Citrus Sinensis ID: 046847
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| 147841225 | 185 | hypothetical protein VITISV_032219 [Viti | 1.0 | 0.475 | 0.528 | 2e-16 | |
| 147779878 | 579 | hypothetical protein VITISV_027369 [Viti | 1.0 | 0.151 | 0.528 | 3e-16 | |
| 413941984 | 288 | hypothetical protein ZEAMMB73_204913 [Ze | 1.0 | 0.305 | 0.516 | 3e-14 | |
| 307135889 | 623 | retrotransposon protein [Cucumis melo su | 1.0 | 0.141 | 0.483 | 8e-14 | |
| 413950101 | 445 | hypothetical protein ZEAMMB73_878123 [Ze | 1.0 | 0.197 | 0.505 | 1e-13 | |
| 147769233 | 568 | hypothetical protein VITISV_010914 [Viti | 1.0 | 0.154 | 0.505 | 4e-13 | |
| 38346719 | 535 | OSJNBa0086O06.17 [Oryza sativa Japonica | 1.0 | 0.164 | 0.449 | 3e-12 | |
| 222629452 | 504 | hypothetical protein OsJ_15967 [Oryza sa | 1.0 | 0.174 | 0.449 | 3e-12 | |
| 125570642 | 598 | hypothetical protein OsJ_02038 [Oryza sa | 1.0 | 0.147 | 0.449 | 4e-12 | |
| 307136287 | 657 | retrotransposon protein [Cucumis melo su | 0.795 | 0.106 | 0.535 | 6e-12 |
| >gi|147841225|emb|CAN62415.1| hypothetical protein VITISV_032219 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 89.7 bits (221), Expect = 2e-16, Method: Compositional matrix adjust.
Identities = 47/89 (52%), Positives = 60/89 (67%), Gaps = 1/89 (1%)
Query: 1 MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR 60
MDR TF +L +L + +LK V V+E V +FLH LAHHVKN+ I RF SGETISR
Sbjct: 6 MDRHTFTMLCSMLRTIGKLKDSKYVDVEEMVALFLHILAHHVKNRVIKFRFLRSGETISR 65
Query: 61 -FNSILNGVLELQHILLKSPKPMPEYCTD 88
FN++LN V+ LQ +LLK P+P+ E D
Sbjct: 66 HFNAVLNAVIRLQGVLLKKPEPVSENSID 94
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147779878|emb|CAN65842.1| hypothetical protein VITISV_027369 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|413941984|gb|AFW74633.1| hypothetical protein ZEAMMB73_204913 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|307135889|gb|ADN33754.1| retrotransposon protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|413950101|gb|AFW82750.1| hypothetical protein ZEAMMB73_878123 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|147769233|emb|CAN60760.1| hypothetical protein VITISV_010914 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|38346719|emb|CAE04869.2| OSJNBa0086O06.17 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|222629452|gb|EEE61584.1| hypothetical protein OsJ_15967 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|125570642|gb|EAZ12157.1| hypothetical protein OsJ_02038 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|307136287|gb|ADN34114.1| retrotransposon protein [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| TAIR|locus:2165775 | 374 | AT5G41980 [Arabidopsis thalian | 0.806 | 0.189 | 0.333 | 3.1e-06 |
| TAIR|locus:2165775 AT5G41980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 115 (45.5 bits), Expect = 3.1e-06, P = 3.1e-06
Identities = 24/72 (33%), Positives = 45/72 (62%)
Query: 1 MDRKTFGLLFELLCSDERLKTDSVVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR 60
MD+ F L +LL + L+ + + ++ Q+ +FL + H+++ + + F +SGETISR
Sbjct: 48 MDKPVFYKLCDLLQTRGLLRHTNRIKIEAQLAIFLFIIGHNLRTRAVQELFCYSGETISR 107
Query: 61 -FNSILNGVLEL 71
FN++LN V+ +
Sbjct: 108 HFNNVLNAVIAI 119
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.324 0.138 0.414 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 88 88 0.00091 102 3 11 22 0.41 29
29 0.49 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 526 (56 KB)
Total size of DFA: 105 KB (2073 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 11.25u 0.10s 11.35t Elapsed: 00:00:01
Total cpu time: 11.25u 0.10s 11.35t Elapsed: 00:00:01
Start: Fri May 10 02:31:11 2013 End: Fri May 10 02:31:12 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 98.74 | |
| PF12116 | 82 | SpoIIID: Stage III sporulation protein D; InterPro | 96.86 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 96.78 | |
| KOG4585 | 326 | consensus Predicted transposase [Replication, reco | 96.2 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 95.42 | |
| PF08299 | 70 | Bac_DnaA_C: Bacterial dnaA protein helix-turn-heli | 95.13 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 95.08 | |
| PRK06030 | 124 | hypothetical protein; Provisional | 95.05 | |
| COG3415 | 138 | Transposase and inactivated derivatives [DNA repli | 94.36 | |
| PF04218 | 53 | CENP-B_N: CENP-B N-terminal DNA-binding domain; In | 94.16 | |
| PRK11753 | 211 | DNA-binding transcriptional dual regulator Crp; Pr | 93.6 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 93.25 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 92.77 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 92.57 | |
| PRK10402 | 226 | DNA-binding transcriptional activator YeiL; Provis | 92.34 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 91.84 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 91.51 | |
| PRK13918 | 202 | CRP/FNR family transcriptional regulator; Provisio | 91.28 | |
| smart00351 | 125 | PAX Paired Box domain. | 90.9 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 90.64 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 90.46 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 90.42 | |
| cd00131 | 128 | PAX Paired Box domain | 89.97 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 89.93 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 89.69 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 89.66 | |
| PRK11161 | 235 | fumarate/nitrate reduction transcriptional regulat | 89.54 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 89.5 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 89.43 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 89.38 | |
| PRK09391 | 230 | fixK transcriptional regulator FixK; Provisional | 89.12 | |
| TIGR02531 | 88 | yecD_yerC TrpR-related protein YerC/YecD. This mod | 89.0 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 88.93 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 88.87 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 88.71 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 88.61 | |
| PRK09392 | 236 | ftrB transcriptional activator FtrB; Provisional | 88.31 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 87.43 | |
| PRK01381 | 99 | Trp operon repressor; Provisional | 86.8 | |
| PRK09492 | 315 | treR trehalose repressor; Provisional | 86.28 | |
| PF13340 | 75 | DUF4096: Putative transposase of IS4/5 family (DUF | 86.19 | |
| PRK09639 | 166 | RNA polymerase sigma factor SigX; Provisional | 85.94 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 85.67 | |
| PF13518 | 52 | HTH_28: Helix-turn-helix domain | 85.54 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 84.85 | |
| cd06171 | 55 | Sigma70_r4 Sigma70, region (SR) 4 refers to the mo | 84.25 | |
| PF12840 | 61 | HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ | 82.85 | |
| TIGR02937 | 158 | sigma70-ECF RNA polymerase sigma factor, sigma-70 | 82.58 | |
| TIGR02985 | 161 | Sig70_bacteroi1 RNA polymerase sigma-70 factor, Ba | 82.35 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 82.0 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 81.74 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 81.72 | |
| PRK09047 | 161 | RNA polymerase factor sigma-70; Validated | 81.62 | |
| cd00569 | 42 | HTH_Hin_like Helix-turn-helix domain of Hin and re | 81.56 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 81.45 | |
| smart00760 | 60 | Bac_DnaA_C Bacterial dnaA protein helix-turn-helix | 81.32 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 81.24 | |
| PRK09413 | 121 | IS2 repressor TnpA; Reviewed | 80.78 | |
| TIGR02844 | 80 | spore_III_D sporulation transcriptional regulator | 80.49 |
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
Probab=98.74 E-value=2e-08 Score=58.10 Aligned_cols=47 Identities=23% Similarity=0.312 Sum_probs=44.6
Q ss_pred ccchhHHHHHHHHHhccccchhhhhhhcccccchhHh-HHHHHHHHHH
Q 046847 24 VVFVDEQVCMFLHALAHHVKNQTINNRFKHSGETISR-FNSILNGVLE 70 (88)
Q Consensus 24 ~v~veE~la~FL~i~~~n~~~r~i~~~F~~S~eTisr-f~~Vl~ai~~ 70 (88)
.++.|+|+.+.|..+.+|.++++++.+|+.|.+|||| |+++++.+..
T Consensus 2 kLs~~d~lll~L~~LR~~~~~~~La~~FgIs~stvsri~~~~~~~L~~ 49 (53)
T PF13613_consen 2 KLSLEDQLLLTLMYLRLNLTFQDLAYRFGISQSTVSRIFHEWIPLLYQ 49 (53)
T ss_pred CCCHHHHHHHHHHHHHcCCcHhHHhhheeecHHHHHHHHHHHHHHHHH
Confidence 4689999999999999999999999999999999999 9999998865
|
|
| >PF12116 SpoIIID: Stage III sporulation protein D; InterPro: IPR014208 Members of this entry represent the transcriptional regulator SpoIIID, or stage III sporulation protein D | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >KOG4585 consensus Predicted transposase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PF08299 Bac_DnaA_C: Bacterial dnaA protein helix-turn-helix; InterPro: IPR013159 This entry represents the C-terminal domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PRK06030 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG3415 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere | Back alignment and domain information |
|---|
| >PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >PRK10402 DNA-binding transcriptional activator YeiL; Provisional | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13918 CRP/FNR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >smart00351 PAX Paired Box domain | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >cd00131 PAX Paired Box domain | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PRK09391 fixK transcriptional regulator FixK; Provisional | Back alignment and domain information |
|---|
| >TIGR02531 yecD_yerC TrpR-related protein YerC/YecD | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK09392 ftrB transcriptional activator FtrB; Provisional | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
| >PRK01381 Trp operon repressor; Provisional | Back alignment and domain information |
|---|
| >PRK09492 treR trehalose repressor; Provisional | Back alignment and domain information |
|---|
| >PF13340 DUF4096: Putative transposase of IS4/5 family (DUF4096) | Back alignment and domain information |
|---|
| >PRK09639 RNA polymerase sigma factor SigX; Provisional | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PF13518 HTH_28: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >cd06171 Sigma70_r4 Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs) | Back alignment and domain information |
|---|
| >PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B | Back alignment and domain information |
|---|
| >TIGR02937 sigma70-ECF RNA polymerase sigma factor, sigma-70 family | Back alignment and domain information |
|---|
| >TIGR02985 Sig70_bacteroi1 RNA polymerase sigma-70 factor, Bacteroides expansion family 1 | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09047 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >cd00569 HTH_Hin_like Helix-turn-helix domain of Hin and related proteins, a family of DNA-binding domains unique to bacteria and represented by the Hin protein of Salmonella | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >smart00760 Bac_DnaA_C Bacterial dnaA protein helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >PRK09413 IS2 repressor TnpA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02844 spore_III_D sporulation transcriptional regulator SpoIIID | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| 1j1v_A | 94 | Chromosomal replication initiator protein DNAA, 5' | 95.23 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 94.94 | |
| 3pvv_A | 101 | Chromosomal replication initiator protein DNAA; he | 94.22 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 93.94 | |
| 3dv8_A | 220 | Transcriptional regulator, CRP/FNR family; cyclic | 92.34 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 92.2 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 92.15 | |
| 2fmy_A | 220 | COOA, carbon monoxide oxidation system transcripti | 91.89 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 91.84 | |
| 3ryp_A | 210 | Catabolite gene activator; CAMP receptor protein ( | 91.83 | |
| 2oz6_A | 207 | Virulence factor regulator; winged helix, helix-tu | 91.18 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 90.95 | |
| 3iwz_A | 230 | CAP-like, catabolite activation-like protein; XCC, | 90.67 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 90.55 | |
| 3dkw_A | 227 | DNR protein; CRP-FNR, HTH, beta barrel, dimerizati | 90.49 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 90.48 | |
| 1zyb_A | 232 | Transcription regulator, CRP family; NP_813211.1, | 90.21 | |
| 3frw_A | 107 | Putative Trp repressor protein; structural genomic | 90.1 | |
| 1ft9_A | 222 | Carbon monoxide oxidation system transcription reg | 90.1 | |
| 2zcw_A | 202 | TTHA1359, transcriptional regulator, FNR/CRP famil | 90.04 | |
| 1o5l_A | 213 | Transcriptional regulator, CRP family; TM1171, str | 89.98 | |
| 1pdn_C | 128 | Protein (PRD paired); protein-DNA complex, double | 89.84 | |
| 3la7_A | 243 | Global nitrogen regulator; activator, DNA-binding, | 89.78 | |
| 4ev0_A | 216 | Transcription regulator, CRP family; CAMP binding, | 89.78 | |
| 3b02_A | 195 | Transcriptional regulator, CRP family; structural | 89.52 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 89.31 | |
| 1u78_A | 141 | TC3 transposase, transposable element TC3 transpos | 88.93 | |
| 2bgc_A | 238 | PRFA; bacterial infection, human pathogen, transcr | 88.74 | |
| 3fx3_A | 237 | Cyclic nucleotide-binding protein; helix_TURN_heli | 88.65 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 88.64 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 88.6 | |
| 3kcc_A | 260 | Catabolite gene activator; helix-turn-helix, CAMP, | 88.48 | |
| 1k78_A | 149 | Paired box protein PAX5; paired domain, ETS domain | 88.43 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 88.22 | |
| 3e97_A | 231 | Transcriptional regulator, CRP/FNR family; YP_6044 | 88.01 | |
| 3d0s_A | 227 | Transcriptional regulatory protein; CAMP receptor | 87.98 | |
| 3e6c_C | 250 | CPRK, cyclic nucleotide-binding protein; CPRK, hal | 87.91 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 87.87 | |
| 2jrt_A | 95 | Uncharacterized protein; solution, structure, NESG | 86.6 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 86.36 | |
| 1iuf_A | 144 | Centromere ABP1 protein; riken structural genomics | 86.3 | |
| 2gau_A | 232 | Transcriptional regulator, CRP/FNR family; structu | 85.89 | |
| 3kor_A | 119 | Possible Trp repressor; putative DNA-binding Trp r | 85.88 | |
| 1s7o_A | 113 | Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SP | 85.86 | |
| 1jko_C | 52 | HIN recombinase, DNA-invertase HIN; water-mediated | 85.83 | |
| 2jn6_A | 97 | Protein CGL2762, transposase; GFT PSI-2, protein s | 85.5 | |
| 2oa4_A | 101 | SIR5; structure, structural genomics, PSI-2, prote | 85.36 | |
| 1xsv_A | 113 | Hypothetical UPF0122 protein SAV1236; helix-turn-h | 84.27 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 84.24 | |
| 2k27_A | 159 | Paired box protein PAX-8; paired domain, solution | 84.24 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 83.72 | |
| 2lkp_A | 119 | Transcriptional regulator, ARSR family; symmetric | 83.7 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 83.64 | |
| 2l0k_A | 93 | Stage III sporulation protein D; SPOIIID, solution | 83.43 | |
| 2glo_A | 59 | Brinker CG9653-PA; protein-DNA complex, helix-turn | 82.63 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 82.32 | |
| 3t72_q | 99 | RNA polymerase sigma factor RPOD, DNA-directed RN | 82.28 | |
| 1hlv_A | 131 | CENP-B, major centromere autoantigen B; helix-turn | 82.04 |
| >1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 | Back alignment and structure |
|---|
Probab=95.23 E-value=0.015 Score=36.22 Aligned_cols=47 Identities=17% Similarity=0.074 Sum_probs=42.3
Q ss_pred CCccchhHHHHHHHHHhccccchhhhhhhc-ccccchhHh-HHHHHHHH
Q 046847 22 DSVVFVDEQVCMFLHALAHHVKNQTINNRF-KHSGETISR-FNSILNGV 68 (88)
Q Consensus 22 t~~v~veE~la~FL~i~~~n~~~r~i~~~F-~~S~eTisr-f~~Vl~ai 68 (88)
++.+..--|+||+|-.--.+.|...|+..| +++-.||+. .+.+=+.+
T Consensus 27 ~~~i~~aRqiamyL~r~~t~~Sl~~IG~~fggrdHsTV~ha~~ki~~~~ 75 (94)
T 1j1v_A 27 SRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLR 75 (94)
T ss_dssp CHHHHHHHHHHHHHHHHHSCCCHHHHHHHTTSCCHHHHHHHHHHHHHHH
T ss_pred CchhHHHHHHHHHHHHHHHCcCHHHHHHHhCCCCHHHHHHHHHHHHHHH
Confidence 478889999999999999999999999999 899999999 88876544
|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >3pvv_A Chromosomal replication initiator protein DNAA; helix-turn-helix motif, interacting with DNAA-BOX, DNAA-box; HET: DNA; 2.00A {Mycobacterium tuberculosis} PDB: 3pvp_A* | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... | Back alignment and structure |
|---|
| >2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3frw_A Putative Trp repressor protein; structural genomics, APC21159, PSI-2, P structure initiative; 2.05A {Ruminococcus obeum atcc 29174} PDB: 3g1c_A | Back alignment and structure |
|---|
| >1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 | Back alignment and structure |
|---|
| >2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 | Back alignment and structure |
|---|
| >1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 | Back alignment and structure |
|---|
| >3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* | Back alignment and structure |
|---|
| >4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1u78_A TC3 transposase, transposable element TC3 transposase; transposon DNA, bipartite DNA-binding, HTH- motif, DNA binding protein/DNA complex; 2.69A {Caenorhabditis elegans} SCOP: a.4.1.2 a.4.1.2 | Back alignment and structure |
|---|
| >2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A | Back alignment and structure |
|---|
| >3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} | Back alignment and structure |
|---|
| >1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* | Back alignment and structure |
|---|
| >3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >1iuf_A Centromere ABP1 protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; NMR {Schizosaccharomyces pombe} SCOP: a.4.1.7 a.4.1.7 | Back alignment and structure |
|---|
| >2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 | Back alignment and structure |
|---|
| >3kor_A Possible Trp repressor; putative DNA-binding Trp repressor, TRPR like protein, struc genomics, transcription; 1.60A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1jko_C HIN recombinase, DNA-invertase HIN; water-mediated recognition, protein-DNA complex, A10G mutant, DNA binding protein/DNA complex; 2.24A {Synthetic} SCOP: a.4.1.2 PDB: 1ijw_C* 1jj6_C* 1jj8_C* 1hcr_A 1jkp_C 1jkq_C 1jkr_C | Back alignment and structure |
|---|
| >2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 | Back alignment and structure |
|---|
| >2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 | Back alignment and structure |
|---|
| >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} SCOP: a.4.13.3 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >2l0k_A Stage III sporulation protein D; SPOIIID, solution structure, DNA binding, bacillus subti transcription factor, transcription; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3t72_q RNA polymerase sigma factor RPOD, DNA-directed RN polymerase subunit beta; winged-helix motif, transcription activation, DNA-binding; 4.33A {Escherichia coli} PDB: 1tlh_B | Back alignment and structure |
|---|
| >1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 95.41 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 95.23 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 94.82 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 94.68 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 94.46 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 93.27 | |
| d1l8qa1 | 110 | Chromosomal replication initiation factor DnaA C-t | 92.35 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 91.57 | |
| d1j1va_ | 94 | Chromosomal replication initiation factor DnaA C-t | 90.93 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 89.59 | |
| d2bgca1 | 100 | Listeriolysin regulatory protein PrfA, C-terminal | 88.32 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 87.12 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 86.83 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 84.69 | |
| d1vz0a1 | 93 | Putative partitioning protein ParB/Spo0J {Thermus | 84.63 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 83.95 | |
| d1jhga_ | 101 | Trp repressor, TrpR {Escherichia coli [TaxId: 562] | 83.35 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 82.72 | |
| d2d1ha1 | 109 | Hypothetical transcriptional regulator ST1889 {Sul | 82.54 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 81.92 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 81.49 |
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Recombinase DNA-binding domain domain: HIN recombinase (DNA-binding domain) species: Synthetic
Probab=95.41 E-value=0.0038 Score=33.36 Aligned_cols=35 Identities=17% Similarity=0.099 Sum_probs=31.4
Q ss_pred hhHHHHHHHHHhccccchhhhhhhcccccchhHh-H
Q 046847 27 VDEQVCMFLHALAHHVKNQTINNRFKHSGETISR-F 61 (88)
Q Consensus 27 veE~la~FL~i~~~n~~~r~i~~~F~~S~eTisr-f 61 (88)
.+||++-..-+++.+.+..+|+..|+.|..||.| |
T Consensus 7 t~~q~~~a~~l~~~G~s~~~iA~~~gVSr~TiYry~ 42 (47)
T d1ijwc_ 7 NKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYF 42 (47)
T ss_dssp CHHHHHHHHHHHHTTCCHHHHHHHHTCCHHHHHHHS
T ss_pred CHHHHHHHHHHHHCCCCHHHHHHHHCcCHHHHHhhC
Confidence 3678888888889999999999999999999988 5
|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa1 a.4.12.2 (A:290-399) Chromosomal replication initiation factor DnaA C-terminal domain IV {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j1va_ a.4.12.2 (A:) Chromosomal replication initiation factor DnaA C-terminal domain IV {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1vz0a1 a.4.14.1 (A:116-208) Putative partitioning protein ParB/Spo0J {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhga_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|