Citrus Sinensis ID: 046837


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------66
MALRNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
cccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHEEEcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccEEEccEEEccEEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHccccccEEEEEEcccccEEcccHHHHHHHHccccccccHHHHHHHHHcccccHHHHcccccHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHcccHHHHHHHHHHHHHcHHccccccHHHHHHHHHHcccccccccEEEEccccccccccEEcccccccccEEEEEccccc
cccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHccccccccccHHHHHccccccHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHHcccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccEEEEEHHHcccEEEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccEEEEEcccccEEcHHHHHHHHHHccccccccHHHHHHHHHHccccHHHEEccccHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccEEEEcccccccccEEEccccccccEEEEEEEcccc
malrndlrmisasDDSAKMMKQVLAnhapaghevdvrpILSIIEDIFRRatatpsnidgvpngkrehmdalhdnkslaafstpeplsdIIHKICCeisckgggDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKqlpeiptgydalkPQFDELNNLIGAMLDLTNCIVEfkqlpsryisndgkamsmdqdhYHAAYWTFRSIVACNSRilsfrglytpsttheleLSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAedlvdgetrTTVQIHVLKKKHVLLLisrpddisqEEILFLSNMYKDlkeskecrivwlpivdgsiDRQQALDKFKNLqkrmpwysiqdpamiqPAVIKYVKEEWKYSKKAIIVSvdpqgrilnqnAFHTLWIWGisafpftaeTEEALwkekpwtlellvgDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLEEISSSitktesshiVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLqkihpgkhcnRLILAgvngaipgtvqcadcgrdmemffmyhccpe
MALRNDLRMISASDDSAKMMKQVLANhapaghevdvrPILSIIEDIFRRatatpsnidgvpnGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRilgkhnrdnIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLisrpddisqEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMpwysiqdpamiQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVAskaqinwgmayvgkknaKKRLEEISssitktesshiviDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
MALRNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYtpstthelelstltYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIhvlkkkhvlllISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLeeisssitktessHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
******************************GHEVDVRPILSIIEDIFRRAT*********************************PLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKK*****************SSHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCC**
*************DDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSN*****************NKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKN*KKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
MALRNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQH*************TAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
************SDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALRNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAAYWTFRSIVACNSRILSFRGLYTPSTTHELELSTLTYKVSNIHVxxxxxxxxxxxxxxxxxxxxxKEYNNLVRILGKHNRDNIKVLRALIYAEDLVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQHGMGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPGKHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query658
359806555698 uncharacterized protein LOC100811452 [Gl 0.986 0.929 0.484 1e-176
359806206705 uncharacterized protein LOC100789215 [Gl 0.986 0.920 0.482 1e-173
449501442698 PREDICTED: uncharacterized LOC101204444 0.975 0.919 0.451 1e-169
297733661708 unnamed protein product [Vitis vinifera] 0.984 0.915 0.469 1e-167
449440983694 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.975 0.925 0.447 1e-167
255547988701 conserved hypothetical protein [Ricinus 0.974 0.914 0.436 1e-161
147821880693 hypothetical protein VITISV_041167 [Viti 0.965 0.916 0.456 1e-159
255572048 809 conserved hypothetical protein [Ricinus 0.983 0.799 0.438 1e-159
255572046 805 conserved hypothetical protein [Ricinus 0.987 0.807 0.429 1e-157
225424590714 PREDICTED: uncharacterized protein LOC10 0.983 0.906 0.440 1e-154
>gi|359806555|ref|NP_001241263.1| uncharacterized protein LOC100811452 [Glycine max] gi|307101640|gb|ADN32785.1| sieve element occlusion c [Glycine max] Back     alignment and taxonomy information
 Score =  623 bits (1607), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 339/699 (48%), Positives = 452/699 (64%), Gaps = 50/699 (7%)

Query: 1   MALRNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGV 60
           M  R + RM S SDDSA M KQV A HAP G E+DV+PIL I+++I  R  A    ++G 
Sbjct: 9   MQQRRERRMFSTSDDSA-MTKQVEATHAPDGREIDVKPILQIVDEILVRFIA--RTVEG- 64

Query: 61  PNGKREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCK--GGGDALATTMALFKTLSS 118
            +  +   DAL    +LA F   + L+ II+KI CE+SCK  GGGDA ++TM L   +SS
Sbjct: 65  -HEVKRDQDALEMTAALAEFDMLDSLAYIINKISCELSCKCSGGGDAHSSTMVLLNYMSS 123

Query: 119 YSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGYDALKPQFDEL 178
           Y+W AK+VL+LAAFAV +GEFWLVAQL  +N+LA SVA+LKQLP+I   + +LKP F+ L
Sbjct: 124 YAWHAKVVLTLAAFAVIFGEFWLVAQLSAENTLAKSVALLKQLPDIAENFMSLKPHFEAL 183

Query: 179 NNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYH-AAYWTFRSIVACNSRILSF 237
             L+ A +D+T CIVEFK+LPS YIS D   MS+   H   A+YW  RSIVAC+S+I S 
Sbjct: 184 IRLVKAAMDVTMCIVEFKELPSEYISEDTPPMSVASTHIPIASYWVIRSIVACSSQIASL 243

Query: 238 RGLYT---PSTTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRIL 294
            G+      STT   ELS+L +KVS+I+  E+L  Q+    Q ID  R I+ ++NL+R+ 
Sbjct: 244 VGMRNESISSTTEAWELSSLAHKVSSIY--EHLKNQLVLCYQYIDDKRHIEAFHNLIRLF 301

Query: 295 GKHNRDNIKVLRALIYAED----LVDGETRTTVQIHVLKKKHVLLLISRPDDISQEEILF 350
              + DN+K+LRALIYA+D    LVDG T++ V + VL++KHVLLLIS   D+SQEEIL 
Sbjct: 302 ETVHVDNMKILRALIYAKDDVLPLVDGTTKSRVSLEVLRRKHVLLLISD-LDLSQEEILV 360

Query: 351 LSNMYKDLKESKEC--RIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVI 408
           L N+YKD +   +    +VW+P+VD +   + +  KF+ LQ  M WYS+ DP +I+P+ I
Sbjct: 361 LDNLYKDARARGDTHYEMVWIPVVDKATWNETSKQKFEYLQSLMAWYSVYDPFIIEPSAI 420

Query: 409 KYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAETEEALWKEKPWTLE 468
           KY+KE W +SK AI+V++DPQG++ + N  H LWIWG  AFPFT+E EE+LWK++ W+LE
Sbjct: 421 KYIKEVWNFSKTAILVALDPQGKLSSPNVVHMLWIWGNLAFPFTSEKEESLWKQEIWSLE 480

Query: 469 LLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGMAYVGKKNAK 528
           LLV  ID T+LEWM + + ICLYGG D  WI KF  +A  VA   +    MAYVGK NAK
Sbjct: 481 LLVDGIDPTVLEWMTDGKLICLYGGEDLEWIEKFTTTAISVAKAGKFELEMAYVGKSNAK 540

Query: 529 KRLEEISSSITKTESSHIVIDATKMWFFWARLERMLYWKLQHG----------------- 571
           +R++++  + T  + S+   + T +WFFW RLE MLY KLQHG                 
Sbjct: 541 ERMQKMIKTFTTRKFSYFWPNVTSIWFFWTRLESMLYSKLQHGRTVENDDIMSQVMTVLS 600

Query: 572 ------------MGKTQETARAKGTAAIDCMEKFHEWQDDALRNGFIQALNNYLQKIHPG 619
                        G T E ARAKG +A+ C++ F +W+D    +G +QA+N+YL K  P 
Sbjct: 601 FDGSDRGWAIFCRGAT-EMARAKGDSALICLQDFDKWKDRIEEDGVVQAMNDYLNKNKPP 659

Query: 620 KHCNRLILAGVNGAIPGTVQCADCGRDMEMFFMYHCCPE 658
            HCNRLIL G  G IP  V CA+CGR ME +FMY CC E
Sbjct: 660 HHCNRLILPGSTGGIPQKVVCAECGRQMEKYFMYRCCVE 698




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359806206|ref|NP_001241461.1| uncharacterized protein LOC100789215 [Glycine max] gi|307101642|gb|ADN32786.1| sieve element occlusion d [Glycine max] Back     alignment and taxonomy information
>gi|449501442|ref|XP_004161368.1| PREDICTED: uncharacterized LOC101204444 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297733661|emb|CBI14908.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440983|ref|XP_004138263.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101204444 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255547988|ref|XP_002515051.1| conserved hypothetical protein [Ricinus communis] gi|223546102|gb|EEF47605.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|147821880|emb|CAN65891.1| hypothetical protein VITISV_041167 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255572048|ref|XP_002526965.1| conserved hypothetical protein [Ricinus communis] gi|223533717|gb|EEF35452.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255572046|ref|XP_002526964.1| conserved hypothetical protein [Ricinus communis] gi|223533716|gb|EEF35451.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|225424590|ref|XP_002282172.1| PREDICTED: uncharacterized protein LOC100261038 [Vitis vinifera] gi|296081390|emb|CBI16823.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query658
TAIR|locus:2084143822 SEOa "sieve element occlusion 0.823 0.659 0.315 8.3e-83
TAIR|locus:2084158740 SEOR1 "Sieve-Element-Occlusion 0.869 0.772 0.310 1.9e-81
TAIR|locus:2008590576 AT1G67790 "AT1G67790" [Arabido 0.317 0.362 0.266 5.6e-39
TAIR|locus:2084143 SEOa "sieve element occlusion a" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 681 (244.8 bits), Expect = 8.3e-83, Sum P(2) = 8.3e-83
 Identities = 189/599 (31%), Positives = 289/599 (48%)

Query:     4 RNDLRMISASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNIDGVPNG 63
             RN   M S SDD   M  +VL  H+P     DV  +LS++ DIF+  +  PS     P  
Sbjct:   128 RNGRPMFSLSDDRV-MADRVLKTHSPDMIFFDVTSLLSVVNDIFK--SHVPSIDSSAPKP 184

Query:    64 KREHMDALHDNKSLAAFSTPEPLSDIIHKICCEISCK--GGGDALA-------------T 108
                  D   D+ S   F+      D+I +I CEI CK   GG++               T
Sbjct:   185 SLVFKDYA-DHTSFETFA------DLIDQISCEIDCKCLHGGESHGMMTSGLHLDSRNTT 237

Query:   109 TMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTGY 168
             T ++   +S Y WDAK+VL L+A AV YG F L+A+    N L  S+A++KQLP I +  
Sbjct:   238 TFSVLSLVSKYRWDAKLVLVLSALAVKYGVFLLLAETHATNQLTKSLALIKQLPSIFSRQ 297

Query:   169 DALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHYHAA-YWTFRSI 227
             +AL  + D+   L+  M+DLT  I++  QLP  +I+    A +   DH   A YW  R +
Sbjct:   298 NALHQRLDKTRILMQDMVDLTTTIIDIYQLPPNHIT---AAFT---DHIPTAVYWIVRCV 351

Query:   228 VACNSRILSFRGLYXXXXXXXXXXXXXXYKVSNIHV-SENLTKQIEFWRQQIDKIRQI-- 284
             + C S I    G                 +VS IH  SE L K   +  +Q  K +    
Sbjct:   352 LICVSHISGASGF-------KQDQIMSFMEVSEIHENSERLRKINAYLLEQFKKSKMTIE 404

Query:   285 -----KEYNNLVRILGKH-NRDNIKVLRALIYAEDLV---DGETRTTVQIXXXXXXXXXX 335
                  +EY  L++      + D +  L  L+   D +    G ++  V I          
Sbjct:   405 EGIIEEEYQELIQTFTTIIHVDVVPPLLRLLRPIDFLYHGAGVSKRRVGINVLTQKHVLL 464

Query:   336 XISRPDDISQEEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWY 395
              IS  ++I ++E+  L ++Y +  + +   I+W+P+ D   +   A  KF+ L   M WY
Sbjct:   465 LISDLENI-EKELYILESLYTEAWQ-QSFEILWVPVQDFWTEADDA--KFEALHMNMRWY 520

Query:   396 SIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQGRILNQNAFHTLWIWGISAFPFTAET 455
              + +P  ++ A I++V+E W +  + I+V++DP+G++++ NAF  +WIW   A PFT   
Sbjct:   521 VLGEPRKLRRAAIRFVREWWGFKNRPILVALDPKGQVMSTNAFPMVWIWQPFAHPFTTAR 580

Query:   456 EEALWKEKPWTLELLVGDIDATILEWMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQI 515
             E  LW E+ W LE L+   D   L  + + ++ICLYGG D  WI+ F +  ++VA  A I
Sbjct:   581 ERDLWSEQEWNLEFLIDGTDPHSLNQLVDGKYICLYGGEDMQWIKNFTSLWRNVAKAANI 640

Query:   516 NWGMAYVGKKNAKKRLXXXXXXXXXXXXXHIVIDATKMWFFWARLERMLYWKLQHGMGK 574
                M YVGK+N K  +             H + D  ++WFFW R+E M  W+ +  M K
Sbjct:   641 QLEMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRVESM--WESKQRMLK 697


GO:0009507 "chloroplast" evidence=ISM
GO:0043621 "protein self-association" evidence=IPI
TAIR|locus:2084158 SEOR1 "Sieve-Element-Occlusion-Related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008590 AT1G67790 "AT1G67790" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 658
PF14576286 SEO_N: Sieve element occlusion N-terminus 100.0
PF14577235 SEO_C: Sieve element occlusion C-terminus 100.0
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 99.9
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.82
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.76
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.74
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.51
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 98.72
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.67
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.61
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.6
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.38
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.37
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 98.37
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.33
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 98.28
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.26
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 98.24
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.23
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 98.14
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.13
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.13
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 98.13
PLN02412167 probable glutathione peroxidase 98.06
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.03
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 98.0
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 97.98
PTZ00256183 glutathione peroxidase; Provisional 97.98
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 97.98
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 97.96
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 97.93
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.93
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 97.92
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 97.91
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 97.88
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.83
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 97.83
PTZ00056199 glutathione peroxidase; Provisional 97.81
PTZ00253199 tryparedoxin peroxidase; Provisional 97.8
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 97.65
PF02630174 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This fam 97.63
PRK13190202 putative peroxiredoxin; Provisional 97.62
PTZ00137261 2-Cys peroxiredoxin; Provisional 97.42
PRK15000200 peroxidase; Provisional 97.39
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 97.37
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 97.3
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 97.25
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 97.18
TIGR02740271 TraF-like TraF-like protein. This protein is relat 97.16
PRK13728181 conjugal transfer protein TrbB; Provisional 97.11
cd02955124 SSP411 TRX domain, SSP411 protein family; members 97.07
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 97.07
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 97.03
PRK13599215 putative peroxiredoxin; Provisional 97.01
PRK13191215 putative peroxiredoxin; Provisional 96.96
PRK13189222 peroxiredoxin; Provisional 96.93
PRK10606183 btuE putative glutathione peroxidase; Provisional 96.87
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 96.64
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 96.52
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 96.34
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 95.96
COG1999207 Uncharacterized protein SCO1/SenC/PrrC, involved i 95.94
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 95.85
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 95.82
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 95.74
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 95.69
PTZ0005198 thioredoxin; Provisional 95.53
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 95.45
PRK10996139 thioredoxin 2; Provisional 95.39
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 95.35
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 95.19
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 95.05
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 94.96
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 94.95
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 94.83
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 94.75
PHA02278103 thioredoxin-like protein 94.73
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 94.69
PRK09381109 trxA thioredoxin; Provisional 94.69
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 94.55
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 94.41
PRK00293571 dipZ thiol:disulfide interchange protein precursor 94.36
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 94.33
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 93.81
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 93.73
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 93.5
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 93.46
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 93.36
cd02958114 UAS UAS family; UAS is a domain of unknown functio 92.92
PTZ00102477 disulphide isomerase; Provisional 92.91
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 92.9
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 92.71
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 92.57
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 92.27
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 91.84
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 91.79
cd0294793 TRX_family TRX family; composed of two groups: Gro 91.75
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 91.33
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 90.95
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 90.86
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 90.54
KOG2792280 consensus Putative cytochrome C oxidase assembly p 89.75
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 89.6
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 89.37
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 88.93
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 88.43
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 87.81
PTZ00443224 Thioredoxin domain-containing protein; Provisional 86.79
cd02962152 TMX2 TMX2 family; composed of proteins similar to 86.0
COG0450194 AhpC Peroxiredoxin [Posttranslational modification 85.94
smart00594122 UAS UAS domain. 85.69
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 85.66
cd02955124 SSP411 TRX domain, SSP411 protein family; members 85.63
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 85.42
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 85.1
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 85.09
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 84.83
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 84.2
PTZ00062204 glutaredoxin; Provisional 84.0
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 83.32
PF00255108 GSHPx: Glutathione peroxidase; InterPro: IPR000889 83.28
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 81.7
KOG0907106 consensus Thioredoxin [Posttranslational modificat 81.57
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 81.55
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 81.22
PTZ00102 477 disulphide isomerase; Provisional 81.16
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 80.47
>PF14576 SEO_N: Sieve element occlusion N-terminus Back     alignment and domain information
Probab=100.00  E-value=8.1e-105  Score=818.42  Aligned_cols=279  Identities=48%  Similarity=0.797  Sum_probs=259.8

Q ss_pred             cccccHHHHHHHHhhcCCCCCccChhHhHHHHHHHHHhhcCCCCCC-CCCCCCCccchhhhccccccccc-CCCCCchhh
Q 046837           12 ASDDSAKMMKQVLANHAPAGHEVDVRPILSIIEDIFRRATATPSNI-DGVPNGKREHMDALHDNKSLAAF-STPEPLSDI   89 (658)
Q Consensus        12 ~sdd~i~~~~~I~~TH~pd~~~~Dv~~Ll~~venIl~~a~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~f-~~le~l~~~   89 (658)
                      +|||++ ||||||+||+||||+|||+|||++||||++||++   ++ ++.....+.+.+++++++.+.++ +++||++++
T Consensus         1 ~~~D~~-ilk~I~~TH~pd~~~~Dv~~Ll~~venIl~~at~---~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~e~l~~~   76 (286)
T PF14576_consen    1 TSDDDQ-ILKQIYATHVPDGRKFDVEPLLHLVENILKRATP---IVGDSIDTVVQKHPEALEDKDYQIEPIASFEPLFYT   76 (286)
T ss_pred             CCcHHH-HHHHHHHhcCCCCCcccHHHHHHHHHHHHHHhhh---hhcchhhhhhhcchhhhhhhhcccchHhhcCchhHH
Confidence            467777 8999999999999999999999999999999988   34 22223344444555566666566 788999999


Q ss_pred             hhhhheeecccC--CCchhhhHHHHHHhhccCcchhHHHHHHHHHHHhhcchhhhhhccCccHHHHHHHHHhCCCCCCCC
Q 046837           90 IHKICCEISCKG--GGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSLANSVAVLKQLPEIPTG  167 (658)
Q Consensus        90 i~~Iscem~ck~--~~~aH~TTm~Il~~Ls~YsWDAK~vLtLAAFAl~YGeFwlL~q~~~~n~LakSlA~Lkqlp~i~~~  167 (658)
                      ||||||||+|||  |+|||+|||+|||+||+|||||||||||||||+||||||||+|+|++||||||||+|||||+|+||
T Consensus        77 i~rIScem~ck~~g~~~aH~TTm~Il~~Ls~YsWDAK~VLtLAAFAl~YGeFwlLaq~~~~n~LakSlA~LkqlP~i~~~  156 (286)
T PF14576_consen   77 IKRISCEMSCKCSGEEDAHQTTMSILNMLSSYSWDAKAVLTLAAFALEYGEFWLLAQIYPTNPLAKSLAILKQLPDILEH  156 (286)
T ss_pred             HHHHHHHheecCCCCchHhHHHHHHHHHhhcCCcHHHHHHHHHHHHHHhhhHHHHhhhcccCHHHHHHHHHhcchhhhhh
Confidence            999999999999  899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCccchHHhHHHHHHHHHhhHHHhcccCCcccccCCCcchhhHHHHH-HHHHHHHHHHHHhhhcccccccc-c-CCC
Q 046837          168 YDALKPQFDELNNLIGAMLDLTNCIVEFKQLPSRYISNDGKAMSMDQDHY-HAAYWTFRSIVACNSRILSFRGL-Y-TPS  244 (658)
Q Consensus       168 ~~~lk~~~~~ln~LVk~m~dV~~cIie~~~L~~~y~~~dvpal~~a~~~I-~~vYW~I~sivac~~qi~~l~~~-~-~~s  244 (658)
                      .+++||||+++|+|||+||||++||+||++||++||++|||+|++|++|| ++|||||||+|||++||++|+++ + +.+
T Consensus       157 ~~~lk~r~~~ln~LVk~mldV~~cIief~~L~~~y~~~Dvpal~~a~~~IPvavYWtI~siVAc~sqI~~lt~~~~e~~~  236 (286)
T PF14576_consen  157 SDSLKPRFDALNNLVKAMLDVTKCIIEFEELPSQYITKDVPALSTALAHIPVAVYWTIRSIVACASQITGLTGMGHEITS  236 (286)
T ss_pred             hhcccchhHHHHHHHHHHHHHHHHHHHHHHcChhhccccchhHHHHHHhCcHHHHHHHHHHHHHHHHHHHHhhccccccc
Confidence            99999999999999999999999999999999999999999999999999 99999999999999999999999 4 467


Q ss_pred             CccchhhchhhhhhhhcccchhHHHHHHHHHHHHHhHhhHHHHHHHHHHhccCCc
Q 046837          245 TTHELELSTLTYKVSNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNR  299 (658)
Q Consensus       245 ~~~~~eLS~l~~Kl~~I~~~~~L~~~l~~c~~~I~~~~~~e~y~~l~~lf~~~~~  299 (658)
                      ++++||||+|++||++|+  +|||+||+.|+||||+   +|+|++|+++|++||+
T Consensus       237 ~~~~~eLS~l~~KL~~I~--~~Lk~qL~~C~~~I~~---~E~y~~l~~lf~t~~~  286 (286)
T PF14576_consen  237 TTEAWELSSLAHKLSNIL--SHLKKQLDLCRQQIEE---IEDYQMLLKLFETPHI  286 (286)
T ss_pred             chhhhHHhhHHHHHHHHH--HHHHHHHHHHHHHHHH---HHHHHHHHHHhhcCCC
Confidence            899999999999999999  9999999999999999   8999999999999974



>PF14577 SEO_C: Sieve element occlusion C-terminus Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>PF02630 SCO1-SenC: SCO1/SenC; InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion] Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>COG0450 AhpC Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PF00255 GSHPx: Glutathione peroxidase; InterPro: IPR000889 Glutathione peroxidase (GSHPx) (1 Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query658
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-08
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 80.3 bits (197), Expect = 1e-15
 Identities = 110/684 (16%), Positives = 217/684 (31%), Gaps = 199/684 (29%)

Query: 32  HEVDVRPILSIIEDIFRRATATPSNIDGVPNGKREHMDALHDNKSLAAFSTPEPLSDIIH 91
           H+   + ILS+ ED F        N D      ++  D        +  S  E +  II 
Sbjct: 14  HQYQYKDILSVFEDAFVD------NFDC-----KDVQDMPK-----SILSKEE-IDHII- 55

Query: 92  KICCEISCKGGGDALATTMALFKTLSSYSWDAKMVLSLAAFAVNYGEFWLVAQLCTQNSL 151
                       DA++ T+ LF TL S   +           +NY   +L++ + T+   
Sbjct: 56  ---------MSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLRINYK--FLMSPIKTEQ-- 102

Query: 152 ANSVAVLKQLPEIPT-GY----DALK---PQFDELN-NLIGAMLDLTNCIVEFKQLPSRY 202
                  +Q P + T  Y    D L      F + N + +   L L   ++E +  P++ 
Sbjct: 103 -------RQ-PSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELR--PAKN 152

Query: 203 ISNDG-----K---AMSMDQDH------YHAAYWTFRSIVACNSRILSFRGLYTPSTTHE 248
           +  DG     K   A+ +   +          +W            L+ +   +P T  E
Sbjct: 153 VLIDGVLGSGKTWVALDVCLSYKVQCKMDFKIFW------------LNLKNCNSPETVLE 200

Query: 249 LELSTLTYKV-----SNIHVSENLTKQIEFWRQQIDKIRQIKEYNNLVRILGKHNRDNI- 302
           + L  L Y++     S    S N+  +I   + ++ ++ + K Y N + +L      N+ 
Sbjct: 201 M-LQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVL-----LNVQ 254

Query: 303 --KVLRAL-IYAEDLVDGETR---TTVQIHVLKKKHVLLLISRPDDISQEEIL-----FL 351
             K   A  +  + L+   TR    T  +      H+  L      ++ +E+      +L
Sbjct: 255 NAKAWNAFNLSCKILL--TTRFKQVTDFLSAATTTHI-SLDHHSMTLTPDEVKSLLLKYL 311

Query: 352 SNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWYSIQDPAMIQPAVIKYV 411
               +DL           P     I                   SI+D      A     
Sbjct: 312 DCRPQDLPRE-VLTT--NPRRLSII-----------------AESIRDG----LATWDN- 346

Query: 412 KEEWKYS-----KKAIIVSVDPQGRILNQNAFHTLWIWGISAFP----FTAETEEALWKE 462
              WK+         I  S++       +  F  L +     FP            +W +
Sbjct: 347 ---WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSV-----FPPSAHIPTILLSLIWFD 398

Query: 463 KPW--TLELLVGDIDATILE-WMKEERFICLYGGNDEAWIRKFRNSAKDVASKAQINWGM 519
                 + ++      +++E   KE   I +     E               K ++    
Sbjct: 399 VIKSDVMVVVNKLHKYSLVEKQPKEST-ISIPSIYLE--------------LKVKLE--- 440

Query: 520 AYVGKKNAKKRLEEISSSITKTESSHIVIDATKMWFFW--------------ARLERMLY 565
               +    + + +  +     +S  ++      +F+                 L RM++
Sbjct: 441 ---NEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVF 497

Query: 566 ----W---KLQHGMGKTQETARAKGTAAIDCMEKFHEW--QDDALRNGFIQALNNYLQK- 615
               +   K++H    T   A       +  ++ +  +   +D      + A+ ++L K 
Sbjct: 498 LDFRFLEQKIRH--DSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKI 555

Query: 616 ---IHPGKHCN--RLILAGVNGAI 634
              +   K+ +  R+ L   + AI
Sbjct: 556 EENLICSKYTDLLRIALMAEDEAI 579


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query658
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.48
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.46
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.44
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.43
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.67
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.06
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.02
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.99
2lrn_A152 Thiol:disulfide interchange protein; structural ge 98.96
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.96
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.92
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.9
3raz_A151 Thioredoxin-related protein; structural genomics, 98.88
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.87
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.82
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 98.79
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 98.76
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.76
4evm_A138 Thioredoxin family protein; structural genomics, n 98.75
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 98.72
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.71
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.68
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 98.67
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.67
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 98.67
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.67
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.67
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 98.66
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 98.66
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 98.66
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.65
3me7_A170 Putative uncharacterized protein; electron transfe 98.65
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.64
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.64
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.63
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 98.63
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.63
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.62
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.61
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 98.61
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.61
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.61
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.61
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 98.59
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.58
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 98.57
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.57
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.57
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 98.57
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.56
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 98.56
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 98.56
2ls5_A159 Uncharacterized protein; structural genomics, unkn 97.97
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.52
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 98.52
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.51
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 98.5
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.5
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 98.47
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 98.47
2l5o_A153 Putative thioredoxin; structural genomics, unknown 98.46
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.44
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 98.42
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 98.42
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 98.42
1psq_A163 Probable thiol peroxidase; structural genomics, NY 98.42
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 98.41
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 98.41
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.41
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 98.4
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 98.39
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.37
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 98.36
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.36
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 98.35
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.35
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.33
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 98.33
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 98.32
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.29
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.29
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.28
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 98.24
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 98.18
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 98.17
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.12
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.11
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.08
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.05
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 97.98
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 97.92
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 97.89
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 97.89
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 97.87
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 97.86
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 97.85
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.83
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.72
3f9u_A172 Putative exported cytochrome C biogenesis-related; 97.69
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 97.61
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 97.54
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.53
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.49
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 97.44
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 97.42
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 97.39
3keb_A224 Probable thiol peroxidase; structural genomics, AP 97.27
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 97.22
2l5l_A136 Thioredoxin; structural genomics, electron transpo 97.21
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 97.2
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.06
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.0
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 96.97
2kuc_A130 Putative disulphide-isomerase; structural genomics 96.9
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 96.89
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.89
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.88
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.87
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.84
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 96.83
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.78
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.78
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 96.77
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.77
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.77
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 96.74
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.71
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.71
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 96.7
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.68
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.67
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 96.65
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.65
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 96.64
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.64
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 96.63
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 96.63
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.62
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 96.61
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 96.58
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.58
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.58
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 96.57
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.56
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 96.54
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 96.53
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 96.52
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.51
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.51
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.5
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 96.48
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 96.44
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.41
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 96.4
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 95.39
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 96.35
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 96.34
3ira_A173 Conserved protein; methanosarcina mazei,structural 96.34
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 96.33
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 96.32
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.31
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 96.28
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 96.24
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 96.22
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.21
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 96.21
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 96.19
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 96.19
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 96.17
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 96.13
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 96.12
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.11
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.11
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 96.11
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 96.1
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.08
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.05
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 95.99
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 95.96
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 95.85
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 95.82
1mek_A120 Protein disulfide isomerase; electron transport, r 95.8
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 95.67
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 95.44
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 95.39
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 95.25
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 95.23
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 95.18
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 95.13
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 94.96
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 94.82
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 94.74
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 94.67
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 94.57
1wmj_A130 Thioredoxin H-type; structural genomics, program f 94.39
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 94.17
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 94.12
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 94.02
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 93.06
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 93.98
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 93.97
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 93.3
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 93.07
2qsi_A137 Putative hydrogenase expression/formation protein; 92.93
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 92.27
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 91.99
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 91.87
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 91.36
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 90.81
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 90.65
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 90.56
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 90.32
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 90.04
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 89.34
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 89.06
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 88.85
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 88.83
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 88.81
1v5n_A89 PDI-like hypothetical protein AT1G60420; DC1 domai 88.46
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 88.21
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 88.05
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 87.8
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 87.17
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 86.64
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 86.6
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 85.73
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 85.71
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 85.05
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 84.91
2lrt_A152 Uncharacterized protein; structural genomics, thio 84.71
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 84.53
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 83.68
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 83.67
2lrn_A152 Thiol:disulfide interchange protein; structural ge 83.4
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 83.01
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 82.66
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 81.74
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 81.66
2yzu_A109 Thioredoxin; redox protein, electron transport, st 81.6
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 81.55
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 81.44
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 81.29
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 81.07
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 80.97
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 80.81
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 80.4
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 80.14
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
Probab=99.48  E-value=3.2e-13  Score=125.79  Aligned_cols=124  Identities=19%  Similarity=0.293  Sum_probs=105.0

Q ss_pred             CCCcEEecccccCcEEEEEEecCCCCCh--HHHHHHHHHHHHhcCCCCeeEEEEecccCCCcchhhHHHHHHhhcCCCce
Q 046837          318 ETRTTVQIHVLKKKHVLLLISRPDDISQ--EEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKRMPWY  395 (658)
Q Consensus       318 ~~~~kV~Is~L~gK~VlLyfSa~~~~~~--~~~~~L~~iY~~lk~~~~fEIVwIpivD~s~~W~dde~~F~~~~~~MPWy  395 (658)
                      .+| .+.++.++||.|+|+|.+. ||++  .+.+.|.++|++++.+.+++||.|+++       ++.+.+..+..+++|+
T Consensus        37 ~~g-~v~l~~~~gk~vll~F~a~-wC~~C~~~~p~l~~l~~~~~~~~~v~vv~v~~d-------~~~~~~~~~~~~~~~~  107 (165)
T 3s9f_A           37 QAD-TADMDSLSGKTVFFYFSAS-WCPPCRGFTPQLVEFYEKHHDSKNFEIILASWD-------EEEDDFNAYYAKMPWL  107 (165)
T ss_dssp             TTE-EECSGGGTTSEEEEEEECT-TCHHHHHHHHHHHHHHHHHTTTTTEEEEEEECC-------CSHHHHHHHHTTCSSE
T ss_pred             CCC-cccHHHcCCCEEEEEEECC-cChhHHHHHHHHHHHHHHhccCCCeEEEEEecC-------CCHHHHHHHHHhCCCc
Confidence            456 8999999999999999999 9976  567789999999987679999999982       3667788999999999


Q ss_pred             eecCCCCCcHHHHHHHHHhhccCCceEEEEECCC-CceeccchHHHHHHh-CCccccCCh
Q 046837          396 SIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQ-GRILNQNAFHTLWIW-GISAFPFTA  453 (658)
Q Consensus       396 AVpf~~~i~~~~~r~ike~f~~~~iP~LVvL~pq-Gkv~~~nA~~mI~~w-G~~AFPFT~  453 (658)
                      .+|+..   ......+.+.|++.++|+++++|++ |+++..++.+.+..- ....||+..
T Consensus       108 ~~~~~~---~~~~~~l~~~~~v~~~Pt~~lid~~~G~iv~~~~~~~~~~d~~~~~fpw~~  164 (165)
T 3s9f_A          108 SIPFAN---RNIVEALTKKYSVESIPTLIGLNADTGDTVTTRARHALTQDPMGEQFPWRD  164 (165)
T ss_dssp             ECCTTC---HHHHHHHHHHTTCCSSSEEEEEETTTCCEEESCHHHHHHHCTTCTTTTCCC
T ss_pred             ccccCc---hhHHHHHHHHcCCCCCCEEEEEeCCCCEEEecccHHHHhhCcccccCCCCC
Confidence            999975   3344778889999999999999998 999999998877654 455688864



>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>1v5n_A PDI-like hypothetical protein AT1G60420; DC1 domain, zinc binding domain, PDI-like protein, structural genomics; NMR {Arabidopsis thaliana} SCOP: g.49.1.3 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query658
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.79
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.68
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.6
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.92
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.9
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.75
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.7
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.67
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.64
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.6
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.58
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.45
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.44
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 98.36
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.14
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 98.06
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 98.01
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 97.84
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.83
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 97.81
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 97.81
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 97.63
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.61
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 97.55
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 97.46
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 97.42
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 97.39
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 97.36
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 97.21
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 97.06
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 96.95
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 96.83
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.63
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 96.48
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 96.41
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.23
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 96.22
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.17
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 96.1
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 95.97
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 95.91
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 95.89
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 95.79
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 95.58
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 95.57
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 95.43
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 95.36
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 95.35
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 95.21
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 95.06
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 95.02
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 94.9
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 94.38
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 94.3
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 94.1
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 93.72
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 93.71
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 93.62
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 93.47
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 93.18
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 91.97
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 91.76
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 91.23
d1hd2a_161 Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606 91.2
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 90.92
d1wjka_100 Thioredoxin-like structure containing protein C330 89.82
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 89.72
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 88.13
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 87.55
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 87.11
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 86.0
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 83.71
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 81.71
d1tp9a1162 Plant peroxiredoxin {Western balsam poplar(Populus 81.33
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Glutathione peroxidase-like
domain: Tryparedoxin II
species: Crithidia fasciculata [TaxId: 5656]
Probab=99.79  E-value=4.5e-19  Score=162.22  Aligned_cols=126  Identities=17%  Similarity=0.326  Sum_probs=111.1

Q ss_pred             cccCCCCcEEecccccCcEEEEEEecCCCCCh--HHHHHHHHHHHHhcCCCCeeEEEEecccCCCcchhhHHHHHHhhcC
Q 046837          314 LVDGETRTTVQIHVLKKKHVLLLISRPDDISQ--EEILFLSNMYKDLKESKECRIVWLPIVDGSIDRQQALDKFKNLQKR  391 (658)
Q Consensus       314 l~~g~~~~kV~Is~L~gK~VlLyfSa~~~~~~--~~~~~L~~iY~~lk~~~~fEIVwIpivD~s~~W~dde~~F~~~~~~  391 (658)
                      +++|+ |.+|++++|+||.|+|+|.|. ||++  .+++.|.++|++.+.+.+||||.|+.+       ++++.++++.++
T Consensus        13 ~l~~~-~~~v~ls~l~GK~vll~FwAt-WC~pC~~~~p~L~~l~~~~~~~~~~~vi~vs~D-------~~~~~~~~~~~~   83 (144)
T d1i5ga_          13 VLKGA-AADIALPSLAGKTVFFYFSAS-WCPPSRAFTPQLIDFYKAHAEKKNFEVMLISWD-------ESAEDFKDYYAK   83 (144)
T ss_dssp             EEETT-EEEEEGGGGTTSEEEEEEECT-TCHHHHHHHHHHHHHHHHHTTTTTEEEEEEECC-------SSHHHHHHHHTT
T ss_pred             hccCC-CCEeeHHHcCCCEEEEEEEec-CCchHhhhhHhHHHHHHHHHhccCcEEEEEecc-------ccHHHHHHHHHh
Confidence            67775 667999999999999999999 9976  578899999999988789999999972       377889999999


Q ss_pred             CCceeecCCCCCcHHHHHHHHHhhccCCceEEEEECCC-CceeccchHHHHHH-hCCccccC
Q 046837          392 MPWYSIQDPAMIQPAVIKYVKEEWKYSKKAIIVSVDPQ-GRILNQNAFHTLWI-WGISAFPF  451 (658)
Q Consensus       392 MPWyAVpf~~~i~~~~~r~ike~f~~~~iP~LVvL~pq-Gkv~~~nA~~mI~~-wG~~AFPF  451 (658)
                      ++|+.+++.+   ..+...|.+.|+++++|++++||++ |+|++.+|++++.+ -+..+||+
T Consensus        84 ~~~~~~~~~d---~~~~~~l~~~y~v~~iPt~~lid~~~G~vi~~~g~~~v~~d~~~~~fpw  142 (144)
T d1i5ga_          84 MPWLALPFED---RKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPW  142 (144)
T ss_dssp             CSSEECCTTC---HHHHHHHHHHTTCCSSSEEEEEETTTCCEEESCHHHHHHHCTTCTTTTC
T ss_pred             CCCCceeeEC---hHHHHHHHHHCCCCCcCEEEEEeCCCCEEEeehhHHHHhhCcccccCCC
Confidence            9999999965   4566778899999999999999996 99999999999876 45778997



>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1hd2a_ c.47.1.10 (A:) Peroxiredoxin 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1tp9a1 c.47.1.10 (A:1-162) Plant peroxiredoxin {Western balsam poplar(Populus trichocarpa) [TaxId: 3694]} Back     information, alignment and structure