Citrus Sinensis ID: 046678

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70----
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
cccEEHHHHHHHHHHHccccEEEEEEccccccccEEEccHHHHHHHHHHccccEEEEEEEccccccEEEccccc
ccHHHHHHHHHHHHHHccccEEEEEEcccccEEEEcccccHHHHHHHHHcccccEccccccccccccEEEEEcc
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFwacngddqckadcqknykgtgwcdfhkaippekycfcqync
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
***FTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQY**
**KFTIVCFLLAFLLVSDGNMF**AQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
*AKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEKYCFCQYNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query74 2.2.26 [Sep-21-2011]
P8273276 Putative defensin-like pr yes no 0.986 0.960 0.342 4e-09
P8275777 Putative defensin-like pr no no 0.878 0.844 0.376 2e-06
P8275681 Putative defensin-like pr no no 0.864 0.790 0.310 7e-05
>sp|P82732|DF184_ARATH Putative defensin-like protein 184 OS=Arabidopsis thaliana GN=LCR18 PE=3 SV=1 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 39/73 (53%)

Query: 2  AKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKA 61
          +    V  ++ FL+ S GN  +  +A  C++ W C G+D+C+  C   + G G CD + A
Sbjct: 4  SSILFVLIIVVFLISSSGNKKMVGEAKKCDQTWTCEGEDKCREKCLTLHNGVGVCDLYTA 63

Query: 62 IPPEKYCFCQYNC 74
              K CFC Y+C
Sbjct: 64 PLVPKQCFCHYDC 76

Arabidopsis thaliana (taxid: 3702)
>sp|P82757|DF187_ARATH Putative defensin-like protein 187 OS=Arabidopsis thaliana GN=LCR42 PE=5 SV=1 Back     alignment and function description
>sp|P82756|DF188_ARATH Putative defensin-like protein 188 OS=Arabidopsis thaliana GN=LCR41 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
25554240674 conserved hypothetical protein [Ricinus 1.0 1.0 0.405 1e-08
7931311976 putative defensin-like protein 184 [Arab 0.986 0.960 0.342 2e-07
22412550071 predicted protein [Populus trichocarpa] 0.891 0.929 0.378 5e-07
29783319676 predicted protein [Arabidopsis lyrata su 0.932 0.907 0.366 4e-06
7931333177 putative defensin-like protein 187 [Arab 0.878 0.844 0.376 0.0001
>gi|255542406|ref|XP_002512266.1| conserved hypothetical protein [Ricinus communis] gi|223548227|gb|EEF49718.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score = 63.9 bits (154), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 39/74 (52%)

Query: 1  MAKFTIVCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHK 60
          M KFT    L+  +L SD  + + A A  C K W C G+++C  DC+  Y G G CD + 
Sbjct: 1  MVKFTTFFLLVLLILASDEEVVMRAGARDCHKVWNCKGNNRCWDDCKNKYNGMGLCDLYA 60

Query: 61 AIPPEKYCFCQYNC 74
          A    K CFC Y C
Sbjct: 61 APAVPKQCFCAYKC 74

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|79313119|ref|NP_001030639.1| putative defensin-like protein 184 [Arabidopsis thaliana] gi|46396209|sp|P82732.1|DF184_ARATH RecName: Full=Putative defensin-like protein 184; AltName: Full=Putative low-molecular-weight cysteine-rich protein 18; Short=Protein LCR18; Flags: Precursor gi|332640642|gb|AEE74163.1| putative defensin-like protein 184 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224125500|ref|XP_002319602.1| predicted protein [Populus trichocarpa] gi|222857978|gb|EEE95525.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297833196|ref|XP_002884480.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330320|gb|EFH60739.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79313331|ref|NP_001030745.1| putative defensin-like protein 187 [Arabidopsis thaliana] gi|46396229|sp|P82757.1|DF187_ARATH RecName: Full=Putative defensin-like protein 187; AltName: Full=Putative low-molecular-weight cysteine-rich protein 42; Short=Protein LCR42; Flags: Precursor gi|332643205|gb|AEE76726.1| putative defensin-like protein 187 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query74
TAIR|locus:100902329276 LCR18 "low-molecular-weight cy 0.918 0.894 0.367 2.2e-11
TAIR|locus:100902324877 LCR42 "low-molecular-weight cy 0.864 0.831 0.382 2.9e-09
TAIR|locus:100902327281 LCR41 "low-molecular-weight cy 0.864 0.790 0.319 4.2e-08
TAIR|locus:100902321774 LCR40 "low-molecular-weight cy 0.932 0.932 0.316 4.8e-07
TAIR|locus:100902328077 LCR39 "low-molecular-weight cy 0.918 0.883 0.313 2.1e-06
TAIR|locus:100902317283 LCR29 "low-molecular-weight cy 0.945 0.843 0.270 3e-05
TAIR|locus:100902331377 LCR25 "low-molecular-weight cy 0.972 0.935 0.354 3.9e-05
TAIR|locus:100902319584 LCR60 "low-molecular-weight cy 0.824 0.726 0.328 5e-05
TAIR|locus:211823977 LCR27 "AT4G29300" [Arabidopsis 0.972 0.935 0.316 6.3e-05
TAIR|locus:100902337077 LCR13 "low-molecular-weight cy 0.959 0.922 0.275 0.0001
TAIR|locus:1009023292 LCR18 "low-molecular-weight cysteine-rich 18" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 2.2e-11, P = 2.2e-11
 Identities = 25/68 (36%), Positives = 38/68 (55%)

Query:     7 VCFLLAFLLVSDGNMFLGAQANTCEKFWACNGDDQCKADCQKNYKGTGWCDFHKAIPPEK 66
             V  ++ FL+ S GN  +  +A  C++ W C G+D+C+  C   + G G CD + A    K
Sbjct:     9 VLIIVVFLISSSGNKKMVGEAKKCDQTWTCEGEDKCREKCLTLHNGVGVCDLYTAPLVPK 68

Query:    67 YCFCQYNC 74
              CFC Y+C
Sbjct:    69 QCFCHYDC 76
GO:0005576 "extracellular region" evidence=ISM
TAIR|locus:1009023248 LCR42 "low-molecular-weight cysteine-rich 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023272 LCR41 "low-molecular-weight cysteine-rich 41" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023217 LCR40 "low-molecular-weight cysteine-rich 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023280 LCR39 "low-molecular-weight cysteine-rich 39" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023172 LCR29 "low-molecular-weight cysteine-rich 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023313 LCR25 "low-molecular-weight cysteine-rich 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023195 LCR60 "low-molecular-weight cysteine-rich 60" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118239 LCR27 "AT4G29300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023370 LCR13 "low-molecular-weight cysteine-rich 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P82732DF184_ARATHNo assigned EC number0.34240.98640.9605yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
LCR18
LCR18 (Low-molecular-weight cysteine-rich 18); Encodes a member of a family of small,secreted, cysteine rich protein with sequence similarity to the PCP (pollen coat protein) gene family. (76 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 74
PF0733358 SLR1-BP: S locus-related glycoprotein 1 binding po 99.08
PF0030447 Gamma-thionin: Gamma-thionin family; InterPro: IPR 98.4
PF1086890 DUF2667: Protein of unknown function (DUF2667); In 98.01
cd0010733 Knot1 The "knottin" fold is stable cysteine-rich s 97.07
smart0050545 Knot1 Knottins. Knottins, representing plant lecti 96.11
PF0045132 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IP 93.97
PF0712754 Nodulin_late: Late nodulin protein; InterPro: IPR0 93.8
PF1141535 Toxin_37: Antifungal peptide termicin; InterPro: I 91.8
PF0109734 Defensin_2: Arthropod defensin; InterPro: IPR00154 91.74
PF1486559 Macin: Macin; PDB: 2K35_A 2LN8_A. 84.67
PF0053754 Toxin_3: Scorpion toxin-like domain ; InterPro: IP 83.25
>PF07333 SLR1-BP: S locus-related glycoprotein 1 binding pollen coat protein (SLR1-BP); InterPro: IPR010851 This entry consists of a number of cysteine rich SLR1 binding pollen coat like proteins Back     alignment and domain information 
Probab=99.08  E-value=1.3e-10  Score=65.00  Aligned_cols=44  Identities=36%  Similarity=0.953  Sum_probs=37.9

Q ss_pred             cccceee-----ecCCCcchHHHhhhhCCCc-cEeeccCCCCCCCceEEeecC
Q 046678           28 NTCEKFW-----ACNGDDQCKADCQKNYKGT-GWCDFHKAIPPEKYCFCQYNC   74 (74)
Q Consensus        28 ~~C~~~~-----~C~~~~~C~~~C~~~~~g~-G~C~~~~~~~~~~~C~C~y~C   74 (74)
                      ++|++++     +|+. ++|++.|.++|+|. |+|.  +.++.+.+|+|+|+|
T Consensus         9 ~~C~~~l~~~~~~C~~-~~C~~~C~~k~~g~~G~C~--~~~~~~~~C~C~Y~C   58 (58)
T PF07333_consen    9 RQCHEVLPNKPGPCDP-QDCRSLCKKKYKGGVGTCI--PKPKGPKQCLCTYNC   58 (58)
T ss_pred             CcCceeCccCCCCCCh-HHHHHHHHHHcCCCceEec--cCCCCCCeeEEEeeC
Confidence            4499877     7999 99999999999987 9999  343458899999998

Adhesion of pollen grains to the stigmatic surface is a critical step during sexual reproduction in plants. In Brassica, S locus-related glycoprotein 1 (SLR1), a stigma-specific protein belonging to the S gene family of proteins, has been shown to be involved in this step. SLR1-BP specifically binds SLR1 with high affinity. The SLR1-BP gene is specifically expressed in pollen at late stages of development and is a member of the class A pollen coat protein (PCP) family, which includes PCP-A1, an SLG (S locus glycoprotein)-binding protein []. This entry also includes defensin-like proteins. The function of these proteins is uncharacterised.
>PF00304 Gamma-thionin: Gamma-thionin family; InterPro: IPR008176 The following small plant proteins are evolutionary related: Gamma-thionins from Triticum aestivum (Wheat) endosperm (gamma-purothionins) and gamma-hordothionins from Hordeum vulgare(Barley) are toxic to animal cells and inhibit protein synthesis in cell free systems [] Back     alignment and domain information
>PF10868 DUF2667: Protein of unknown function (DUF2667); InterPro: IPR022618 This family of proteins with unknown function appears to be restricted to Arabidopsis thaliana Back     alignment and domain information
>cd00107 Knot1 The "knottin" fold is stable cysteine-rich scaffold, in which one disulfide bridge crosses the macrocycle made by two other disulfide bridges and the connecting backbone segments Back     alignment and domain information
>smart00505 Knot1 Knottins Back     alignment and domain information
>PF00451 Toxin_2: Scorpion short toxin, BmKK2; InterPro: IPR001947 Scorpion venoms contain a variety of peptides toxic to mammals, insects and crustaceans Back     alignment and domain information
>PF07127 Nodulin_late: Late nodulin protein; InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein Back     alignment and domain information
>PF11415 Toxin_37: Antifungal peptide termicin; InterPro: IPR024723 Termicin is a cysteine-rich antifungal peptide, which also exhibits weak antibacterial activity Back     alignment and domain information
>PF01097 Defensin_2: Arthropod defensin; InterPro: IPR001542 Arthropod defensins are a family of insect and scorpion cysteine-rich antibacterial peptides, primarily active against Gram-positive bacteria [, , , , ] Back     alignment and domain information
>PF14865 Macin: Macin; PDB: 2K35_A 2LN8_A Back     alignment and domain information
>PF00537 Toxin_3: Scorpion toxin-like domain ; InterPro: IPR002061 Scorpion toxins, which may be mammal or insect specific, bind to sodium channels, inhibiting the inactivation of activated channels and blocking neuronal transmission Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
2ksk_A71 Sugarcane defensin 5; csalphabeta motif, antimicro 98.88
1ayj_A51 RS-AFP1, antifungal protein 1; fungicide, plant de 98.67
1mr4_A47 Nicotiana alata plant defensin 1 (NAD1); cysteine- 98.63
1n4n_A47 PHD1, floral defensin-like protein 1; cysteine-sta 98.61
1gps_A47 Gamma-1-P thionin; plant toxin; NMR {Triticum turg 98.61
2kpy_A108 Major pollen allergen ART V 1; defensin-like, poly 98.58
2lr3_A47 Defensin; fungal disease, antifungal agent, antifu 98.56
1ti5_A46 Plant defensin; insecticidal activity, MUNG bean, 98.51
3psm_A47 Defensin, SPE10; dimer, antimicrobial protein; 0.9 98.47
1jkz_A46 PSD1, defense-related peptide 1; plant defensin, C 98.44
1bk8_A50 AH-AMP1, antimicrobial protein 1; plant defensin, 98.41
1myn_A44 Drosomycin; insect immunity, antifungal, csalpha-b 97.16
1c49_A35 Toxin K-beta; scorpion toxin, potassium channels b 96.7
1quz_A35 HSTX1 toxin; scorpion toxin, alpha beta, molecular 96.6
2k9o_A36 VM24 scorpion toxin; ALFA/beta scaffold, beta shee 96.57
1qky_A38 PI7, toxin 7 from pandinus imperator; neurotoxin; 96.55
1n8m_A38 PI4, potassium channel blocking toxin 4; potassium 96.44
1wt7_A41 BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, 96.38
1wmt_A41 ISTX; neurotoxin, potassium channel blocker, solut 96.29
1i2u_A44 Defensin heliomicin; alpha-beta protein, CSAB moti 95.98
2ddl_A33 Leiurotoxin, LEI4P; scorpion toxin analog; NMR {Sy 95.7
1wz5_A35 Potassium channel blocking toxin 1; ionic channel 94.93
1c55_A40 Butantoxin; structure; NMR {Tityus serrulatus} SCO 94.79
1j5j_A36 BEKM-1 toxin; alpha-beta motif, cysteine-knot moti 94.78
1hly_A39 Hongotoxin 1; scorpion, centruroides limbatus HGTX 94.71
1agt_A38 Agitoxin 2; potassium channel blocker, neurotoxin; 94.67
1hp2_A37 Tityustoxin K alpha; K+ channel, scorpion toxin, a 94.36
1r1g_A31 Neurotoxin BMK37, BMBKTTX1; siras from S atoms, sc 94.33
1pjv_A32 Cobatoxin 1, COTX1, GTIX; scorpion toxin, centuroi 94.29
2axk_A38 Discrepin; scorpion toxin, A-current, K+-channel,; 94.25
1big_A37 Toxin BMTX1; scorpion, neurotoxin, structure, larg 94.11
1m2s_A37 Toxin BMTX3, neurotoxin TX3; alpha/beta scaffold; 93.93
1mm0_A36 Termicin; termite, cytein-rich, antimicrobial pept 93.59
1bah_A37 Charybdotoxin, chabii; neurotoxin, potassium chann 92.86
1brz_A54 Brazzein; sweet protein, cysteine-stabilized alpha 92.71
1cmr_A31 Charybdotoxin, alpha chimera; antagonist of nicoti 92.52
2koz_A33 Nasonin-1; alpha/beta structure, disulfide bonds, 92.38
1tsk_A35 TS KAPA; scorpion, toxin, potassium channel, neuro 91.98
1zfu_A40 Plectasin; defensin,antimicrobial peptide,cysteine 91.84
2k35_A60 Hydramacin-1; antimicrobial protein; NMR {Hydra} 90.38
2ln8_A75 Theromacin; antimicrobial peptide, antimicrobial p 89.82
2e3g_A40 Defensin, mutant DEF-DAA; insect defensin, CSAB mo 89.14
1jxc_A68 Putative trypsin inhibitor ATTI-2; chymotrypsin in 88.68
1ica_A40 Insect defensin A; antibacterial protein; NMR {Pro 86.97
2e3e_A45 Defensin, mutant DEF-BBB; insect defensin, CSAB mo 86.59
2ln4_A44 Coprisin; antimicrobial protein, defensin-like pep 86.58
1fjn_A39 Defensin MGD-1; cystine stabilized alpha-beta moti 86.43
2lt8_A42 Eurocin; A/B-fold, cysteine stabilised, antimicrob 84.88
2lr5_A38 Micasin; antimicrobial protein; NMR {Arthroderma o 84.89
2b68_A43 Defensin; antibacterial peptide, cysteine-rich pep 83.33
1pvz_A31 K+ toxin-like peptide; alpha/beta scaffold; NMR {M 83.12
>2ksk_A Sugarcane defensin 5; csalphabeta motif, antimicrobial protein; NMR {Saccharum officinarum} Back     alignment and structure
Probab=98.88  E-value=1.7e-09  Score=62.49  Aligned_cols=48  Identities=31%  Similarity=0.691  Sum_probs=39.7

Q ss_pred             cccccccceee-----ecCCCcchHHHhhh--hCCCccEeeccCCCCCCCceEEeecC
Q 046678           24 GAQANTCEKFW-----ACNGDDQCKADCQK--NYKGTGWCDFHKAIPPEKYCFCQYNC   74 (74)
Q Consensus        24 ~~ea~~C~~~~-----~C~~~~~C~~~C~~--~~~g~G~C~~~~~~~~~~~C~C~y~C   74 (74)
                      ++||++|++..     +|..+.+|+++|++  ++...|.|.  .++ ..++|+|+++|
T Consensus         3 ~aEAr~C~s~S~~fkG~C~~~~nC~~vC~~~~Egf~~G~C~--g~~-~~rrC~Ctk~C   57 (71)
T 2ksk_A            3 PTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCN--GRP-PFKQCFCTKPC   57 (71)
T ss_dssp             CCSSCCEEEECSSSCSSCCCHHHHHHHHHHHCSSCCEEEEE--CCS-SSCEEEEEECC
T ss_pred             cccchhhhccCCCCeEEcCCCccHHHhccCcCCCCCCCCcC--CCC-CCceEEEECCc
Confidence            47899999854     89999999999999  566889999  332 16789999998
>1ayj_A RS-AFP1, antifungal protein 1; fungicide, plant defensin, cysteine-stabilized ALFA/beta motif; HET: PCA; NMR {Raphanus sativus var} SCOP: g.3.7.5 Back     alignment and structure
>1mr4_A Nicotiana alata plant defensin 1 (NAD1); cysteine-stabilized alpha-beta motif, plant defensin fold, plant protein; NMR {Nicotiana tabacum} SCOP: g.3.7.5 PDB: 4aaz_A 4ab0_A Back     alignment and structure
>1n4n_A PHD1, floral defensin-like protein 1; cysteine-stabilised alpha-beta motif, fifth disulfide bond, plant protein; NMR {Petunia x hybrida} SCOP: g.3.7.5 Back     alignment and structure
>1gps_A Gamma-1-P thionin; plant toxin; NMR {Triticum turgidum} SCOP: g.3.7.5 PDB: 1gpt_A Back     alignment and structure
>2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Back     alignment and structure
>2lr3_A Defensin; fungal disease, antifungal agent, antifungal protein; NMR {Medicago truncatula} Back     alignment and structure
>1ti5_A Plant defensin; insecticidal activity, MUNG bean, plant protein; NMR {Vigna radiata} Back     alignment and structure
>3psm_A Defensin, SPE10; dimer, antimicrobial protein; 0.98A {Pachyrhizus erosus} SCOP: g.3.7.5 PDB: 2gl1_A 2lj7_A Back     alignment and structure
>1jkz_A PSD1, defense-related peptide 1; plant defensin, Cys-rich, antifungal, antifungal protein; NMR {Pisum sativum} SCOP: g.3.7.5 Back     alignment and structure
>1bk8_A AH-AMP1, antimicrobial protein 1; plant defensin, cysteine-stabilized ALFA/ beta motif; NMR {Aesculus hippocastanum} SCOP: g.3.7.5 Back     alignment and structure
>1myn_A Drosomycin; insect immunity, antifungal, csalpha-beta motif, signal protein; NMR {Drosophila melanogaster} SCOP: g.3.7.4 Back     alignment and structure
>1c49_A Toxin K-beta; scorpion toxin, potassium channels blockers, alpha-K toxin family, neurotoxin, solution structure; NMR {Pandinus imperator} SCOP: g.3.7.2 PDB: 2pta_A Back     alignment and structure
>1quz_A HSTX1 toxin; scorpion toxin, alpha beta, molecular modeling, potassium channel; NMR {Synthetic} SCOP: k.23.1.1 PDB: 1y2p_A 1wpd_A Back     alignment and structure
>2k9o_A VM24 scorpion toxin; ALFA/beta scaffold, beta sheet, ALFA helix, scorpion K+ toxin; NMR {Synthetic} Back     alignment and structure
>1qky_A PI7, toxin 7 from pandinus imperator; neurotoxin; NMR {Pandinus imperator} SCOP: g.3.7.2 Back     alignment and structure
>1n8m_A PI4, potassium channel blocking toxin 4; potassium channel blocker, disulfide bridge stabilized alpha beta motif; NMR {Synthetic} SCOP: g.3.7.2 PDB: 1v56_A 1txm_A Back     alignment and structure
>1wt7_A BUTX-MTX; maurotoxin, butantoxin, scorpion toxin, K+ channels, molecular contacts, toxin affinity; NMR {Synthetic} SCOP: g.3.7.2 PDB: 2z3s_A Back     alignment and structure
>1wmt_A ISTX; neurotoxin, potassium channel blocker, solution structure, alpha-K toxin family, scorpion toxin; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>1i2u_A Defensin heliomicin; alpha-beta protein, CSAB motif (cysteine stabilized alpha- helix beta-sheet motif), antifungal protein; NMR {Heliothis virescens} SCOP: g.3.7.4 PDB: 1ozz_A 1i2v_A 1p0a_A 1p00_A Back     alignment and structure
>2ddl_A Leiurotoxin, LEI4P; scorpion toxin analog; NMR {Synthetic} Back     alignment and structure
>1wz5_A Potassium channel blocking toxin 1; ionic channel inhibitor; HET: ABA; NMR {Pandinus imperator} Back     alignment and structure
>1c55_A Butantoxin; structure; NMR {Tityus serrulatus} SCOP: g.3.7.2 PDB: 1c56_A Back     alignment and structure
>1j5j_A BEKM-1 toxin; alpha-beta motif, cysteine-knot motif; NMR {Mesobuthus eupeus} SCOP: g.3.7.2 PDB: 1lgl_A Back     alignment and structure
>1hly_A Hongotoxin 1; scorpion, centruroides limbatus HGTX1, potassium channel; NMR {Centruroides limbatus} SCOP: g.3.7.2 PDB: 1mtx_A 1sxm_A Back     alignment and structure
>1agt_A Agitoxin 2; potassium channel blocker, neurotoxin; NMR {Leiurus quinquestriatus hebraeus} SCOP: g.3.7.2 PDB: 1xsw_A 2ktx_A 2uvs_A 3odv_A* 1ktx_A 2ck4_A 1sco_A 2k4u_A 1bkt_A 2ck5_A 2kir_A Back     alignment and structure
>1hp2_A Tityustoxin K alpha; K+ channel, scorpion toxin, alpha-K toxin,; NMR {Tityus serrulatus} SCOP: g.3.7.2 Back     alignment and structure
>1r1g_A Neurotoxin BMK37, BMBKTTX1; siras from S atoms, scorpion toxin, reductive dimethylation; HET: MLY; 1.72A {Synthetic} SCOP: g.3.7.2 PDB: 1q2k_A 3e8y_X Back     alignment and structure
>1pjv_A Cobatoxin 1, COTX1, GTIX; scorpion toxin, centuroides noxius, K+ channel, chemical synthesis, 3-D structure, 1H-spectroscopy, circular dichroism; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>2axk_A Discrepin; scorpion toxin, A-current, K+-channel,; HET: PCA; NMR {Synthetic} Back     alignment and structure
>1big_A Toxin BMTX1; scorpion, neurotoxin, structure, large conductance potassium channel, voltage gated potassium channel; HET: PCA; NMR {Mesobuthus martensii} SCOP: g.3.7.2 PDB: 2bmt_A* Back     alignment and structure
>1m2s_A Toxin BMTX3, neurotoxin TX3; alpha/beta scaffold; NMR {Mesobuthus martensii} SCOP: g.3.7.2 Back     alignment and structure
>1mm0_A Termicin; termite, cytein-rich, antimicrobial peptide, insect defensin, CSAB motif, antimicrobial protein; NMR {Pseudacanthotermes spiniger} SCOP: g.3.7.4 Back     alignment and structure
>1bah_A Charybdotoxin, chabii; neurotoxin, potassium channel inhibitor; HET: PCA ABA; NMR {Leiurus quinquestriatus} SCOP: g.3.7.2 PDB: 2a9h_E* 2crd_A* 1lir_A* Back     alignment and structure
>1brz_A Brazzein; sweet protein, cysteine-stabilized alpha-beta; HET: PCA; NMR {Pentadiplandra brazzeana} SCOP: g.3.7.5 PDB: 2brz_A* 2kgq_A 2kyq_A Back     alignment and structure
>1cmr_A Charybdotoxin, alpha chimera; antagonist of nicotinic acetylcholine receptor, curaremimetic protein; NMR {Synthetic} SCOP: g.3.7.2 Back     alignment and structure
>2koz_A Nasonin-1; alpha/beta structure, disulfide bonds, de novo protein; NMR {Synthetic construct} PDB: 2kp0_A Back     alignment and structure
>1tsk_A TS KAPA; scorpion, toxin, potassium channel, neurotoxin; NMR {Tityus serrulatus} SCOP: g.3.7.2 Back     alignment and structure
>1zfu_A Plectasin; defensin,antimicrobial peptide,cysteine stabilized alpha- beta motif, antimicrobial protein; NMR {Pseudoplectania nigrella} PDB: 3e7r_L 3e7u_X Back     alignment and structure
>2k35_A Hydramacin-1; antimicrobial protein; NMR {Hydra} Back     alignment and structure
>2ln8_A Theromacin; antimicrobial peptide, antimicrobial protein; NMR {Hirudo medicinalis} Back     alignment and structure
>2e3g_A Defensin, mutant DEF-DAA; insect defensin, CSAB motif, antibacterial, antimicrobial protein; NMR {Anopheles gambiae} PDB: 2nz3_A Back     alignment and structure
>1jxc_A Putative trypsin inhibitor ATTI-2; chymotrypsin inhibitor, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: g.3.7.5 Back     alignment and structure
>1ica_A Insect defensin A; antibacterial protein; NMR {Protophormia terraenovae} SCOP: g.3.7.4 PDB: 1l4v_A 2lld_A 2ny8_X Back     alignment and structure
>2e3e_A Defensin, mutant DEF-BBB; insect defensin, CSAB motif, antibacterial, antimicrobial protein; NMR {Anopheles gambiae} PDB: 2e3f_A 2ny9_X Back     alignment and structure
>2ln4_A Coprisin; antimicrobial protein, defensin-like peptide; NMR {Copris tripartitus} Back     alignment and structure
>1fjn_A Defensin MGD-1; cystine stabilized alpha-beta motif, antibacterial, disulfide bond, synthesis, antimicrobial protein; NMR {Synthetic} SCOP: g.3.7.3 Back     alignment and structure
>2lt8_A Eurocin; A/B-fold, cysteine stabilised, antimicrobial protein; NMR {Eurotium amstelodami} Back     alignment and structure
>2lr5_A Micasin; antimicrobial protein; NMR {Arthroderma otae} Back     alignment and structure
>2b68_A Defensin; antibacterial peptide, cysteine-rich peptide, antimicrobial protein; NMR {Crassostrea gigas} Back     alignment and structure
>1pvz_A K+ toxin-like peptide; alpha/beta scaffold; NMR {Mesobuthus martensii} SCOP: g.3.7.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query74
d1ayja_51 Antifungal protein 1 (RS-AFP1) {Radish (Raphanus s 99.08
d1bk8a_50 Antimicrobial protein 1 (AH-AMP1) {Horse chestnut 99.0
d1gpsa_47 gamma-Thionin {English wheat (Triticum turgidum) [ 98.63
d1mr4a_47 Floral defensin 1 {Common tobacco (Nicotiana tabac 98.55
d1n4na_47 Floral defensin 1 {Garden petunia (Petunia x hybri 98.46
d1jkza_46 Defensin 1 (PSD1) {Pea (Pisum sativum) [TaxId: 388 97.51
d2crda_37 Charybdotoxin {Scorpion (Leiurus quinquestriatus h 95.57
d1wmta_41 Istx {Scorpion (Opisthacanthus madagascariensis) [ 95.28
d1cmra_31 Charybdotoxin {Scorpion (Leiurus quinquestriatus h 94.11
d1biga_37 Bmtx1 {Buthus martensii [TaxId: 34649]} 93.89
d1mm0a_36 Antimicrobial peptide termicin {Termite (Pseudacan 93.22
d1brza_54 Brazzein {J'oublie (Pentadiplandra brazzeana) [Tax 92.93
d1j5ja_36 Bekm-1 {Lesser asian scorpion (Buthus eupeus) [Tax 92.77
d1r1ga_31 Neurotoxin bmk37 {Chinese scorpion (Buthus martens 92.75
d1ozza_44 Defensin ARD1 {Archaeoprepona demophon [TaxId: 191 91.77
d1c55a_40 Butantoxin {Brazilian scorpion (Tityus serrulatus) 91.22
d1pjva_32 Cobatoxin 1 {Scorpion (Centruroides noxius) [TaxId 90.95
d1m2sa_37 Bmtx3 {Buthus martensii karsch [TaxId: 34649]} 90.93
d1tska_35 Toxin ts kappa {Scorpion (Tityus serrulatus) [TaxI 89.49
d1icaa_40 Defensin A {Flesh fly (Phormia terranovae) [TaxId: 88.29
d1jxca_68 Trypsin/chymotrypsin inhibitor ATT {Mouse-ear cres 86.93
d1hp2a_37 alpha-KTX, K+-channel blocker {Brazilian scorpion 86.83
d1jlza_26 alpha-KTX, K+-channel blocker {Scorpion (Tityus ca 86.12
d1agta_38 Agitoxin {Scorpion (Leiurus quinquestriatus hebrae 82.51
d1myna_44 Drosomycin {Fruit fly (Drosophila melanogaster) [T 81.28
d1nh5a_60 Scorpion toxin {Bark scorpion (Centruroides sculpt 80.76
>d1ayja_ g.3.7.5 (A:) Antifungal protein 1 (RS-AFP1) {Radish (Raphanus sativus) [TaxId: 3726]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: Scorpion toxin-like
family: Plant defensins
domain: Antifungal protein 1 (RS-AFP1)
species: Radish (Raphanus sativus) [TaxId: 3726]

Probab=99.08  E-value=5.3e-11  Score=63.00  Aligned_cols=44  Identities=30%  Similarity=0.852  Sum_probs=37.7

Q ss_pred             cccce---ee--ecCCCcchHHHhhhhCC-CccEeeccCCCCCCCceEEeecC
Q 046678           28 NTCEK---FW--ACNGDDQCKADCQKNYK-GTGWCDFHKAIPPEKYCFCQYNC   74 (74)
Q Consensus        28 ~~C~~---~~--~C~~~~~C~~~C~~~~~-g~G~C~~~~~~~~~~~C~C~y~C   74 (74)
                      +.|+.   +|  .|.+++.|+++|+++++ .+|.|. +.+|  ...|||||||
T Consensus         2 klCer~S~TWsG~Cgn~~~C~~qC~~~E~A~hGaCh-~~f~--~~~CfCYF~C   51 (51)
T d1ayja_           2 KLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCN-YVFP--AHKCICYFPC   51 (51)
T ss_dssp             CCEEEECSSCCSCCSCHHHHHHHHHHHSCCSCEEEE-CCSS--SCEEEEEECC
T ss_pred             chhcccCCceeeccCCchHHHHHHHhhhhccccccc-cccC--CccEEEeccC
Confidence            45664   55  99999999999999887 599999 6887  7889999998
>d1bk8a_ g.3.7.5 (A:) Antimicrobial protein 1 (AH-AMP1) {Horse chestnut (Aesculus hippocastanum) [TaxId: 43364]} Back     information, alignment and structure
>d1gpsa_ g.3.7.5 (A:) gamma-Thionin {English wheat (Triticum turgidum) [TaxId: 4571]} Back     information, alignment and structure
>d1mr4a_ g.3.7.5 (A:) Floral defensin 1 {Common tobacco (Nicotiana tabacum), NAD1 [TaxId: 4097]} Back     information, alignment and structure
>d1n4na_ g.3.7.5 (A:) Floral defensin 1 {Garden petunia (Petunia x hybrida), PHD1 [TaxId: 4102]} Back     information, alignment and structure
>d1jkza_ g.3.7.5 (A:) Defensin 1 (PSD1) {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2crda_ g.3.7.2 (A:) Charybdotoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} Back     information, alignment and structure
>d1wmta_ g.3.7.2 (A:) Istx {Scorpion (Opisthacanthus madagascariensis) [TaxId: 167108]} Back     information, alignment and structure
>d1cmra_ g.3.7.2 (A:) Charybdotoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} Back     information, alignment and structure
>d1biga_ g.3.7.2 (A:) Bmtx1 {Buthus martensii [TaxId: 34649]} Back     information, alignment and structure
>d1mm0a_ g.3.7.4 (A:) Antimicrobial peptide termicin {Termite (Pseudacanthotermes spiniger) [TaxId: 115113]} Back     information, alignment and structure
>d1brza_ g.3.7.5 (A:) Brazzein {J'oublie (Pentadiplandra brazzeana) [TaxId: 43545]} Back     information, alignment and structure
>d1j5ja_ g.3.7.2 (A:) Bekm-1 {Lesser asian scorpion (Buthus eupeus) [TaxId: 34648]} Back     information, alignment and structure
>d1r1ga_ g.3.7.2 (A:) Neurotoxin bmk37 {Chinese scorpion (Buthus martensi karsch) [TaxId: 34649]} Back     information, alignment and structure
>d1ozza_ g.3.7.4 (A:) Defensin ARD1 {Archaeoprepona demophon [TaxId: 191427]} Back     information, alignment and structure
>d1c55a_ g.3.7.2 (A:) Butantoxin {Brazilian scorpion (Tityus serrulatus) [TaxId: 6887]} Back     information, alignment and structure
>d1pjva_ g.3.7.2 (A:) Cobatoxin 1 {Scorpion (Centruroides noxius) [TaxId: 6878]} Back     information, alignment and structure
>d1m2sa_ g.3.7.2 (A:) Bmtx3 {Buthus martensii karsch [TaxId: 34649]} Back     information, alignment and structure
>d1tska_ g.3.7.2 (A:) Toxin ts kappa {Scorpion (Tityus serrulatus) [TaxId: 6887]} Back     information, alignment and structure
>d1icaa_ g.3.7.4 (A:) Defensin A {Flesh fly (Phormia terranovae) [TaxId: 34676]} Back     information, alignment and structure
>d1jxca_ g.3.7.5 (A:) Trypsin/chymotrypsin inhibitor ATT {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hp2a_ g.3.7.2 (A:) alpha-KTX, K+-channel blocker {Brazilian scorpion (Tityus serrulatus), Tstx-k alpha [TaxId: 6887]} Back     information, alignment and structure
>d1jlza_ g.3.7.2 (A:) alpha-KTX, K+-channel blocker {Scorpion (Tityus cambridgei) [TaxId: 184226]} Back     information, alignment and structure
>d1agta_ g.3.7.2 (A:) Agitoxin {Scorpion (Leiurus quinquestriatus hebraeus) [TaxId: 6884]} Back     information, alignment and structure
>d1myna_ g.3.7.4 (A:) Drosomycin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nh5a_ g.3.7.1 (A:) Scorpion toxin {Bark scorpion (Centruroides sculpturatus), cse-v5 [TaxId: 218467]} Back     information, alignment and structure