Citrus Sinensis ID: 046658
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| 147812093 | 607 | hypothetical protein VITISV_040899 [Viti | 0.946 | 0.644 | 0.307 | 1e-38 | |
| 224114976 | 462 | predicted protein [Populus trichocarpa] | 0.932 | 0.833 | 0.277 | 7e-32 | |
| 297819758 | 426 | F-box family protein [Arabidopsis lyrata | 0.953 | 0.924 | 0.292 | 4e-30 | |
| 15229834 | 427 | putative FBD-associated F-box protein [A | 0.951 | 0.920 | 0.265 | 7e-28 | |
| 15241216 | 430 | FBD-associated F-box protein [Arabidopsi | 0.917 | 0.881 | 0.268 | 3e-27 | |
| 22328947 | 419 | F-box/FBD/LRR-repeat protein [Arabidopsi | 0.939 | 0.926 | 0.281 | 5e-27 | |
| 297818864 | 423 | hypothetical protein ARALYDRAFT_323113 [ | 0.888 | 0.867 | 0.270 | 2e-26 | |
| 15231588 | 454 | putative F-box/LRR-repeat protein [Arabi | 0.876 | 0.797 | 0.281 | 7e-26 | |
| 297803460 | 418 | F-box family protein [Arabidopsis lyrata | 0.937 | 0.925 | 0.265 | 4e-25 | |
| 297796525 | 423 | F-box family protein [Arabidopsis lyrata | 0.946 | 0.924 | 0.269 | 2e-24 |
| >gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 167 bits (422), Expect = 1e-38, Method: Compositional matrix adjust.
Identities = 137/446 (30%), Positives = 215/446 (48%), Gaps = 55/446 (12%)
Query: 5 ISDLPDAILGRIVSFLPTKNTVATSVLSRRWKHVWTSLANLSFDDRLCLRPPA----SAY 60
IS+LPD +L I+SFLPTK V TS+LS+RW+++W S+ L FDD L L P
Sbjct: 12 ISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVELEER 71
Query: 61 VVMPGFVDFVQTVLLRTHPGNIDSFCLHCSRPIDLSSVNFWLSSALMQSVRELQLYLGQQ 120
++M F +FV VL + I F L R +L SV W+ AL + V+EL L+L
Sbjct: 72 IIM--FQNFVDGVLRHSEVSCIKKFRLG-YRDNNLDSVYSWICIALERRVQELDLHLLID 128
Query: 121 NRVQLLETIYTSTTLEVLKLDSDCVINAPCVGTCFPTMKVLHMQ-LQNLDNSLTEKMFSA 179
RV+L + TL V+KL ++ P P++K LH++ ++ D+ +K+ S
Sbjct: 129 WRVELPPMFFICKTLVVVKLSCALFLDIPTT-VWLPSLKALHLKSVEYSDDDSIQKLLSG 187
Query: 180 CPCLEELSVHAYFDADDSRTNFIIASSTLKHFTLTVVIDTDNHFSE---IDHTVMLKAPN 236
CP LEEL + + D++ +++ +LK + D H E D+ V++ APN
Sbjct: 188 CPVLEELVIER--EERDNQWVVNVSNPSLKILRIFFFTDGFAHPYEQEDQDYKVVVDAPN 245
Query: 237 LQCLHIIADRLGSYVLEEMHCLHEAVVHI-----SYAEWSQAVDQCY------------- 278
L+ L I Y ++++ L +A + + + E Y
Sbjct: 246 LEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGRISN 305
Query: 279 -------------------DNFCPSFSELTFLE-VKLAGSGWRVLPIILHSSPNLERLLV 318
D P+F +T LE + + G W LP LHSSPNLE L++
Sbjct: 306 VKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNFLHSSPNLEALVI 365
Query: 319 DKECWFEITKEQFGWIESDCVPQCLLQRVKKIEIIRVQGDEDEQRVIEYFLQQCKCLEVM 378
+ E+ E GW+ VP CL+ +K+IEI R+ G++ E +EY L+ + L+ M
Sbjct: 366 ETGYTNELIPE--GWLMPLQVPACLVLHLKEIEIRRIVGEDYELEAVEYLLKNAEVLQQM 423
Query: 379 IINCKALIFKNQRKHLRQRLSHLKRG 404
I+C + +Q + ++L L RG
Sbjct: 424 TIDCHE-SYMDQEFCVCKKLLGLPRG 448
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15229834|ref|NP_190640.1| putative FBD-associated F-box protein [Arabidopsis thaliana] gi|75265626|sp|Q9SCQ5.1|FBD10_ARATH RecName: Full=Putative FBD-associated F-box protein At3g50710 gi|6561974|emb|CAB62440.1| putative protein [Arabidopsis thaliana] gi|332645179|gb|AEE78700.1| putative FBD-associated F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15241216|ref|NP_200455.1| FBD-associated F-box protein [Arabidopsis thaliana] gi|75262697|sp|Q9FM87.1|FBD26_ARATH RecName: Full=Putative FBD-associated F-box protein At5g56440 gi|10177843|dbj|BAB11272.1| unnamed protein product [Arabidopsis thaliana] gi|332009382|gb|AED96765.1| FBD-associated F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22328947|ref|NP_194364.2| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75244651|sp|Q8H1R7.1|FDL27_ARATH RecName: Full=F-box/FBD/LRR-repeat protein At4g26340 gi|23296372|gb|AAN13055.1| unknown protein [Arabidopsis thaliana] gi|332659787|gb|AEE85187.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297818864|ref|XP_002877315.1| hypothetical protein ARALYDRAFT_323113 [Arabidopsis lyrata subsp. lyrata] gi|297323153|gb|EFH53574.1| hypothetical protein ARALYDRAFT_323113 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15231588|ref|NP_191447.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75264354|sp|Q9LXR4.1|FBL56_ARATH RecName: Full=Putative F-box/LRR-repeat protein At3g58880 gi|7630083|emb|CAB88305.1| putative protein [Arabidopsis thaliana] gi|332646322|gb|AEE79843.1| putative F-box/LRR-repeat protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297803460|ref|XP_002869614.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297315450|gb|EFH45873.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|297796525|ref|XP_002866147.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297311982|gb|EFH42406.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 413 | ||||||
| TAIR|locus:2101674 | 427 | AT3G50710 "AT3G50710" [Arabido | 0.956 | 0.925 | 0.276 | 1.4e-32 | |
| TAIR|locus:2136834 | 419 | AT4G26340 "AT4G26340" [Arabido | 0.934 | 0.921 | 0.286 | 4.7e-32 | |
| TAIR|locus:2099054 | 454 | AT3G58880 "AT3G58880" [Arabido | 0.605 | 0.550 | 0.318 | 1e-29 | |
| TAIR|locus:2161053 | 422 | AT5G56420 "AT5G56420" [Arabido | 0.939 | 0.919 | 0.269 | 4.5e-27 | |
| TAIR|locus:505006162 | 422 | AT1G32375 "AT1G32375" [Arabido | 0.927 | 0.907 | 0.276 | 1.5e-26 | |
| TAIR|locus:2099119 | 482 | AT3G58930 "AT3G58930" [Arabido | 0.501 | 0.429 | 0.312 | 1.8e-26 | |
| TAIR|locus:2037578 | 458 | AT1G78750 "AT1G78750" [Arabido | 0.595 | 0.537 | 0.303 | 3.9e-26 | |
| TAIR|locus:2101635 | 448 | AT3G44810 [Arabidopsis thalian | 0.648 | 0.598 | 0.284 | 5.8e-26 | |
| TAIR|locus:2081408 | 427 | AT3G44060 "AT3G44060" [Arabido | 0.479 | 0.463 | 0.314 | 9.3e-26 | |
| TAIR|locus:2077695 | 491 | AT3G59000 "AT3G59000" [Arabido | 0.602 | 0.507 | 0.313 | 2.5e-25 |
| TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 356 (130.4 bits), Expect = 1.4e-32, P = 1.4e-32
Identities = 121/438 (27%), Positives = 210/438 (47%)
Query: 4 RISDLPDAILGRIVSFLPTKNTVATSVLSRRWKHVWTSLANLSFDDRLCLRPPASAYVVM 63
RIS+L D +L +IVS LPTK+ V T +LS+RWK +W + L FDD L P S Y
Sbjct: 3 RISNLSDDLLLKIVSSLPTKDVVVTMLLSKRWKFLWMMVPKLRFDDEFELEP--SYYGRF 60
Query: 64 PGFVDFVQTVLLRTHPGNIDSFCLH-CSRPIDLSSVNFWLSSALMQSVRELQL-----YL 117
+VD VL R F + C D+++ W+ +++++REL++ Y
Sbjct: 61 LKYVD-KSMVLNRAQVLETVKFNVGPCCSSEDIAT---WIRIGMVRNMRELEISHCEGYF 116
Query: 118 GQQNRVQLLETIYTSTTLEVLKLDSDCVINAPCVGTCFPTMKVLHMQLQNLDNSLTEK-M 176
+ ++L +++YT LEVLKL S V+N P + CFP++K LH+ + + +
Sbjct: 117 REHRSIKLPKSLYTYEKLEVLKLASTVVLNVP-IDVCFPSLKSLHLVCVEYKTKKSHRRL 175
Query: 177 FSACPCLEELSVHAYFDADDSRTNFIIASSTLKHFTLTVVIDTDNHFSEIDHTVMLKAPN 236
S CP LEEL + +++ R+ F + TL+ + ++DT D T ++ AP
Sbjct: 176 LSGCPVLEELVLDKSYNSFHVRS-FYVEIPTLQSLS---ILDTSGELYG-DFTFVVNAPA 230
Query: 237 LQCLHIIADRLGSYVLEE-MHCLHEAVVHISYAEWSQAVDQCYD----NFC--PS---FS 286
L+ + + D G L + M + + + + Y + + + C PS +
Sbjct: 231 LKYFNFV-DFYGDLCLRDNMPEVVDVNIKVIYRNPKKLLGPLKSVKRLSLCLSPSTTLHN 289
Query: 287 ELTFLEV---KLAGSG---WRVLPIILHSSPNLERLLV-DKEC----WFEITKEQFGWIE 335
+ F ++ +L G W +L +L SSP L+ L + + +C + + E+ W E
Sbjct: 290 HMEFYQLVHLELCGDALMWWDLLTWMLQSSPKLQVLKIYECKCEEHDYLDDPIEEH-WEE 348
Query: 336 SDCVPQCLLQRVKKIEIIRVQGDEDEQRVIEYFLQQCKCLEVMIINCKALIF-KNQRKHL 394
VPQCLL + E ++E++V+ Y L+ + L+ + + ++ K +R
Sbjct: 349 PSSVPQCLLFHLNIFEWKYYNAGDEEKKVVAYILKNARQLKTATFSAASYLYPKEERSRE 408
Query: 395 RQRLSHLKRGCDGSELLL 412
L ++ R +LLL
Sbjct: 409 LNELVYMARASSSCQLLL 426
|
|
| TAIR|locus:2136834 AT4G26340 "AT4G26340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099054 AT3G58880 "AT3G58880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161053 AT5G56420 "AT5G56420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006162 AT1G32375 "AT1G32375" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099119 AT3G58930 "AT3G58930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2101635 AT3G44810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081408 AT3G44060 "AT3G44060" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2077695 AT3G59000 "AT3G59000" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00110937 | hypothetical protein (457 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| pfam08387 | 51 | pfam08387, FBD, FBD | 1e-07 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 3e-04 | |
| smart00579 | 72 | smart00579, FBD, domain in FBox and BRCT domain co | 3e-04 |
| >gnl|CDD|203925 pfam08387, FBD, FBD | Back alignment and domain information |
|---|
Score = 47.9 bits (115), Expect = 1e-07
Identities = 15/50 (30%), Positives = 29/50 (58%)
Query: 333 WIESDCVPQCLLQRVKKIEIIRVQGDEDEQRVIEYFLQQCKCLEVMIINC 382
W + VP+CLL ++ +E +G+E+E + +Y L+ + L+ M I+
Sbjct: 2 WNQPSSVPECLLSSLETVEWRGYRGEEEELELAKYILENARVLKKMTISL 51
|
This region is found in F-box (pfam00646) and other domain containing plant proteins; it is repeated in two family members. Its precise function is unknown, but it is thought to be associated with nuclear processes. In fact, several family members are annotated as being similar to transcription factors. Length = 51 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
| >gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.67 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.58 | |
| smart00579 | 72 | FBD domain in FBox and BRCT domain containing plan | 99.45 | |
| PF08387 | 51 | FBD: FBD; InterPro: IPR013596 This region is found | 99.25 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.66 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.42 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.25 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.22 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.21 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.19 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.09 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.04 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.82 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.82 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.81 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.76 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.71 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.39 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.26 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.2 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.15 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.15 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.12 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.03 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.02 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 96.89 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.86 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 96.86 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 96.83 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.79 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.75 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 96.53 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.17 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 96.14 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.12 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.78 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 95.72 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.18 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 95.18 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 94.66 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 94.24 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 94.23 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 94.2 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 93.46 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 93.26 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 92.73 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 92.6 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 92.58 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 92.37 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 92.25 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 91.96 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 90.78 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 90.61 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 90.58 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 88.63 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 87.99 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 87.42 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 87.27 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 86.63 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 85.56 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 84.66 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 84.23 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.67 E-value=5.1e-19 Score=154.64 Aligned_cols=214 Identities=19% Similarity=0.157 Sum_probs=147.3
Q ss_pred CCCCChHHHHHHhcCCCcccchhhcccchhhHHHHhccC---eeeeecCCCCCCCCccccccchHHHHHHHHHhccCCCC
Q 046658 5 ISDLPDAILGRIVSFLPTKNTVATSVLSRRWKHVWTSLA---NLSFDDRLCLRPPASAYVVMPGFVDFVQTVLLRTHPGN 81 (413)
Q Consensus 5 is~LPd~lL~~Ils~L~~~d~~r~s~lSrrWr~l~~~~~---~L~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~~~~~ 81 (413)
+..||||++..|||.|+.+|..+.+.|||||.++.+.-. .+++....+.+ .+...+.++ |
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~~lDl~~r~i~p--------------~~l~~l~~r-g-- 160 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQTLDLTGRNIHP--------------DVLGRLLSR-G-- 160 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhccccccceeeeccCCCccCh--------------hHHHHHHhC-C--
Confidence 467999999999999999999999999999997654333 23333333321 122223222 2
Q ss_pred cceEEeeecCCCCcccHHHHHHHH--HhCCcEEEEEEECcceeeecCccccccccccEEEeCCccccccCC-CcccCCcc
Q 046658 82 IDSFCLHCSRPIDLSSVNFWLSSA--LMQSVRELQLYLGQQNRVQLLETIYTSTTLEVLKLDSDCVINAPC-VGTCFPTM 158 (413)
Q Consensus 82 l~~l~l~~~~~~~~~~~~~wl~~a--~~~~v~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~~~-~~~~~~~L 158 (413)
|..|++.-....++ +...++ ++..+++++++...-..-.+...+..|..|+.|+|.|....+.-. ..+.-.+|
T Consensus 161 V~v~Rlar~~~~~p----rlae~~~~frsRlq~lDLS~s~it~stl~~iLs~C~kLk~lSlEg~~LdD~I~~~iAkN~~L 236 (419)
T KOG2120|consen 161 VIVFRLARSFMDQP----RLAEHFSPFRSRLQHLDLSNSVITVSTLHGILSQCSKLKNLSLEGLRLDDPIVNTIAKNSNL 236 (419)
T ss_pred eEEEEcchhhhcCc----hhhhhhhhhhhhhHHhhcchhheeHHHHHHHHHHHHhhhhccccccccCcHHHHHHhccccc
Confidence 55555553222222 222222 345799999997665444555666779999999999987655321 34567889
Q ss_pred cEEEeeeeEe-ChhhHHHHhccCCccceEEEEeeec-CCCCcceEEEecCccceeEEEeeecCCCCCCCC---cceEEEe
Q 046658 159 KVLHMQLQNL-DNSLTEKMFSACPCLEELSVHAYFD-ADDSRTNFIIASSTLKHFTLTVVIDTDNHFSEI---DHTVMLK 233 (413)
Q Consensus 159 ~~L~L~~~~~-~~~~l~~l~~~cp~Le~L~l~~~~~-~~~~~~~~~i~~~~L~~L~i~~~~~~~~~~~~~---~~~~~~~ 233 (413)
+.|+|+.+.. +..++.-++++|..|.+|.+.+|.. .+.+...+...+++|+.|+++ +|...-+ ...+.-.
T Consensus 237 ~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNls-----G~rrnl~~sh~~tL~~r 311 (419)
T KOG2120|consen 237 VRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLS-----GYRRNLQKSHLSTLVRR 311 (419)
T ss_pred eeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhh-----hhHhhhhhhHHHHHHHh
Confidence 9999999987 9999999999999999999999987 333433233346899999999 8765421 1223446
Q ss_pred cCceeEEEEee
Q 046658 234 APNLQCLHIIA 244 (413)
Q Consensus 234 ~P~L~~L~~~~ 244 (413)
+|+|..|++++
T Consensus 312 cp~l~~LDLSD 322 (419)
T KOG2120|consen 312 CPNLVHLDLSD 322 (419)
T ss_pred CCceeeecccc
Confidence 78888888887
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >smart00579 FBD domain in FBox and BRCT domain containing plant proteins | Back alignment and domain information |
|---|
| >PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 413 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-08 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 58.3 bits (140), Expect = 3e-09
Identities = 52/386 (13%), Positives = 115/386 (29%), Gaps = 120/386 (31%)
Query: 53 LRPPASAYVV---MPGFVDFVQTVL----LRTHPGNIDSFCLHCSRPIDLSSVNFWLSSA 105
LRP + V+ + G +T + ++ + C + FWL+
Sbjct: 147 LRP--AKNVLIDGVLGSG---KTWVALDVCLSYK-------VQCKMDFKI----FWLN-- 188
Query: 106 LMQSVRELQLYLGQQNRVQLLETIYTSTTLEVLKLDSDCVINAPCVGTCFPTMKVLHMQL 165
L N + + + L+ L D + + ++ +H
Sbjct: 189 -----------LKNCNSPETVLEM-----LQKLLYQIDPNWTSRSDHSSNIKLR-IHSIQ 231
Query: 166 QNLDNSLTEKMFSACPCL------EELSVHAYFD---------ADDSRTNFIIASSTLKH 210
L L K + CL + F+ T+F+ A++T H
Sbjct: 232 AELRRLLKSKPY--ENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATT-TH 288
Query: 211 FTLTVVIDTDNHFSEIDHTVMLKAPNLQCLHIIADRLGSYV--------------LEEMH 256
+L + D L + L L V + +
Sbjct: 289 ISL---DHHSMTLTP-DEVKSLLL---KYLDCRPQDLPREVLTTNPRRLSIIAESIRDGL 341
Query: 257 CLHEAVVHISYAEWSQAVDQCYDNFCPS-----FSELT-FLE-VKLAGSGWRVLPIILHS 309
+ H++ + + ++ + P+ F L+ F + P IL
Sbjct: 342 ATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI--------PTIL-- 391
Query: 310 SPNLERLLVDKECWFEITKEQFGWIESDCVPQCLLQRVKK---IEI------IRVQGDED 360
L + WF++ K + + L+++ K I I ++V+ + +
Sbjct: 392 ---LSLI------WFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENE 442
Query: 361 ---EQRVIE-YFLQQCKCLEVMIINC 382
+ +++ Y + + + +I
Sbjct: 443 YALHRSIVDHYNIPKTFDSDDLIPPY 468
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.79 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.78 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.71 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.09 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.95 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.85 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.8 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.77 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.73 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.69 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.69 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.66 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.64 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.61 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.59 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.58 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.58 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.56 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.56 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.54 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.53 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.52 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.5 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.5 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.48 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.47 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.47 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.46 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.44 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.44 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.43 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.42 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.41 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.41 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.41 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.41 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.4 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.4 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.4 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.39 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.39 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.38 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.38 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.38 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.38 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.37 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.37 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.36 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.34 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.33 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.33 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.32 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.32 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.31 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.31 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.29 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.29 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.27 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.24 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.24 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.23 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.23 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.21 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.21 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.19 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.18 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.18 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.17 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.17 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.17 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.17 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.17 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.17 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.15 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.14 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.14 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.12 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.12 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.11 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.07 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.02 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.01 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.01 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.98 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.98 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.94 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.93 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.9 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.88 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.86 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.86 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.85 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.82 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.81 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.8 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.78 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.78 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.77 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.71 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.71 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.7 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.61 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.59 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.57 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.56 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.53 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.52 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.46 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.46 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.43 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.43 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.4 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.36 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.36 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.36 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.35 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.32 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.3 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.29 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.25 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.13 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.12 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.1 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.09 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.08 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.99 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.94 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.88 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.76 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.7 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.67 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.61 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.41 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.39 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.26 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 96.2 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.12 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.06 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 95.9 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 95.81 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 95.6 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.56 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 93.58 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 93.12 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 93.01 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 92.95 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 91.26 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 89.31 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 88.93 |
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
Probab=99.79 E-value=7.7e-20 Score=185.26 Aligned_cols=218 Identities=17% Similarity=0.147 Sum_probs=116.6
Q ss_pred ccCC----CCChHHHHHHhcCC-CcccchhhcccchhhHHHHhccCeeeeecCCCCCCCCccccccchHHHHHHHHHhcc
Q 046658 3 YRIS----DLPDAILGRIVSFL-PTKNTVATSVLSRRWKHVWTSLANLSFDDRLCLRPPASAYVVMPGFVDFVQTVLLRT 77 (413)
Q Consensus 3 D~is----~LPd~lL~~Ils~L-~~~d~~r~s~lSrrWr~l~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~v~~~L~~~ 77 (413)
||++ .||||+|.+||+|| +++|+++++.|||||++++...+...+....+ ......++.+.
T Consensus 7 ~r~~~~~~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~--------------~~~~~~~~~~~ 72 (592)
T 3ogk_B 7 KRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMALCY--------------TATPDRLSRRF 72 (592)
T ss_dssp -----CCCCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHHCCEEEESCGG--------------GSCHHHHHHHC
T ss_pred hhHhhccCCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhccccEEEEeecc--------------ccChHHHHHhC
Confidence 4555 89999999999999 89999999999999999865544221111111 01122232222
Q ss_pred CCCCcceEEeeecCC---------CCcccHHHHHHHHH--hCCcEEEEEEECcceeeecCccccc-ccc-ccEEEeCCcc
Q 046658 78 HPGNIDSFCLHCSRP---------IDLSSVNFWLSSAL--MQSVRELQLYLGQQNRVQLLETIYT-STT-LEVLKLDSDC 144 (413)
Q Consensus 78 ~~~~l~~l~l~~~~~---------~~~~~~~~wl~~a~--~~~v~~L~l~~~~~~~~~lp~~~~~-~~~-L~~L~L~~~~ 144 (413)
+.++++.+..... ........|+.... .+++++|+++...-.... +..+.. +++ |++|+|.+|.
T Consensus 73 --~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~i~~~~-~~~l~~~~~~~L~~L~L~~~~ 149 (592)
T 3ogk_B 73 --PNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLD-LDRLAKARADDLETLKLDKCS 149 (592)
T ss_dssp --TTCSEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHH-HHHHHHHHGGGCCEEEEESCE
T ss_pred --CCCeEEEecCCcchhhcccccccccccchHHHHHHHhhCCCCCeEEeeccEecHHH-HHHHHHhccccCcEEECcCCC
Confidence 3378888765321 11233455665544 257777777744211111 111212 334 7777777664
Q ss_pred cccc---CCCcccCCcccEEEeeeeEeCh---hhHHHHhccCCccceEEEEeeecC----CCCcceEEEecCccceeEEE
Q 046658 145 VINA---PCVGTCFPTMKVLHMQLQNLDN---SLTEKMFSACPCLEELSVHAYFDA----DDSRTNFIIASSTLKHFTLT 214 (413)
Q Consensus 145 ~~~~---~~~~~~~~~L~~L~L~~~~~~~---~~l~~l~~~cp~Le~L~l~~~~~~----~~~~~~~~i~~~~L~~L~i~ 214 (413)
.... +....++++|++|+|.++.+++ ..+..+...||.|++|.+.++... ..+.. +...+++|+.|.+.
T Consensus 150 ~~~~~~l~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~-~~~~~~~L~~L~L~ 228 (592)
T 3ogk_B 150 GFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLET-IARNCRSLVSVKVG 228 (592)
T ss_dssp EEEHHHHHHHHHHCTTCSEEECTTCEEECCCSHHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHH-HHHHCTTCCEEECS
T ss_pred CcCHHHHHHHHhhCCCCCEEECccccccCcchhHHHHHHhcCCCccEEEeeccCCCccCHHHHHH-HHhhCCCCcEEecc
Confidence 2211 1122356777777777776622 225566667777777777655441 01111 11234667777776
Q ss_pred eeecCCCCCCCCcceEEEecCceeEEEEee
Q 046658 215 VVIDTDNHFSEIDHTVMLKAPNLQCLHIIA 244 (413)
Q Consensus 215 ~~~~~~~~~~~~~~~~~~~~P~L~~L~~~~ 244 (413)
+|.... ........|+|++|.+..
T Consensus 229 -----~~~~~~-l~~~~~~~~~L~~L~l~~ 252 (592)
T 3ogk_B 229 -----DFEILE-LVGFFKAAANLEEFCGGS 252 (592)
T ss_dssp -----SCBGGG-GHHHHHHCTTCCEEEECB
T ss_pred -----CccHHH-HHHHHhhhhHHHhhcccc
Confidence 654321 112222456666666653
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 413 | ||||
| d1gefa_ | 120 | c.52.1.18 (A:) Archaeal Holliday junction resolvas | 3e-05 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 5e-04 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 0.001 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 413 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.03 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.75 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.65 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.63 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.31 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.3 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.2 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.2 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.11 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.1 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.08 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.96 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.9 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.85 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.82 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.8 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.76 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.73 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.67 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.65 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.65 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.57 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.51 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.36 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 97.32 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.29 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.21 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.86 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.6 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.19 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.05 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.03 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 95.56 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 95.51 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 94.38 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.3 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 93.61 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 93.12 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 92.94 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 92.11 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 90.64 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 89.03 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 88.59 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 87.95 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 87.72 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.03 E-value=2.5e-13 Score=122.11 Aligned_cols=151 Identities=15% Similarity=0.165 Sum_probs=87.0
Q ss_pred CCcEEEEEEECcceeeecCccccccccccEEEeCCcccccc-CCCcccCCcccEEEeeeeEe-ChhhHHHHhccCCccce
Q 046658 108 QSVRELQLYLGQQNRVQLLETIYTSTTLEVLKLDSDCVINA-PCVGTCFPTMKVLHMQLQNL-DNSLTEKMFSACPCLEE 185 (413)
Q Consensus 108 ~~v~~L~l~~~~~~~~~lp~~~~~~~~L~~L~L~~~~~~~~-~~~~~~~~~L~~L~L~~~~~-~~~~l~~l~~~cp~Le~ 185 (413)
..+++++++........++..+..|++|++|+|.+|...+. +.....+++|++|+|.++.. ++..+..++.+||.|++
T Consensus 46 ~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~ 125 (284)
T d2astb2 46 FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDE 125 (284)
T ss_dssp BCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHHHHCTTCCE
T ss_pred CCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHHHhcCCCCcCccccccccccccccchhhHHHHhccc
Confidence 35677776543322233444455678888888888754321 11345678888888888754 77778888888888888
Q ss_pred EEEEeeec-CC-CCcceEEEecCccceeEEEeeecCCCCCC-C--CcceEEEecCceeEEEEeeccc----ceeeeecCC
Q 046658 186 LSVHAYFD-AD-DSRTNFIIASSTLKHFTLTVVIDTDNHFS-E--IDHTVMLKAPNLQCLHIIADRL----GSYVLEEMH 256 (413)
Q Consensus 186 L~l~~~~~-~~-~~~~~~~i~~~~L~~L~i~~~~~~~~~~~-~--~~~~~~~~~P~L~~L~~~~~~~----~~~~~~~~~ 256 (413)
|.+.+|.. .+ .+...+...+++|++|.+. +|... . +...+.-.+|+|++|+++++.. +...+..++
T Consensus 126 L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~-----~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~~~ 200 (284)
T d2astb2 126 LNLSWCFDFTEKHVQVAVAHVSETITQLNLS-----GYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLN 200 (284)
T ss_dssp EECCCCTTCCHHHHHHHHHHSCTTCCEEECC-----SCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGGCT
T ss_pred cccccccccccccchhhhcccccccchhhhc-----ccccccccccccccccccccccccccccccCCCchhhhhhcccC
Confidence 88888755 11 1111011124678888887 76432 1 1111223467777777776422 122344455
Q ss_pred CceEEEE
Q 046658 257 CLHEAVV 263 (413)
Q Consensus 257 ~L~~~~i 263 (413)
+|+.+.+
T Consensus 201 ~L~~L~L 207 (284)
T d2astb2 201 YLQHLSL 207 (284)
T ss_dssp TCCEEEC
T ss_pred cCCEEEC
Confidence 5555444
|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|