Citrus Sinensis ID: 046847


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLKSPKPMPEYCTD
ccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccc
ccHHHHHHHHHHHHHcccccccccEcHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHHHHHHHHcHHHccccccccccccc
MDRKTFGLLFELLcsderlktdsvvFVDEQVCMFLHALAHHvknqtinnrfkhsgeTISRFNSILNGVLELQHILlkspkpmpeyctd
MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHillkspkpmpeyctd
MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLKSPKPMPEYCTD
****TFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILL************
*DRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLK***********
MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLKSPK********
*DRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLKSPK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISRFNSILNGVLELQHILLKSPKPMPEYCTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
147841225185 hypothetical protein VITISV_032219 [Viti 1.0 0.475 0.528 2e-16
147779878 579 hypothetical protein VITISV_027369 [Viti 1.0 0.151 0.528 3e-16
413941984 288 hypothetical protein ZEAMMB73_204913 [Ze 1.0 0.305 0.516 3e-14
307135889 623 retrotransposon protein [Cucumis melo su 1.0 0.141 0.483 8e-14
413950101 445 hypothetical protein ZEAMMB73_878123 [Ze 1.0 0.197 0.505 1e-13
147769233 568 hypothetical protein VITISV_010914 [Viti 1.0 0.154 0.505 4e-13
38346719 535 OSJNBa0086O06.17 [Oryza sativa Japonica 1.0 0.164 0.449 3e-12
222629452 504 hypothetical protein OsJ_15967 [Oryza sa 1.0 0.174 0.449 3e-12
125570642 598 hypothetical protein OsJ_02038 [Oryza sa 1.0 0.147 0.449 4e-12
307136287 657 retrotransposon protein [Cucumis melo su 0.795 0.106 0.535 6e-12
>gi|147841225|emb|CAN62415.1| hypothetical protein VITISV_032219 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 89.7 bits (221), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)

Query: 1  MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR 60
          MDR TF +L  +L +  +LK    V V+E V +FLH LAHHVKN+ I  RF  SGETISR
Sbjct: 6  MDRHTFTMLCSMLRTIGKLKDSKYVDVEEMVALFLHILAHHVKNRVIKFRFLRSGETISR 65

Query: 61 -FNSILNGVLELQHILLKSPKPMPEYCTD 88
           FN++LN V+ LQ +LLK P+P+ E   D
Sbjct: 66 HFNAVLNAVIRLQGVLLKKPEPVSENSID 94




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147779878|emb|CAN65842.1| hypothetical protein VITISV_027369 [Vitis vinifera] Back     alignment and taxonomy information
>gi|413941984|gb|AFW74633.1| hypothetical protein ZEAMMB73_204913 [Zea mays] Back     alignment and taxonomy information
>gi|307135889|gb|ADN33754.1| retrotransposon protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|413950101|gb|AFW82750.1| hypothetical protein ZEAMMB73_878123 [Zea mays] Back     alignment and taxonomy information
>gi|147769233|emb|CAN60760.1| hypothetical protein VITISV_010914 [Vitis vinifera] Back     alignment and taxonomy information
>gi|38346719|emb|CAE04869.2| OSJNBa0086O06.17 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|222629452|gb|EEE61584.1| hypothetical protein OsJ_15967 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|125570642|gb|EAZ12157.1| hypothetical protein OsJ_02038 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|307136287|gb|ADN34114.1| retrotransposon protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
TAIR|locus:2165775 374 AT5G41980 [Arabidopsis thalian 0.806 0.189 0.333 3.1e-06
TAIR|locus:2165775 AT5G41980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 115 (45.5 bits), Expect = 3.1e-06, P = 3.1e-06
 Identities = 24/72 (33%), Positives = 45/72 (62%)

Query:     1 MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR 60
             MD+  F  L +LL +   L+  + + ++ Q+ +FL  + H+++ + +   F +SGETISR
Sbjct:    48 MDKPVFYKLCDLLQTRGLLRHTNRIKIEAQLAIFLFIIGHNLRTRAVQELFCYSGETISR 107

Query:    61 -FNSILNGVLEL 71
              FN++LN V+ +
Sbjct:   108 HFNNVLNAVIAI 119


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.324   0.138   0.414    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       88        88   0.00091  102 3  11 22  0.41    29
                                                     29  0.49    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  526 (56 KB)
  Total size of DFA:  105 KB (2073 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  11.25u 0.10s 11.35t   Elapsed:  00:00:01
  Total cpu time:  11.25u 0.10s 11.35t   Elapsed:  00:00:01
  Start:  Fri May 10 02:31:11 2013   End:  Fri May 10 02:31:12 2013


GO:0005634 "nucleus" evidence=ISM
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 98.74
PF1211682 SpoIIID: Stage III sporulation protein D; InterPro 96.86
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 96.78
KOG4585 326 consensus Predicted transposase [Replication, reco 96.2
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 95.42
PF0829970 Bac_DnaA_C: Bacterial dnaA protein helix-turn-heli 95.13
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 95.08
PRK06030124 hypothetical protein; Provisional 95.05
COG3415138 Transposase and inactivated derivatives [DNA repli 94.36
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.16
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 93.6
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 93.25
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 92.77
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 92.57
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 92.34
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 91.84
PRK00149450 dnaA chromosomal replication initiation protein; R 91.51
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 91.28
smart00351125 PAX Paired Box domain. 90.9
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 90.64
PRK14088440 dnaA chromosomal replication initiation protein; P 90.46
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 90.42
cd00131128 PAX Paired Box domain 89.97
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 89.93
PRK14087450 dnaA chromosomal replication initiation protein; P 89.69
PRK04217110 hypothetical protein; Provisional 89.66
PRK11161235 fumarate/nitrate reduction transcriptional regulat 89.54
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 89.5
PRK14086617 dnaA chromosomal replication initiation protein; P 89.43
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 89.38
PRK09391230 fixK transcriptional regulator FixK; Provisional 89.12
TIGR0253188 yecD_yerC TrpR-related protein YerC/YecD. This mod 89.0
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 88.93
PF1373055 HTH_36: Helix-turn-helix domain 88.87
PRK12422445 chromosomal replication initiation protein; Provis 88.71
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 88.61
PRK09392236 ftrB transcriptional activator FtrB; Provisional 88.31
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 87.43
PRK0138199 Trp operon repressor; Provisional 86.8
PRK09492 315 treR trehalose repressor; Provisional 86.28
PF1334075 DUF4096: Putative transposase of IS4/5 family (DUF 86.19
PRK09639166 RNA polymerase sigma factor SigX; Provisional 85.94
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 85.67
PF1351852 HTH_28: Helix-turn-helix domain 85.54
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 84.85
cd0617155 Sigma70_r4 Sigma70, region (SR) 4 refers to the mo 84.25
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 82.85
TIGR02937158 sigma70-ECF RNA polymerase sigma factor, sigma-70 82.58
TIGR02985161 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba 82.35
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 82.0
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 81.74
COG0593408 DnaA ATPase involved in DNA replication initiation 81.72
PRK09047161 RNA polymerase factor sigma-70; Validated 81.62
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and re 81.56
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 81.45
smart0076060 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix 81.32
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 81.24
PRK09413121 IS2 repressor TnpA; Reviewed 80.78
TIGR0284480 spore_III_D sporulation transcriptional regulator 80.49
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
Probab=98.74  E-value=2e-08  Score=58.10  Aligned_cols=47  Identities=23%  Similarity=0.312  Sum_probs=44.6

Q ss_pred             ccchhHHHHHHHHHhccccchhhhhhhcccccchhHh-HHHHHHHHHH
Q 046847           24 VVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR-FNSILNGVLE   70 (88)
Q Consensus        24 ~v~veE~la~FL~i~~~n~~~r~i~~~F~~S~eTisr-f~~Vl~ai~~   70 (88)
                      .++.|+|+.+.|..+.+|.++++++.+|+.|.+|||| |+++++.+..
T Consensus         2 kLs~~d~lll~L~~LR~~~~~~~La~~FgIs~stvsri~~~~~~~L~~   49 (53)
T PF13613_consen    2 KLSLEDQLLLTLMYLRLNLTFQDLAYRFGISQSTVSRIFHEWIPLLYQ   49 (53)
T ss_pred             CCCHHHHHHHHHHHHHcCCcHhHHhhheeecHHHHHHHHHHHHHHHHH
Confidence            4689999999999999999999999999999999999 9999998865



>PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>KOG4585 consensus Predicted transposase [Replication, recombination and repair] Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PF08299 Bac_DnaA_C: Bacterial dnaA protein helix-turn-helix; InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PRK06030 hypothetical protein; Provisional Back     alignment and domain information
>COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>smart00351 PAX Paired Box domain Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>cd00131 PAX Paired Box domain Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR02531 yecD_yerC TrpR-related protein YerC/YecD Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information
>PRK01381 Trp operon repressor; Provisional Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) Back     alignment and domain information
>PRK09639 RNA polymerase sigma factor SigX; Provisional Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PF13518 HTH_28: Helix-turn-helix domain Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family Back     alignment and domain information
>TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09047 RNA polymerase factor sigma-70; Validated Back     alignment and domain information
>cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 95.23
1jhg_A101 Trp operon repressor; complex (regulatory protein- 94.94
3pvv_A101 Chromosomal replication initiator protein DNAA; he 94.22
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 93.94
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 92.34
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 92.2
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 92.15
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 91.89
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 91.84
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 91.83
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 91.18
3c57_A95 Two component transcriptional regulatory protein; 90.95
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 90.67
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 90.55
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 90.49
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 90.48
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 90.21
3frw_A107 Putative Trp repressor protein; structural genomic 90.1
1ft9_A222 Carbon monoxide oxidation system transcription reg 90.1
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 90.04
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 89.98
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 89.84
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 89.78
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 89.78
3b02_A195 Transcriptional regulator, CRP family; structural 89.52
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 89.31
1u78_A141 TC3 transposase, transposable element TC3 transpos 88.93
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 88.74
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 88.65
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 88.64
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 88.6
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 88.48
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 88.43
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 88.22
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 88.01
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 87.98
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 87.91
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 87.87
2jrt_A95 Uncharacterized protein; solution, structure, NESG 86.6
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 86.36
1iuf_A144 Centromere ABP1 protein; riken structural genomics 86.3
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 85.89
3kor_A119 Possible Trp repressor; putative DNA-binding Trp r 85.88
1s7o_A113 Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP 85.86
1jko_C52 HIN recombinase, DNA-invertase HIN; water-mediated 85.83
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 85.5
2oa4_A101 SIR5; structure, structural genomics, PSI-2, prote 85.36
1xsv_A113 Hypothetical UPF0122 protein SAV1236; helix-turn-h 84.27
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 84.24
2k27_A159 Paired box protein PAX-8; paired domain, solution 84.24
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 83.72
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 83.7
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 83.64
2l0k_A93 Stage III sporulation protein D; SPOIIID, solution 83.43
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 82.63
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 82.32
3t72_q99 RNA polymerase sigma factor RPOD, DNA-directed RN 82.28
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 82.04
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
Probab=95.23  E-value=0.015  Score=36.22  Aligned_cols=47  Identities=17%  Similarity=0.074  Sum_probs=42.3

Q ss_pred             CCccchhHHHHHHHHHhccccchhhhhhhc-ccccchhHh-HHHHHHHH
Q 046847           22 DSVVFVDEQVCMFLHALAHHVKNQTINNRF-KHSGETISR-FNSILNGV   68 (88)
Q Consensus        22 t~~v~veE~la~FL~i~~~n~~~r~i~~~F-~~S~eTisr-f~~Vl~ai   68 (88)
                      ++.+..--|+||+|-.--.+.|...|+..| +++-.||+. .+.+=+.+
T Consensus        27 ~~~i~~aRqiamyL~r~~t~~Sl~~IG~~fggrdHsTV~ha~~ki~~~~   75 (94)
T 1j1v_A           27 SRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLR   75 (94)
T ss_dssp             CHHHHHHHHHHHHHHHHHSCCCHHHHHHHTTSCCHHHHHHHHHHHHHHH
T ss_pred             CchhHHHHHHHHHHHHHHHCcCHHHHHHHhCCCCHHHHHHHHHHHHHHH
Confidence            478889999999999999999999999999 899999999 88876544



>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} Back     alignment and structure
>1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 Back     alignment and structure
>1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure
>1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 95.41
d1i5za169 Catabolite gene activator protein (CAP), C-termina 95.23
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 94.82
d1zyba173 Probable transcription regulator BT4300, C-termina 94.68
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 94.46
d1hlva166 DNA-binding domain of centromere binding protein B 93.27
d1l8qa1110 Chromosomal replication initiation factor DnaA C-t 92.35
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 91.57
d1j1va_94 Chromosomal replication initiation factor DnaA C-t 90.93
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 89.59
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 88.32
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 87.12
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 86.83
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 84.69
d1vz0a193 Putative partitioning protein ParB/Spo0J {Thermus 84.63
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 83.95
d1jhga_101 Trp repressor, TrpR {Escherichia coli [TaxId: 562] 83.35
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 82.72
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 82.54
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 81.92
d1yioa170 Response regulatory protein StyR, C-terminal domai 81.49
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Recombinase DNA-binding domain
domain: HIN recombinase (DNA-binding domain)
species: Synthetic
Probab=95.41  E-value=0.0038  Score=33.36  Aligned_cols=35  Identities=17%  Similarity=0.099  Sum_probs=31.4

Q ss_pred             hhHHHHHHHHHhccccchhhhhhhcccccchhHh-H
Q 046847           27 VDEQVCMFLHALAHHVKNQTINNRFKHSGETISR-F   61 (88)
Q Consensus        27 veE~la~FL~i~~~n~~~r~i~~~F~~S~eTisr-f   61 (88)
                      .+||++-..-+++.+.+..+|+..|+.|..||.| |
T Consensus         7 t~~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~   42 (47)
T d1ijwc_           7 NKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF   42 (47)
T ss_dssp             CHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence            3678888888889999999999999999999988 5



>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure