpG_papA, glutamine amidotransferase o 6e-43
PRK08857193 PRK08857, PRK08857, para-aminobenzoate synthase co 9e-42
PRK08007187 PRK08007, PRK08007, para-aminobenzoate synthase co 4e-40
PLN02335222 PLN02335, PLN02335, anthranilate synthase 8e-38
TIGR01823 742 TIGR01823, PabB-fungal, aminodeoxychorismate synth 2e-31
PRK13566720 PRK13566, PRK13566, anthranilate synthase; Provisi 2e-29
TIGR01815717 TIGR01815, TrpE-clade3, anthranilate synthase, alp 8e-25
PRK09522 531 PRK09522, PRK09522, bifunctional glutamine amidotr 4e-20
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase 4e-16
PRK05637208 PRK05637, PRK05637, anthranilate synthase componen 1e-15
PRK00758184 PRK00758, PRK00758, GMP synthase subunit A; Valida 3e-14
cd01742181 cd01742, GATase1_GMP_Synthase, Type 1 glutamine am 9e-14
TIGR00888188 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hyd 3e-12
cd01744178 cd01744, GATase1_CPSase, Small chain of the glutam 6e-10
PRK06895190 PRK06895, PRK06895, putative anthranilate synthase 2e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase 4e-08
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferas 4e-08
COG0518198 COG0518, GuaA, GMP synthase - Glutamine amidotrans 6e-08
PRK12564360 PRK12564, PRK12564, carbamoyl phosphate synthase s 6e-08
COG0505368 COG0505, CarA, Carbamoylphosphate synthase small s 7e-08
TIGR01368358 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synt 1e-06
PRK12838354 PRK12838, PRK12838, carbamoyl phosphate synthase s 2e-06
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 4e-06
CHL00197382 CHL00197, carA, carbamoyl-phosphate synthase argin 5e-06
PRK00074 511 PRK00074, guaA, GMP synthase; Reviewed 5e-05
cd01741188 cd01741, GATase1_1, Subgroup of proteins having th 8e-05
PRK13170196 PRK13170, hisH, imidazole glycerol phosphate synth 0.002
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synth 0.003
>gnl|CDD|215481 PLN02889, PLN02889, oxo-acid-lyase/anthranilate synthase Back     alignment and domain information 
 Score =  608 bits (1570), Expect = 0.0
 Identities = 259/389 (66%), Positives = 298/389 (76%), Gaps = 15/389 (3%)

Query: 1   KLEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVI 60
           KLEFVRTLLIDNYDSYTYNIYQELS +NGVPPVVVRNDEWTW ++  YLYEE AFDNIVI
Sbjct: 78  KLEFVRTLLIDNYDSYTYNIYQELSIVNGVPPVVVRNDEWTWEEVYHYLYEEKAFDNIVI 137

Query: 61  SPGPGSPACPEDIGICLRVLLECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEI 120
           SPGPGSP CP DIGICLR+LLEC D+PILGVCLGHQALG+VHGA IVHAPEPVHGRLSEI
Sbjct: 138 SPGPGSPTCPADIGICLRLLLECRDIPILGVCLGHQALGYVHGARIVHAPEPVHGRLSEI 197

Query: 121 VHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGE 180
            HNG RLF DIPSG+NSGFKVVRYHSL+IDA+SLPKEL+PIAW++S+D  S+L + +SG 
Sbjct: 198 EHNGCRLFDDIPSGRNSGFKVVRYHSLVIDAESLPKELVPIAWTSSSDTLSFLESQKSGL 257

Query: 181 IPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMR-REVLMGIMHSTRPHYGVQFHPE 239
           +PDAY+SQ  Q       S+++KNG+   S +S RM+  ++LMGIMHSTRPHYG+QFHPE
Sbjct: 258 VPDAYESQIGQSGSSDPFSSKLKNGTSWPSSHSERMQNGKILMGIMHSTRPHYGLQFHPE 317

Query: 240 SIATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYTG-----AESLLLREITRTSRSV 294
           SIATCYG +I +NFREIT+DYW RLRS  ++ RN + T        S L +   R  +  
Sbjct: 318 SIATCYGRQIFKNFREITQDYWLRLRSTSLRRRNSNLTANMQVPDASQLFKVPRRG-QLG 376

Query: 295 NNSDELG-REALRPRQLFCDLGDRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTV 353
           N  D LG RE  R  QL       R  +       +   S GVK LKL WRKF+ LA+ V
Sbjct: 377 NGEDALGNRELSRRAQL-------RGSVDVFSLLNLSEPSSGVKFLKLKWRKFNKLAAQV 429

Query: 354 GGARNIFCELFGNNKAENTFWLDSSSTEK 382
           GGARNIFCELFG NKAENTFWLDSSSTEK
Sbjct: 430 GGARNIFCELFGKNKAENTFWLDSSSTEK 458

Length = 918
>gnl|CDD|153214 cd01743, GATase1_Anthranilate_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>gnl|CDD|235552 PRK05670, PRK05670, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|223586 COG0512, PabA, Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237764 PRK14607, PRK14607, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|214365 CHL00101, trpG, anthranilate synthase component 2 Back     alignment and domain information
>gnl|CDD|181107 PRK07765, PRK07765, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181066 PRK07649, PRK07649, para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>gnl|CDD|180689 PRK06774, PRK06774, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|215729 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|233027 TIGR00566, trpG_papA, glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>gnl|CDD|181566 PRK08857, PRK08857, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|181194 PRK08007, PRK08007, para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|177969 PLN02335, PLN02335, anthranilate synthase Back     alignment and domain information
>gnl|CDD|233588 TIGR01823, PabB-fungal, aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>gnl|CDD|237429 PRK13566, PRK13566, anthranilate synthase; Provisional Back     alignment and domain information
>gnl|CDD|130874 TIGR01815, TrpE-clade3, anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>gnl|CDD|181927 PRK09522, PRK09522, bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|180178 PRK05637, PRK05637, anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|179112 PRK00758, PRK00758, GMP synthase subunit A; Validated Back     alignment and domain information
>gnl|CDD|153213 cd01742, GATase1_GMP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>gnl|CDD|129966 TIGR00888, guaA_Nterm, GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>gnl|CDD|153215 cd01744, GATase1_CPSase, Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>gnl|CDD|235882 PRK06895, PRK06895, putative anthranilate synthase component II; Provisional Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|223592 COG0518, GuaA, GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|237139 PRK12564, PRK12564, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223579 COG0505, CarA, Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|233378 TIGR01368, CPSaseIIsmall, carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>gnl|CDD|183784 PRK12838, PRK12838, carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|214392 CHL00197, carA, carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>gnl|CDD|234614 PRK00074, guaA, GMP synthase; Reviewed Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|183877 PRK13170, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|237288 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 392
PLN02889 918 oxo-acid-lyase/anthranilate synthase 100.0
KOG1224 767 consensus Para-aminobenzoate (PABA) synthase ABZ1 100.0
COG0512191 PabA Anthranilate/para-aminobenzoate synthases com 100.0
PRK08007187 para-aminobenzoate synthase component II; Provisio 100.0
KOG0026223 consensus Anthranilate synthase, beta chain [Amino 100.0
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine 100.0
PRK06774191 para-aminobenzoate synthase component II; Provisio 100.0
TIGR01823 742 PabB-fungal aminodeoxychorismate synthase, fungal 100.0
TIGR00566188 trpG_papA glutamine amidotransferase of anthranila 100.0
CHL00101190 trpG anthranilate synthase component 2 100.0
PRK08857193 para-aminobenzoate synthase component II; Provisio 100.0
PRK06895190 putative anthranilate synthase component II; Provi 100.0
PLN02335222 anthranilate synthase 100.0
PRK05670189 anthranilate synthase component II; Provisional 100.0
PRK09522 531 bifunctional glutamine amidotransferase/anthranila 100.0
PRK05637208 anthranilate synthase component II; Provisional 100.0
PRK07765214 para-aminobenzoate synthase component II; Provisio 100.0
PRK14607 534 bifunctional glutamine amidotransferase/anthranila 100.0
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine ami 100.0
PRK00758184 GMP synthase subunit A; Validated 100.0
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransfe 100.0
TIGR00888188 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N 100.0
PF00117192 GATase: Glutamine amidotransferase class-I; InterP 100.0
TIGR01815717 TrpE-clade3 anthranilate synthase, alpha proteobac 100.0
PLN02347 536 GMP synthetase 100.0
PRK13566720 anthranilate synthase; Provisional 100.0
PRK00074 511 guaA GMP synthase; Reviewed 100.0
PRK12564360 carbamoyl phosphate synthase small subunit; Review 100.0
cd01744178 GATase1_CPSase Small chain of the glutamine-depend 100.0
CHL00197382 carA carbamoyl-phosphate synthase arginine-specifi 99.98
TIGR01368358 CPSaseIIsmall carbamoyl-phosphate synthase, small 99.97
PRK12838354 carbamoyl phosphate synthase small subunit; Review 99.97
PRK13170196 hisH imidazole glycerol phosphate synthase subunit 99.97
PLN02771415 carbamoyl-phosphate synthase (glutamine-hydrolyzin 99.97
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransfe 99.96
COG0518198 GuaA GMP synthase - Glutamine amidotransferase dom 99.96
PRK13146209 hisH imidazole glycerol phosphate synthase subunit 99.96
CHL00188210 hisH imidazole glycerol phosphate synthase subunit 99.96
PRK13181199 hisH imidazole glycerol phosphate synthase subunit 99.96
PRK13152201 hisH imidazole glycerol phosphate synthase subunit 99.96
PRK13141205 hisH imidazole glycerol phosphate synthase subunit 99.95
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; 99.95
PRK13143200 hisH imidazole glycerol phosphate synthase subunit 99.95
COG0505368 CarA Carbamoylphosphate synthase small subunit [Am 99.95
TIGR01855196 IMP_synth_hisH imidazole glycerol phosphate syntha 99.95
PRK06490239 glutamine amidotransferase; Provisional 99.94
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 g 99.94
PRK14004210 hisH imidazole glycerol phosphate synthase subunit 99.94
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 g 99.93
PRK09065237 glutamine amidotransferase; Provisional 99.93
COG0118204 HisH Glutamine amidotransferase [Amino acid transp 99.93
PRK07567242 glutamine amidotransferase; Provisional 99.92
PRK05665240 amidotransferase; Provisional 99.92
PRK07053234 glutamine amidotransferase; Provisional 99.91
PRK13525189 glutamine amidotransferase subunit PdxT; Provision 99.91
PRK08250235 glutamine amidotransferase; Provisional 99.91
PRK13527200 glutamine amidotransferase subunit PdxT; Provision 99.91
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransfe 99.9
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidot 99.9
KOG1622 552 consensus GMP synthase [Nucleotide transport and m 99.88
PRK13142192 hisH imidazole glycerol phosphate synthase subunit 99.88
TIGR01737227 FGAM_synth_I phosphoribosylformylglycinamidine syn 99.86
PLN02617 538 imidazole glycerol phosphate synthase hisHF 99.86
PF07722217 Peptidase_C26: Peptidase C26; InterPro: IPR011697 99.84
COG2071243 Predicted glutamine amidotransferases [General fun 99.84
KOG0370 1435 consensus Multifunctional pyrimidine synthesis pro 99.84
PRK05380533 pyrG CTP synthetase; Validated 99.83
TIGR00337525 PyrG CTP synthase. CTP synthase is involved in pyr 99.81
PRK06186229 hypothetical protein; Validated 99.78
TIGR03800184 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, gl 99.75
PLN02327557 CTP synthase 99.75
PRK03619219 phosphoribosylformylglycinamidine synthase I; Prov 99.74
KOG3179245 consensus Predicted glutamine synthetase [Nucleoti 99.72
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) i 99.71
PRK05368302 homoserine O-succinyltransferase; Provisional 99.65
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide 99.59
PLN02832248 glutamine amidotransferase subunit of pyridoxal 5' 99.58
PRK01175261 phosphoribosylformylglycinamidine synthase I; Prov 99.5
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synt 99.44
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase 99.44
KOG0623 541 consensus Glutamine amidotransferase/cyclase [Amin 99.35
PRK13526179 glutamine amidotransferase subunit PdxT; Provision 99.31
KOG2387585 consensus CTP synthase (UTP-ammonia lyase) [Nucleo 99.22
KOG1559340 consensus Gamma-glutamyl hydrolase [Coenzyme trans 99.09
PF13507259 GATase_5: CobB/CobQ-like glutamine amidotransferas 98.86
TIGR018571239 FGAM-synthase phosphoribosylformylglycinamidine sy 98.86
cd03131175 GATase1_HTS Type 1 glutamine amidotransferase (GAT 98.69
COG0311194 PDX2 Predicted glutamine amidotransferase involved 98.69
PLN032061307 phosphoribosylformylglycinamidine synthase; Provis 98.6
PF01174188 SNO: SNO glutamine amidotransferase family; InterP 98.54
TIGR017351310 FGAM_synt phosphoribosylformylglycinamidine syntha 98.5
PRK052971290 phosphoribosylformylglycinamidine synthase; Provis 98.45
PF04204298 HTS: Homoserine O-succinyltransferase ; InterPro: 98.39
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GA 98.2
PHA033661304 FGAM-synthase; Provisional 98.13
TIGR01001300 metA homoserine O-succinyltransferase. The apparen 98.03
PRK06278 476 cobyrinic acid a,c-diamide synthase; Validated 97.81
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GA 97.76
TIGR017391202 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM 97.67
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1 97.67
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)- 97.58
PRK00784488 cobyric acid synthase; Provisional 97.24
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase 97.1
KOG3210226 consensus Imidazoleglycerol-phosphate synthase sub 96.99
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 96.98
PRK11780217 isoprenoid biosynthesis protein with amidotransfer 96.79
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 96.78
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase ( 96.75
TIGR01382166 PfpI intracellular protease, PfpI family. The memb 96.55
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GAT 96.53
TIGR00379449 cobB cobyrinic acid a,c-diamide synthase. This mod 96.27
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransfer 96.16
COG1897307 MetA Homoserine trans-succinylase [Amino acid tran 96.12
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransfe 96.1
TIGR00313475 cobQ cobyric acid synthase CobQ. 95.98
PF07685158 GATase_3: CobB/CobQ-like glutamine amidotransferas 95.96
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransfera 95.68
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase 95.23
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GA 95.19
PRK11574196 oxidative-stress-resistance chaperone; Provisional 95.1
KOG19071320 consensus Phosphoribosylformylglycinamidine syntha 95.1
PRK04155287 chaperone protein HchA; Provisional 94.93
PF01965147 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 T 94.76
PRK13896433 cobyrinic acid a,c-diamide synthase; Provisional 94.7
cd03148232 GATase1_EcHsp31_like Type 1 glutamine amidotransfe 94.63
COG0693188 ThiJ Putative intracellular protease/amidase [Gene 94.17
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransfera 93.57
PRK05282233 (alpha)-aspartyl dipeptidase; Validated 93.38
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase ( 92.68
cd03138195 GATase1_AraC_2 AraC transcriptional regulators hav 92.65
TIGR01383179 not_thiJ DJ-1 family protein. This model represent 92.39
cd03129210 GAT1_Peptidase_E_like Type 1 glutamine amidotransf 91.65
cd03137187 GATase1_AraC_1 AraC transcriptional regulators hav 90.86
PRK11104177 hemG protoporphyrinogen oxidase; Provisional 89.66
COG3442250 Predicted glutamine amidotransferase [General func 87.72
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regula 87.52
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase ( 87.17
PRK11249752 katE hydroperoxidase II; Provisional 86.54
PF13278166 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3M 86.33
PF06283217 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A. 83.57
PF03358152 FMN_red: NADPH-dependent FMN reductase; InterPro: 82.99
COG4090154 Uncharacterized protein conserved in archaea [Func 82.94
PF09825367 BPL_N: Biotin-protein ligase, N terminal; InterPro 82.67
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 82.27
PRK01911292 ppnK inorganic polyphosphate/ATP-NAD kinase; Provi 81.9
COG4126230 Hydantoin racemase [Amino acid transport and metab 81.5
>PLN02889 oxo-acid-lyase/anthranilate synthase Back     alignment and domain information 
Probab=100.00  E-value=4.2e-69  Score=587.17  Aligned_cols=375  Identities=67%  Similarity=1.092  Sum_probs=298.6

Q ss_pred             CCccEEEEEECCCCchHHHHHHHHHhCCCCeEEEeCCCCCHHHHHhhhcccCCcCEEEECCCCCCCCCCCchhHHHHHHH
Q 046651            2 LEFVRTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLL   81 (392)
Q Consensus         2 ~~~~r~LlIDnyDSyT~nl~q~L~~v~G~~pvVV~nd~~~~eel~~~l~e~~~fDgIVISpGPGsp~~~~d~gi~~~ll~   81 (392)
                      +++||||||||||||||||+|+|++++|.+|+||+||+.+|+++..++++...||+||||||||+|.+++|++++.++|.
T Consensus        79 ~~~~~iLlIDnyDSfTyNL~~~L~~~~g~~~~Vv~nd~~~~~~~~~~~~~~~~~d~IVlSPGPG~P~~~~d~Gi~~~~i~  158 (918)
T PLN02889         79 LEFVRTLLIDNYDSYTYNIYQELSIVNGVPPVVVRNDEWTWEEVYHYLYEEKAFDNIVISPGPGSPTCPADIGICLRLLL  158 (918)
T ss_pred             cccceEEEEeCCCchHHHHHHHHHHhcCCCEEEEeCCCCCHHHHHhhhhcccCCCEEEECCCCCCccchHHHHHHHHHHH
Confidence            46799999999999999999999998899999999999999998865445578999999999999999999999999998


Q ss_pred             HcCCCCEEEEcHHHHHHHHHhCCeeeecCCCceeceeEEEecCCcccccCCCCCCcceEEEeeecceeecCCCCCCcEEE
Q 046651           82 ECWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPI  161 (392)
Q Consensus        82 ~~~~iPILGVCLGhQ~La~a~Gg~V~~apep~hG~~s~i~h~g~~LF~~ips~~~s~f~VvryHSl~V~~~sLP~~l~~i  161 (392)
                      +..++||||||||||+|++++||+|.++++++||+.+.|.|+++.||+++|++.++.|+|+||||++|+..+||++|+++
T Consensus       159 ~~~~iPILGICLGhQ~i~~~~Gg~V~~~~~~~HG~~s~I~h~~~~lF~glp~~~~~~f~v~RYHSL~v~~~~lP~~L~~~  238 (918)
T PLN02889        159 ECRDIPILGVCLGHQALGYVHGARIVHAPEPVHGRLSEIEHNGCRLFDDIPSGRNSGFKVVRYHSLVIDAESLPKELVPI  238 (918)
T ss_pred             HhCCCcEEEEcHHHHHHHHhcCceEEeCCCceeeeeeeEeecCchhhcCCCcCCCCCceEEeCCCcccccCCCCCceEEE
Confidence            86689999999999999999999999999999999999999999999999985444599999999999877799999999


Q ss_pred             EEecCCCCccccccCCCCCCCcccccchhhhhhcccccccccCCCcccccc-cccCCcceEEEEEecCCCEEEEeccCCC
Q 046651          162 AWSNSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIY-SNRMRREVLMGIMHSTRPHYGVQFHPES  240 (392)
Q Consensus       162 Awt~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~-~~~~~~~~vmgi~h~~~P~~GVQFHPEs  240 (392)
                      ||+.+.++++|+++.+++..+.+.+.+.+.+.+.+|+++...+|..+.++| ...++..+||||+|+++|+|||||||||
T Consensus       239 A~t~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~viMairH~~~P~~GVQfHPES  318 (918)
T PLN02889        239 AWTSSSDTLSFLESQKSGLVPDAYESQIGQSGSSDPFSSKLKNGTSWPSSHSERMQNGKILMGIMHSTRPHYGLQFHPES  318 (918)
T ss_pred             EEECCCcccccccccccccccccccccccccccccccccccccccccccccccccCCCCeeEEEEECCCceEEEEeCCcc
Confidence            999988899999999999888888888888999999999999999999999 5566667999999999999999999999


Q ss_pred             CCCchhHHHHHHHHHHHHHhhhhcCCCcccccccccc--cch---hhhhHhhhhcccccCCCcccccccccccccccccC
Q 046651          241 IATCYGSKILRNFREITEDYWKRLRSPFVKERNVHYT--GAE---SLLLREITRTSRSVNNSDELGREALRPRQLFCDLG  315 (392)
Q Consensus       241 iat~~G~~I~~NF~~l~~~~~~~~~~~~~~~~~~~~~--~~~---~~l~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  315 (392)
                      ++|++|.+||+||++++.+||+..+....++++...+  .+.   ..++... +....+|+.+.+     ..++.++...
T Consensus       319 i~t~~G~~l~~nF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~-----~~~~~~~~~~  392 (918)
T PLN02889        319 IATCYGRQIFKNFREITQDYWLRLRSTSLRRRNSNLTANMQVPDASQLFKVP-RRGQLGNGEDAL-----GNRELSRRAQ  392 (918)
T ss_pred             ccCchhHHHHHHHHHHHHHHhhccCCCccccccccccccccccccccccccc-cccccccccccc-----cccccccccc
Confidence            9999999999999999999987655432232221100  000   0000000 000011111111     0111111111


Q ss_pred             CCcccccccccccccccCCCceeeEEEEEEecccccccCChHHHHHHHhCCCCCCCeEEccCCCCCCC
Q 046651          316 DRRFGIQHSRRFEIQRSSIGVKCLKLTWRKFDHLASTVGGARNIFCELFGNNKAENTFWLDSSSTEKV  383 (392)
Q Consensus       316 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~g~~~~~f~~lf~~~~~~~~fWLDss~~~~~  383 (392)
                      ....+. -..+...+.++...+.+++.|++|+..+.++|++++|||+||+..+++++|||||+..+.+
T Consensus       393 ~~~~~~-~~~~~~~~~~~~~~~~~~l~~~~l~~~~~~~~~~~~if~~lf~~~~~~~~flLdSs~~~~~  459 (918)
T PLN02889        393 LRGSVD-VFSLLNLSEPSSGVKFLKLKWRKFNKLAAQVGGARNIFCELFGKNKAENTFWLDSSSTEKK  459 (918)
T ss_pred             cccccc-cccccccCCCCcccceeecceeecccccccccCHHHHHHHHHhccCCCCeEEEeCCCCCCC
Confidence            000000 0111223333335677999999999999999999999999999876789999999987543

>KOG1224 consensus Para-aminobenzoate (PABA) synthase ABZ1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>KOG0026 consensus Anthranilate synthase, beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR01823 PabB-fungal aminodeoxychorismate synthase, fungal clade Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06895 putative anthranilate synthase component II; Provisional Back     alignment and domain information
>PLN02335 anthranilate synthase Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK09522 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK14607 bifunctional glutamine amidotransferase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit Back     alignment and domain information
>PF00117 GATase: Glutamine amidotransferase class-I; InterPro: IPR017926 Glutamine amidotransferase (GATase) enzymes catalyse the removal of the ammonia group from glutamine and then transfer this group to a substrate to form a new carbon-nitrogen group [] Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase, alpha proteobacterial clade Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PLN02771 carbamoyl-phosphate synthase (glutamine-hydrolyzing) Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK14004 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PF07722 Peptidase_C26: Peptidase C26; InterPro: IPR011697 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>TIGR00337 PyrG CTP synthase Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>TIGR03800 PLP_synth_Pdx2 pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 Back     alignment and domain information
>PLN02327 CTP synthase Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>KOG3179 consensus Predicted glutamine synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02832 glutamine amidotransferase subunit of pyridoxal 5'-phosphate synthase complex Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>KOG0623 consensus Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>KOG2387 consensus CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1559 consensus Gamma-glutamyl hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13507 GATase_5: CobB/CobQ-like glutamine amidotransferase domain; PDB: 3D54_L 3UMM_A 3UJN_A 3UGJ_A 1T3T_A Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>cd03131 GATase1_HTS Type 1 glutamine amidotransferase (GATase1)-like domain found in homoserine trans-succinylase (HTS) Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN03206 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PF01174 SNO: SNO glutamine amidotransferase family; InterPro: IPR002161 Members of this family are involved in the pyridoxine biosynthetic pathway [, ] Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PF04204 HTS: Homoserine O-succinyltransferase ; InterPro: IPR005697 This family of enzymes, homoserine O-succinyltransferase, catalyses the first step in the biosynthesis of methionine: Succinyl-CoA + L-homoserine = CoA + O-succinyl-L-homoserine This enzyme is consequently essential for the survival of bacteria, plants and fungi Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>PHA03366 FGAM-synthase; Provisional Back     alignment and domain information
>TIGR01001 metA homoserine O-succinyltransferase Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>KOG3210 consensus Imidazoleglycerol-phosphate synthase subunit H-like [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>COG1897 MetA Homoserine trans-succinylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ Back     alignment and domain information
>PF07685 GATase_3: CobB/CobQ-like glutamine amidotransferase domain; InterPro: IPR011698 This group of enzymes was suggested to be related to the MinD family of ATPases involved in regulation of cell division in bacteria and archaea [] Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>PRK11574 oxidative-stress-resistance chaperone; Provisional Back     alignment and domain information
>KOG1907 consensus Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04155 chaperone protein HchA; Provisional Back     alignment and domain information
>PF01965 DJ-1_PfpI: DJ-1/PfpI family; InterPro: IPR002818 This signature defines a diverse group of protein families which include proteins involved in RNA-protein interaction regulation, thiamine biosynthesis, Ras-related signal transduction, and those with protease activity Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>cd03148 GATase1_EcHsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Escherichia coli Hsp31 protein (EcHsp31) Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>PRK05282 (alpha)-aspartyl dipeptidase; Validated Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein Back     alignment and domain information
>cd03129 GAT1_Peptidase_E_like Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E_like proteins Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>PRK11104 hemG protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>PF13278 DUF4066: Putative amidotransferase; PDB: 3BHN_A 3MGK_B 3NOV_A 3NON_B 3NOO_B 3NOQ_A 3NOR_A 3GRA_A 3EWN_A 3ER6_C Back     alignment and domain information
>PF06283 ThuA: Trehalose utilisation; PDB: 4E5V_A 1T0B_A Back     alignment and domain information
>PF03358 FMN_red: NADPH-dependent FMN reductase; InterPro: IPR005025 NADPH-dependent FMN reductase (1 Back     alignment and domain information
>COG4090 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF09825 BPL_N: Biotin-protein ligase, N terminal; InterPro: IPR019197 The function of this structural domain is unknown Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>PRK01911 ppnK inorganic polyphosphate/ATP-NAD kinase; Provisional Back     alignment and domain information
>COG4126 Hydantoin racemase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1qdl_B195 The Crystal Structure Of Anthranilate Synthase From 1e-29
1i7q_B193 Anthranilate Synthase From S. Marcescens Length = 1 2e-17
1i1q_B192 Structure Of The Cooperative Allosteric Anthranilat 8e-15
2a9v_A212 Crystal Structure Of A Putative Gmp Synthase Subuni 7e-08
1t36_B382 Crystal Structure Of E. Coli Carbamoyl Phosphate Sy 8e-07
3r74_A645 Crystal Structure Of 2-Amino-2-Desoxyisochorismate 2e-06
1m6v_B382 Crystal Structure Of The G359f (Small Subunit) Poin 4e-06
1jdb_C382 Carbamoyl Phosphate Synthetase From Escherichia Col 4e-06
1wl8_A189 Crystal Structure Of Ph1346 Protein From Pyrococcus 9e-06
2d7j_A209 Crystal Structure Analysis Of Glutamine Amidotransf 2e-05
3r75_A645 Crystal Structure Of 2-Amino-2-Desoxyisochorismate 4e-05
1c30_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 5e-05
1a9x_B379 Carbamoyl Phosphate Synthetase: Caught In The Act O 7e-05
1cs0_B382 Crystal Structure Of Carbamoyl Phosphate Synthetase 7e-05
>pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus Length = 195 Back     alignment and structure 
Iteration: 1

 Score =  127 bits (318), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 118/252 (46%), Gaps = 69/252 (27%)
Query: 7   TLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGS 66
           TL+IDNYDS+ YNI Q +  + G  P+V+RNDE + + I     E    D ++ISPGPG+
Sbjct: 4   TLIIDNYDSFVYNIAQIVGEL-GSYPIVIRNDEISIKGI-----ERIDPDRLIISPGPGT 57
Query: 67  PACPEDIGICLRVLLECWD-VPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGD 125
           P   EDIG+ L V+       PILGVCLGHQA+G+  GA I  A +  HG++S I+    
Sbjct: 58  PEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNII---- 113
Query: 126 RLFHDIP----SGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEI 181
            L ++ P     G    FK  RYHSL++D    P                         I
Sbjct: 114 -LVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPL------------------------I 148
Query: 182 PDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESI 241
            DA  ++  +                             +M I H   P YGVQFHPES+
Sbjct: 149 VDAISAEDNE-----------------------------IMAIHHEEYPIYGVQFHPESV 179
Query: 242 ATCYGSKILRNF 253
            T  G KIL NF
Sbjct: 180 GTSLGYKILYNF 191
>pdb|1I7Q|B Chain B, Anthranilate Synthase From S. Marcescens Length = 193 Back     alignment and structure
>pdb|1I1Q|B Chain B, Structure Of The Cooperative Allosteric Anthranilate Synthase From Salmonella Typhimurium Length = 192 Back     alignment and structure
>pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45 A Resolution Length = 212 Back     alignment and structure
>pdb|1T36|B Chain B, Crystal Structure Of E. Coli Carbamoyl Phosphate Synthetase Small Subunit Mutant C248d Complexed With Uridine 5'-Monophosphate Length = 382 Back     alignment and structure
>pdb|3R74|A Chain A, Crystal Structure Of 2-Amino-2-Desoxyisochorismate Synthase (Adic) Synthase Phze From Burkholderia Lata 383 Length = 645 Back     alignment and structure
>pdb|1M6V|B Chain B, Crystal Structure Of The G359f (Small Subunit) Point Mutant Of Carbamoyl Phosphate Synthetase Length = 382 Back     alignment and structure
>pdb|1JDB|C Chain C, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 382 Back     alignment and structure
>pdb|1WL8|A Chain A, Crystal Structure Of Ph1346 Protein From Pyrococcus Horikoshii Length = 189 Back     alignment and structure
>pdb|2D7J|A Chain A, Crystal Structure Analysis Of Glutamine Amidotransferase From Pyrococcus Horikoshii Ot3 Length = 209 Back     alignment and structure
>pdb|3R75|A Chain A, Crystal Structure Of 2-Amino-2-Desoxyisochorismate Synthase (Adic) Synthase Phze From Burkholderia Lata 383 In Complex With Benzoate, Pyruvate, Glutamine And Contaminating Zn2+ Length = 645 Back     alignment and structure
>pdb|1C30|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase: Small Subunit Mutation C269s Length = 382 Back     alignment and structure
>pdb|1A9X|B Chain B, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 379 Back     alignment and structure
>pdb|1CS0|B Chain B, Crystal Structure Of Carbamoyl Phosphate Synthetase Complexed At Cys269 In The Small Subunit With The Tetrahedral Mimic L-glutamate Gamma-semialdehyde Length = 382 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query392
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 2e-78
1i1q_B192 Anthranilate synthase component II; tryptophan bio 2e-71
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 6e-27
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 3e-18
3uow_A 556 GMP synthetase; structural genomics consortium, SG 2e-10
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 2e-10
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 1e-08
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 8e-08
2a9v_A212 GMP synthase; structural genomics, joint center fo 8e-08
2a9v_A212 GMP synthase; structural genomics, joint center fo 2e-05
3l7n_A236 Putative uncharacterized protein; glutamine amidot 3e-07
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 4e-07
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 7e-07
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 2e-05
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 2e-06
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 4e-05
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 2e-06
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 8e-06
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 2e-06
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 3e-05
3m3p_A250 Glutamine amido transferase; structural genomics, 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 4e-04
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Length = 195 Back     alignment and structure
 Score =  239 bits (612), Expect = 2e-78
 Identities = 88/250 (35%), Positives = 117/250 (46%), Gaps = 67/250 (26%)

Query: 8   LLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSP 67
           L+IDNYDS+ YNI Q +  + G  P+V+RNDE + + I     E    D ++ISPGPG+P
Sbjct: 5   LIIDNYDSFVYNIAQIVGEL-GSYPIVIRNDEISIKGI-----ERIDPDRLIISPGPGTP 58

Query: 68  ACPEDIGICLRVLLECWD-VPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIV---HN 123
              EDIG+ L V+       PILGVCLGHQA+G+  GA I  A +  HG++S I+   ++
Sbjct: 59  EKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNS 118

Query: 124 GDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIPD 183
              L++ I       FK  RYHSL++D    P  +  I+  +              EI  
Sbjct: 119 PLSLYYGIA----KEFKATRYHSLVVDEVHRPLIVDAISAED-------------NEI-- 159

Query: 184 AYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIAT 243
                                                 M I H   P YGVQFHPES+ T
Sbjct: 160 --------------------------------------MAIHHEEYPIYGVQFHPESVGT 181

Query: 244 CYGSKILRNF 253
             G KIL NF
Sbjct: 182 SLGYKILYNF 191
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Length = 192 Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Length = 645 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Length = 556 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Length = 189 Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Length = 525 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Length = 212 Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Length = 236 Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Length = 379 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Length = 218 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Length = 503 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Length = 697 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Length = 527 Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Length = 250 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tr 100.0
1i1q_B192 Anthranilate synthase component II; tryptophan bio 100.0
2a9v_A212 GMP synthase; structural genomics, joint center fo 100.0
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; tr 100.0
2vpi_A218 GMP synthase; guanine monophosphate synthetase, ph 100.0
3r75_A645 Anthranilate/para-aminobenzoate synthases compone; 100.0
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 100.0
3uow_A 556 GMP synthetase; structural genomics consortium, SG 100.0
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine ami 100.0
3tqi_A 527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 100.0
4gud_A211 Imidazole glycerol phosphate synthase subunit His; 100.0
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amid 99.98
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 99.97
1o1y_A239 Conserved hypothetical protein TM1158; flavodoxin- 99.96
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, 99.96
3l7n_A236 Putative uncharacterized protein; glutamine amidot 99.96
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharact 99.96
3m3p_A250 Glutamine amido transferase; structural genomics, 99.96
2w7t_A273 CTP synthetase, putative cytidine triphosphate syn 99.96
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex 99.95
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alph 99.94
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCO 99.94
1vco_A550 CTP synthetase; tetramer, riken structural genomic 99.93
1ka9_H200 Imidazole glycerol phosphtate synthase; riken stru 99.93
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(A 99.93
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine 99.93
1q7r_A219 Predicted amidotransferase; structural genomics, Y 99.92
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase ( 99.92
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxin 99.9
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 99.89
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alp 99.88
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LI 99.88
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B 99.84
2vdj_A301 Homoserine O-succinyltransferase; methionine biosy 99.72
2h2w_A312 Homoserine O-succinyltransferase; TM0881, (EC 2.3. 99.71
3ugj_A1303 Phosphoribosylformylglycinamidine synthase; amidot 99.15
3l4e_A206 Uncharacterized peptidase LMO0363; hypothetical pr 98.08
1fy2_A229 Aspartyl dipeptidase; serine protease, catalytic t 97.98
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, compl 97.41
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/T 96.93
3l18_A168 Intracellular protease I; gatase1_PFPI_LIKE, hydro 96.85
2ab0_A205 YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase 96.58
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, cha 96.58
4hcj_A177 THIJ/PFPI domain protein; structural genomics, PSI 96.58
3cne_A175 Putative protease I; structural genomics, PSI-2, M 96.52
1vhq_A232 Enhancing lycopene biosynthesis protein 2; structu 96.44
3l3b_A242 ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, 95.94
4e08_A190 DJ-1 beta; flavodoxin-like fold, stress response, 95.68
1u9c_A224 APC35852; structural genomics, protein structure i 95.22
3f5d_A206 Protein YDEA; unknow protein, PSI-II, nysgrc, stru 95.07
3ej6_A688 Catalase-3; heme, hydrogen iron, metal-binding, ox 94.84
3efe_A212 THIJ/PFPI family protein; structural GEN csgid, ce 94.78
2fex_A188 Conserved hypothetical protein; structural genomic 94.66
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 94.26
3uk7_A396 Class I glutamine amidotransferase-like domain-CO 93.89
3ot1_A208 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate 93.85
2iuf_A688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 93.53
1rw7_A243 YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI supe 93.33
3ttv_A753 Catalase HPII; heme orientation, oxidoreductase; H 93.13
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidor 92.29
3gra_A202 Transcriptional regulator, ARAC family; transcript 91.82
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 91.59
1z0s_A278 Probable inorganic polyphosphate/ATP-NAD kinase; A 91.58
3n7t_A247 Macrophage binding protein; seattle structural gen 90.91
1n57_A291 Chaperone HSP31, protein YEDU; alpha-beta sandwich 90.11
3kkl_A244 Probable chaperone protein HSP33; peptidase, heat 89.91
3er6_A209 Putative transcriptional regulator protein; struct 89.72
3noq_A231 THIJ/PFPI family protein; DJ-1 superfamily, isocya 88.19
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 87.89
3f6c_A134 Positive transcription regulator EVGA; structural 87.33
2rjn_A154 Response regulator receiver:metal-dependent phosph 86.81
2qr3_A140 Two-component system response regulator; structura 86.79
3grc_A140 Sensor protein, kinase; protein structure initiati 86.16
3jte_A143 Response regulator receiver protein; structural ge 85.96
2rdm_A132 Response regulator receiver protein; structural ge 85.58
3i42_A127 Response regulator receiver domain protein (CHEY- 85.38
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 85.16
3cz5_A153 Two-component response regulator, LUXR family; str 85.12
2zay_A147 Response regulator receiver protein; structural ge 85.09
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 84.73
3cg4_A142 Response regulator receiver domain protein (CHEY-; 84.58
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 84.42
3hdg_A137 Uncharacterized protein; two-component sensor acti 84.29
3ewn_A253 THIJ/PFPI family protein; monomer, PSI nysgrc, str 83.47
2qxy_A142 Response regulator; regulation of transcription, N 83.33
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 83.26
3cnb_A143 DNA-binding response regulator, MERR family; signa 83.16
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 82.64
3hdv_A136 Response regulator; PSI-II, structural genomics, P 82.55
3mgk_A211 Intracellular protease/amidase related enzyme (THI 82.33
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 82.23
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 81.54
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 81.49
3gt7_A154 Sensor protein; structural genomics, signal receiv 81.42
3bhn_A236 THIJ/PFPI domain protein; structural genomics, joi 81.02
2qsj_A154 DNA-binding response regulator, LUXR family; struc 80.77
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1 Back     alignment and structure
Probab=100.00  E-value=8.3e-40  Score=299.09  Aligned_cols=187  Identities=48%  Similarity=0.782  Sum_probs=163.3

Q ss_pred             cE-EEEEECCCCchHHHHHHHHHhCCCCeEEEeCCCCCHHHHHhhhcccCCcCEEEECCCCCCCCCCCchhHHHHHHHH-
Q 046651            5 VR-TLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLE-   82 (392)
Q Consensus         5 ~r-~LlIDnyDSyT~nl~q~L~~v~G~~pvVV~nd~~~~eel~~~l~e~~~fDgIVISpGPGsp~~~~d~gi~~~ll~~-   82 (392)
                      || |+||||++||++++.++|++ .|++++++++++.+++++..     ..+|+|||+||||++....+.++..+++++ 
T Consensus         1 m~mi~iid~~~s~~~~~~~~l~~-~G~~~~v~~~~~~~~~~~~~-----~~~dglil~gG~~~~~~~~~~~~~~~~i~~~   74 (195)
T 1qdl_B            1 MDLTLIIDNYDSFVYNIAQIVGE-LGSYPIVIRNDEISIKGIER-----IDPDRLIISPGPGTPEKREDIGVSLDVIKYL   74 (195)
T ss_dssp             CCEEEEEECSCSSHHHHHHHHHH-TTCEEEEEETTTSCHHHHHH-----HCCSEEEECCCSSCTTSHHHHTTHHHHHHHH
T ss_pred             CCEEEEEECCCchHHHHHHHHHh-CCCEEEEEeCCCCCHHHHhh-----CCCCEEEECCCCCChhhhhhhhHHHHHHHHh
Confidence            66 99999999999999999998 79999999998666777754     369999999999998764444455566654 


Q ss_pred             cCCCCEEEEcHHHHHHHHHhCCeeeecCCCceeceeEEEe-cCC--cccccCCCCCCcceEEEeeecceeecCCCCCCcE
Q 046651           83 CWDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVH-NGD--RLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELI  159 (392)
Q Consensus        83 ~~~iPILGVCLGhQ~La~a~Gg~V~~apep~hG~~s~i~h-~g~--~LF~~ips~~~s~f~VvryHSl~V~~~sLP~~l~  159 (392)
                      ..++||||||+|||+|+.++||+|.+.+...||....+.+ .++  +||+++|..    +.+.++|++.|+.  +|++++
T Consensus        75 ~~~~PvLGIC~G~QlL~~~~gg~v~~~~~~~~g~~~~v~~~~~~~~~l~~~~~~~----~~v~~~H~~~v~~--l~~~~~  148 (195)
T 1qdl_B           75 GKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKE----FKATRYHSLVVDE--VHRPLI  148 (195)
T ss_dssp             TTTSCEEEETHHHHHHHHHTTCEEEEEEEEEEEEEEEEEECCSSCCSTTTTCCSE----EEEEEEEEEEEEC--CCTTEE
T ss_pred             cCCCcEEEEehHHHHHHHHhCCEEeccCCCcCCCceEEEECCCCHhHHHhcCCCc----eEEeccccchhhh--CCCCcE
Confidence            3589999999999999999999999988788998777776 567  899999876    9999999999986  999999


Q ss_pred             EEEEe-cCCCCccccccCCCCCCCcccccchhhhhhcccccccccCCCcccccccccCCcceEEEEEecCCCEEEEeccC
Q 046651          160 PIAWS-NSADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHP  238 (392)
Q Consensus       160 ~iAwt-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~vmgi~h~~~P~~GVQFHP  238 (392)
                      ++|++ ++              +                                      .++|+++.++|+|||||||
T Consensus       149 vla~s~~~--------------g--------------------------------------~i~a~~~~~~~~~gvQfHP  176 (195)
T 1qdl_B          149 VDAISAED--------------N--------------------------------------EIMAIHHEEYPIYGVQFHP  176 (195)
T ss_dssp             EEEEESSS--------------C--------------------------------------CEEEEEESSSSEEEESSBT
T ss_pred             EEEEECCC--------------C--------------------------------------cEEEEEeCCCCEEEEecCC
Confidence            99999 66              6                                      8999999888999999999


Q ss_pred             CCCCCchhHHHHHHHHH
Q 046651          239 ESIATCYGSKILRNFRE  255 (392)
Q Consensus       239 Esiat~~G~~I~~NF~~  255 (392)
                      |+..++.|.+||+||++
T Consensus       177 E~~~~~~g~~l~~~f~~  193 (195)
T 1qdl_B          177 ESVGTSLGYKILYNFLN  193 (195)
T ss_dssp             TSTTCTTHHHHHHHHHH
T ss_pred             CCCCCccHHHHHHHHHh
Confidence            99888999999999987
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B* Back     alignment and structure
>2a9v_A GMP synthase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, ligase; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1 Back     alignment and structure
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A Back     alignment and structure
>2vpi_A GMP synthase; guanine monophosphate synthetase, phosphoprotein, GMP synthetase, GMP biosynthesis, glutamine amidotransferase, ligase, cytoplasm; 2.40A {Homo sapiens} Back     alignment and structure
>3r75_A Anthranilate/para-aminobenzoate synthases compone; ammonia channel, chorismate, type 1 glutamine amidotransfera phenazine biosynthesis, lyase; HET: CYG; 2.10A {Burkholderia SP} PDB: 3r74_A* 3r76_A* Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>4gud_A Imidazole glycerol phosphate synthase subunit His; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE 1PE; 1.91A {Vibrio cholerae} Back     alignment and structure
>1a9x_B Carbamoyl phosphate synthetase (small chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: c.8.3.1 c.23.16.1 PDB: 1bxr_B* 1ce8_B* 1jdb_C* 1cs0_B* 1m6v_B* 1c30_B* 1c3o_B* 1kee_B* 1t36_B* Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Back     alignment and structure
>3l7n_A Putative uncharacterized protein; glutamine amidotransferase, transferas; 2.70A {Streptococcus mutans} Back     alignment and structure
>2ywj_A Glutamine amidotransferase subunit PDXT; uncharacterized conserved protein, structural genomics; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3m3p_A Glutamine amido transferase; structural genomics, nysgrc, PSI-2; HET: MSE; 1.30A {Methylobacillus flagellatus} PDB: 3l83_A* Back     alignment and structure
>2w7t_A CTP synthetase, putative cytidine triphosphate synthase; glutaminase domain, trypsanosoma brucei, ligase, acivicin; HET: 5CS; 2.10A {Trypanosoma brucei} Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A 2wjz_B Back     alignment and structure
>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Back     alignment and structure
>1vco_A CTP synthetase; tetramer, riken structural genomics/proteomics initiative, RSGI, structural genomics, ligase; HET: GLN; 2.15A {Thermus thermophilus} SCOP: c.23.16.1 c.37.1.10 PDB: 1vcn_A 1vcm_A Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Back     alignment and structure
>2v4u_A CTP synthase 2; pyrimidine biosynthesis, glutamine amidotransferase, glutaminase domain, 5-OXO-L-norleucine, DON, ligase, phosphoprotein; HET: CYD; 2.3A {Homo sapiens} PDB: 2vkt_A Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Back     alignment and structure
>1s1m_A CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-forming), cytidine 5 triphosphate synthase, ammonia lyase; 2.30A {Escherichia coli} SCOP: c.23.16.1 c.37.1.10 PDB: 2ad5_A* Back     alignment and structure
>2ywd_A Glutamine amidotransferase subunit PDXT; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase transferase; HET: 5RP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3nva_A CTP synthase; rossman fold, nucleotide binding, LIG; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 PDB: 4ads_G Back     alignment and structure
>2vdj_A Homoserine O-succinyltransferase; methionine biosynthesis, amino-acid biosynthesis, homoserine transacetylase, homoserine transsuccinylase; 2.00A {Bacillus cereus} PDB: 2ghr_A Back     alignment and structure
>2h2w_A Homoserine O-succinyltransferase; TM0881, (EC 2.3.1.46), HOM O-transsuccinylase, HTS, (TM0881), structural genomics; 2.52A {Thermotoga maritima} Back     alignment and structure
>3ugj_A Phosphoribosylformylglycinamidine synthase; amidotransferase, glutaminase, thioester intermediate, ligas; HET: ADP; 1.78A {Salmonella enterica subsp} PDB: 1t3t_A* 3ujn_A* 3umm_A* Back     alignment and structure
>3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1fy2_A Aspartyl dipeptidase; serine protease, catalytic triad, strand-helix MO hydrolase; 1.20A {Salmonella typhimurium} SCOP: c.23.16.4 PDB: 1fye_A Back     alignment and structure
>1oi4_A Hypothetical protein YHBO; PFPI/THIJ family, complete proteome, PFPI, THIJ, bacterial targets at IGS-CNRS, france, BIGS, structural genomics; 2.03A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2vrn_A Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/PFPI superfamily, protease hydrolase, stress response; 2.15A {Deinococcus radiodurans} Back     alignment and structure
>3l18_A Intracellular protease I; gatase1_PFPI_LIKE, hydrolase; 1.78A {Thermococcus onnurineus} SCOP: c.23.16.2 PDB: 1g2i_A Back     alignment and structure
>2ab0_A YAJL; DJ-1/THIJ superfamily, alpha-beta hydrolase fold, unknown function; 1.10A {Escherichia coli} SCOP: c.23.16.2 Back     alignment and structure
>2rk3_A Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperone, cytoplasm, disease mutation, nucleus, oncogene, oxidation, parkinson disease; 1.05A {Homo sapiens} PDB: 1pdv_A 1pdw_A 3cy6_A 1pe0_A 3cza_A 3cyf_A 2rk4_A 3cz9_A* 3ezg_A 3f71_A 3sf8_A 1p5f_A 1ps4_A 1q2u_A 1soa_A 1ucf_A 2or3_A 3bwe_A 3b38_A 3b36_A ... Back     alignment and structure
>4hcj_A THIJ/PFPI domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta-alpha sandwich; HET: MSE; 1.12A {Brachyspira murdochii} Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein struct initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A Back     alignment and structure
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isopr biosynthesis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4e08_A DJ-1 beta; flavodoxin-like fold, stress response, motor protein; 2.00A {Drosophila melanogaster} Back     alignment and structure
>1u9c_A APC35852; structural genomics, protein structure initiative, MCSG, PAR disease, chaperone, cysteine protease, PSI; 1.35A {Geobacillus stearothermophilus} SCOP: c.23.16.2 Back     alignment and structure
>3f5d_A Protein YDEA; unknow protein, PSI-II, nysgrc, structural genomics, protein structure initiative; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural GEN csgid, center for structural genomics of infectious disease chaperone; 2.30A {Bacillus anthracis} Back     alignment and structure
>2fex_A Conserved hypothetical protein; structural genomics, protein structure initiative, PSI, MIDW center for structural genomics, MCSG; 1.70A {Agrobacterium tumefaciens} SCOP: c.23.16.2 Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3uk7_A Class I glutamine amidotransferase-like domain-CO protein; rossmann fold, cytosol; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3ot1_A 4-methyl-5(B-hydroxyethyl)-thiazole monophosphate biosynthesis enzyme; csgid, structural genomics; HET: MSE CSX; 1.16A {Vibrio cholerae o1 biovar el tor} SCOP: c.23.16.0 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1rw7_A YDR533CP; alpha-beta sandwich, DJ-1/THIJ/PFPI superfamily, unknown function; 1.80A {Saccharomyces cerevisiae} SCOP: c.23.16.2 PDB: 1qvv_A* 1qvz_A 1qvw_A Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>3gra_A Transcriptional regulator, ARAC family; transcription regulator, PSI-II, structural genomics structure initiative; 2.30A {Pseudomonas putida} Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1z0s_A Probable inorganic polyphosphate/ATP-NAD kinase; ATP-binding, structural genomics, NADP, PSI, protein structure initiative; HET: ATP; 1.70A {Archaeoglobus fulgidus} SCOP: e.52.1.1 PDB: 1z0u_A* 1z0z_A* 1suw_A* Back     alignment and structure
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis} SCOP: c.23.16.0 Back     alignment and structure
>1n57_A Chaperone HSP31, protein YEDU; alpha-beta sandwich; 1.60A {Escherichia coli} SCOP: c.23.16.2 PDB: 1pv2_A 1izy_A 1ons_A 1izz_A Back     alignment and structure
>3kkl_A Probable chaperone protein HSP33; peptidase, heat shock protein, hydrolase, protease, stress response; 2.03A {Saccharomyces cerevisiae} PDB: 3mii_A* Back     alignment and structure
>3er6_A Putative transcriptional regulator protein; structural genomics, unknown function, DNA-binding, transcription regulation, PSI-2; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3noq_A THIJ/PFPI family protein; DJ-1 superfamily, isocyanide hydratase, isonitrIle hydratase; HET: NHE; 1.00A {Pseudomonas fluorescens} PDB: 3noo_A 3non_A 3nor_A* 3nov_A Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3ewn_A THIJ/PFPI family protein; monomer, PSI nysgrc, structural genomics, protein structure initiative; 1.65A {Pseudomonas syringae PV} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3mgk_A Intracellular protease/amidase related enzyme (THIJ family); amidotranferase-like, structural genomics, PSI; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.76A {Shewanella loihica pv-4} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 392
d1qdlb_195 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 3e-28
d1a9xb2228 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthe 1e-18
d1wl8a1188 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA 4e-18
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 3e-17
d1i7qb_192 c.23.16.1 (B:) Anthranilate synthase GAT subunit, 2e-11
d2a9va1196 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA 2e-16
d1gpma2205 c.23.16.1 (A:3-207) GMP synthetase {Escherichia co 3e-14
d1l9xa_288 c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Ho 7e-14
d1k9vf_200 c.23.16.1 (F:) GAT subunit, HisH, (or domain) of i 0.003
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 195 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Anthranilate synthase GAT subunit, TrpG
species: Archaeon Sulfolobus solfataricus [TaxId: 2287]

 Score =  107 bits (268), Expect = 3e-28
 Identities = 84/251 (33%), Positives = 112/251 (44%), Gaps = 67/251 (26%)

Query: 7   TLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGS 66
           TL+IDNYDS+ YNI Q +  + G  P+V+RNDE + + I     E    D ++ISPGPG+
Sbjct: 4   TLIIDNYDSFVYNIAQIVGEL-GSYPIVIRNDEISIKGI-----ERIDPDRLIISPGPGT 57

Query: 67  PACPEDIGICLRVLLEC-WDVPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHN-- 123
           P   EDIG+ L V+       PILGVCLGHQA+G+  GA I  A +  HG++S I+    
Sbjct: 58  PEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNN 117

Query: 124 -GDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSNSADGFSYLGTLQSGEIP 182
               L++ I       FK  RYHS                                    
Sbjct: 118 SPLSLYYGIAKE----FKATRYHS------------------------------------ 137

Query: 183 DAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIA 242
                          +  ++       +I +       +M I H   P YGVQFHPES+ 
Sbjct: 138 --------------LVVDEVHRPLIVDAISAEDN---EIMAIHHEEYPIYGVQFHPESVG 180

Query: 243 TCYGSKILRNF 253
           T  G KIL NF
Sbjct: 181 TSLGYKILYNF 191
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Length = 228 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Length = 192 Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 196 Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query392
d1i7qb_192 Anthranilate synthase GAT subunit, TrpG {Serratia 100.0
d1qdlb_195 Anthranilate synthase GAT subunit, TrpG {Archaeon 100.0
d1wl8a1188 GMP synthase subunit A, GuaAA {Archaeon Pyrococcus 100.0
d2a9va1196 GMP synthase subunit A, GuaAA {Archaeon Thermoplas 100.0
d1a9xb2228 Carbamoyl phosphate synthetase, small subunit C-te 100.0
d1gpma2205 GMP synthetase {Escherichia coli [TaxId: 562]} 100.0
d1o1ya_230 Hypothetical protein TM1158 {Thermotoga maritima [ 99.95
d1k9vf_200 GAT subunit, HisH, (or domain) of imidazoleglycero 99.92
d1ka9h_195 GAT subunit, HisH, (or domain) of imidazoleglycero 99.91
d2nv0a1195 Hypothetical protein YaaE {Bacillus subtilis [TaxI 99.9
d1jvna2232 GAT subunit, HisH, (or domain) of imidazoleglycero 99.89
d1q7ra_202 Hypothetical protein YaaE {Bacillus stearothermoph 99.88
d1l9xa_288 gamma-glutamyl hydrolase {Human (Homo sapiens) [Ta 99.87
d2abwa1218 Pyridoxine biosynthesis protein 2, Pdx2 {Malaria p 99.82
d1vcoa1250 CTP synthase PyrG, C-terminal domain {Thermus ther 99.78
d1s1ma1258 CTP synthase PyrG, C-terminal domain {Escherichia 99.76
d2ghra1281 Homoserine O-succinyltransferase HTS (MetA) {Bacil 99.6
d1t3ta2262 FGAM synthase PurL, amidotransferase domain {Salmo 99.11
d1vhqa_217 Putative sigma cross-reacting protein 27A (SCRP-27 96.95
d1g2ia_166 Intracellular protease {Archaeon Pyrococcus horiko 96.41
d1sy7a1184 Catalase, C-terminal domain {Neurospora crassa [Ta 96.34
d1p5fa_186 DJ-1 {Human (Homo sapiens) [TaxId: 9606]} 96.07
d1u9ca_221 GK2698 ortholog {Bacillus stearothermophilus [TaxI 96.04
d1oi4a1170 Hypothetical protein YhbO {Escherichia coli [TaxId 95.78
d2fexa1188 Hypothetical protein Atu0886 {Agrobacterium tumefa 95.57
d1p80a1156 Catalase, C-terminal domain {Escherichia coli, HPI 95.15
d1ycga1149 Nitric oxide reductase C-terminal domain {Moorella 93.49
d1qvwa_236 Hypothetical protein Ydr533Cp {Baker's yeast (Sacc 92.84
d2ab0a1195 Protein ThiJ (YajL) {Escherichia coli [TaxId: 562] 92.38
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 92.24
d1z0sa1249 Inorganic polyphosphate/ATP-NAD kinase PpnK {Archa 91.1
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 90.88
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 90.68
d1n57a_279 HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} 90.53
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 89.81
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 88.72
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 88.2
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 86.91
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 86.91
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 86.83
d1ydga_201 Trp repressor binding protein WrbA {Deinococcus ra 86.19
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 84.89
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 84.7
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 84.39
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 83.01
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 82.62
d1mb3a_123 Cell division response regulator DivK {Caulobacter 80.16
>d1i7qb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Class I glutamine amidotransferase-like
family: Class I glutamine amidotransferases (GAT)
domain: Anthranilate synthase GAT subunit, TrpG
species: Serratia marcescens [TaxId: 615]

Probab=100.00  E-value=1.3e-44  Score=329.40  Aligned_cols=189  Identities=34%  Similarity=0.546  Sum_probs=164.9

Q ss_pred             EEEEEECCCCchHHHHHHHHHhCCCCeEEEeCCCCCHHHHHhhhcccCCcCEEEECCCCCCCCCCCchhHHHHHHHHcCC
Q 046651            6 RTLLIDNYDSYTYNIYQELSTINGVPPVVVRNDEWTWRDICRYLYEENAFDNIVISPGPGSPACPEDIGICLRVLLECWD   85 (392)
Q Consensus         6 r~LlIDnyDSyT~nl~q~L~~v~G~~pvVV~nd~~~~eel~~~l~e~~~fDgIVISpGPGsp~~~~d~gi~~~ll~~~~~   85 (392)
                      .||||||||||||||+++|++ .|.+++|+++|.. .+.....+ +..++|+|++|||||+|....+.....+.+  ..+
T Consensus         2 niliiD~~DSFt~ni~~~l~~-lG~~~~v~~~~~~-~~~~~~~l-~~~~~~~iils~Gpg~~~~~~~~~~i~~~l--~~~   76 (192)
T d1i7qb_           2 DILLLDNVDSFTYNLVDQLRA-SGHQVVIYRNQIG-AEVIIERL-QHMEQPVLMLSPGPGTPSEAGCMPELLQRL--RGQ   76 (192)
T ss_dssp             EEEEEECSCSSHHHHHHHHHH-TTCEEEEEETTSC-HHHHHHHH-HHCSSEEEEECCCSSCGGGSTTHHHHHHHH--BTT
T ss_pred             cEEEEECCCcHHHHHHHHHHH-CCCeEEEEeCCCc-ccccHHHH-HhcCCCeEEecCccccccccccchhhHHhh--hcC
Confidence            589999999999999999998 7999999999876 33222222 125789999999999998766654444443  349


Q ss_pred             CCEEEEcHHHHHHHHHhCCeeeecCCCceeceeEEEecCCcccccCCCCCCcceEEEeeecceeecCCCCCCcEEEEEec
Q 046651           86 VPILGVCLGHQALGFVHGADIVHAPEPVHGRLSEIVHNGDRLFHDIPSGQNSGFKVVRYHSLIIDADSLPKELIPIAWSN  165 (392)
Q Consensus        86 iPILGVCLGhQ~La~a~Gg~V~~apep~hG~~s~i~h~g~~LF~~ips~~~s~f~VvryHSl~V~~~sLP~~l~~iAwt~  165 (392)
                      +||||||+|||+|+.++|++|.+.+.+.+|+...+.+.++.+|.+.+..    +.+.++|++.++.  +|+.++.+|+++
T Consensus        77 iPiLGIClG~Q~la~~~Gg~v~~~~~~~~g~~~~~~~~~~~l~~~~~~~----~~~~~~h~~~~~~--~~~~~~~~a~~~  150 (192)
T d1i7qb_          77 LPIIGICLGHQAIVEAYGGQVGQAGEILHGKASAIAHDGEGMFAGMANP----LPVARYHSLVGSN--IPADLTVNARFG  150 (192)
T ss_dssp             BCEEEETHHHHHHHHHTTCEEEEEEEEEEEEEEEEEECCCGGGTTCCSS----EEEEEEEEEEEES--CCTTSEEEEEET
T ss_pred             ccEEeeeHHHHHHHHHCCCeEEECCcccccceEEEeecCCCceeecccc----ceEEeeccccccc--ccceeeeecCCC
Confidence            9999999999999999999999999999999999999999999999988    9999999999988  999999999875


Q ss_pred             CCCCccccccCCCCCCCcccccchhhhhhcccccccccCCCcccccccccCCcceEEEEEecCCCEEEEeccCCCCCCch
Q 046651          166 SADGFSYLGTLQSGEIPDAYQSQSRQKILLSDISTQIKNGSYRHSIYSNRMRREVLMGIMHSTRPHYGVQFHPESIATCY  245 (392)
Q Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~vmgi~h~~~P~~GVQFHPEsiat~~  245 (392)
                      .                                                     .+||++|.++|+||||||||++.|++
T Consensus       151 ~-----------------------------------------------------~i~ai~~~~~~i~GvQFHPEs~~t~~  177 (192)
T d1i7qb_         151 E-----------------------------------------------------MVMAVRDDRRRVCGFQFHPESILTTH  177 (192)
T ss_dssp             T-----------------------------------------------------EEEEEEETTTTEEEESSCTTSTTSTT
T ss_pred             C-----------------------------------------------------eeEEEEECCCCEEEEEeCCCcCCCCC
Confidence            4                                                     79999999999999999999999999


Q ss_pred             hHHHHHHHHHHHH
Q 046651          246 GSKILRNFREITE  258 (392)
Q Consensus       246 G~~I~~NF~~l~~  258 (392)
                      |.+||+||+.++.
T Consensus       178 G~~il~nFl~~~~  190 (192)
T d1i7qb_         178 GARLLEQTLAWAL  190 (192)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHh
Confidence            9999999998764
>d1qdlb_ c.23.16.1 (B:) Anthranilate synthase GAT subunit, TrpG {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1a9xb2 c.23.16.1 (B:1653-1880) Carbamoyl phosphate synthetase, small subunit C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpma2 c.23.16.1 (A:3-207) GMP synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o1ya_ c.23.16.1 (A:) Hypothetical protein TM1158 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k9vf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9h_ c.23.16.1 (H:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nv0a1 c.23.16.1 (A:1-195) Hypothetical protein YaaE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q7ra_ c.23.16.1 (A:) Hypothetical protein YaaE {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l9xa_ c.23.16.1 (A:) gamma-glutamyl hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2abwa1 c.23.16.1 (A:2-219) Pyridoxine biosynthesis protein 2, Pdx2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s1ma1 c.23.16.1 (A:287-544) CTP synthase PyrG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghra1 c.23.16.8 (A:17-297) Homoserine O-succinyltransferase HTS (MetA) {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhqa_ c.23.16.2 (A:) Putative sigma cross-reacting protein 27A (SCRP-27A, EllB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2ia_ c.23.16.2 (A:) Intracellular protease {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1sy7a1 c.23.16.3 (A:553-736) Catalase, C-terminal domain {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1p5fa_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u9ca_ c.23.16.2 (A:) GK2698 ortholog {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oi4a1 c.23.16.2 (A:23-192) Hypothetical protein YhbO {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fexa1 c.23.16.2 (A:1-188) Hypothetical protein Atu0886 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1p80a1 c.23.16.3 (A:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1ycga1 c.23.5.1 (A:251-399) Nitric oxide reductase C-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1qvwa_ c.23.16.2 (A:) Hypothetical protein Ydr533Cp {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ab0a1 c.23.16.2 (A:2-196) Protein ThiJ (YajL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0sa1 e.52.1.1 (A:1-249) Inorganic polyphosphate/ATP-NAD kinase PpnK {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n57a_ c.23.16.2 (A:) HSP31 (HchA; YedU) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ydga_ c.23.5.8 (A:) Trp repressor binding protein WrbA {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure