Citrus Sinensis ID: 046849

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccEEEEEcccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHccccccHHHHHHccccccccccccccccccccccccEEEEccccccccccccccccEEccccccccccHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHHccc
cccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccccccccccccccccccccccccccccccccccEEEEEEEEEEcccccHHcEEEEEEEEcccEEEEEEEccccccccccccccccccccEEEEEEcccccccccccccccEEEEEEEEEEEEcccHHHHHHcccEEEEcccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccEccccccEcccEEEccccEEEcHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHcHHHHHHHHHHHcccccccccccccHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHcccHcccccccHcccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHccccHHHHHHHHHHcc
msafikledspmFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEafggghddpvsvsiggpVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAeldnlgvpvdvehsvsadgihvggtvSYKNIEAVMRSSATGEVQTIKQGYLLKrssnlrgdwkrRFFVLNSQGTLyyyrnkgiksmgshhhyagsadhnggvfsrfrsrhyrsssfnedslncrtvdlrtsaikmdgedtdLRLCFRiispvktytlqaeteadrmdwTSKITGVIASLLNSDLLQQlrpsakhidgndpfstrdvpslsshcsledevkanksdSVSAILRQipgndlcaecsapdpdwaslNLGILLCIECSGVHRNLGVHISKVRSltldvkvwePTILDLFGSLGNAYCNSIWEGLLLLkdrevdksnttipsvrkpcskdvfHYKEQYINAKYVEKLLVIrdtsdaksrTTSIWEAVKTQNLQEVYRLIVTSDaniinttfddvvgvdsyhhvdntqyseidfhkvkkeenngpagcqrikdsndpgnclqggsllhlACQCGNLVMLELLIQFGadinmrarpsikdggglsSLERAMEMGAITDEELFILLAES
msafikledspmfqKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLtefltvdlhdakeSRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEdlqnsksafekSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSsatgevqtikqgyllkrssnlrgdwkrRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYrsssfnedslncrtvdlrtsaikmdgedtdLRLCFRIispvktytlqaeteadrmdWTSKITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKsnttipsvrkpcskdvFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWeavktqnlQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVfsrfrsrhyrsssfNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
*****************************RCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDA**********IHAY************************************RFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVE*DKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRF**************LNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLL*******************************************AILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHK**********************NCLQGGSLLHLACQCGNLVMLELLIQFGADINMRA*******************GAITDEELFILL***
**AFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDD*VSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQ***********************LQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQV******************AKRIQEFRTQAELDNL************************************************************FFVLNSQGTLYYY*******************************************************************FRIISPVKTYTLQAETEADRMDWTSKITGVI***************************************************SAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKD*************************EQYINAKYVEKLLV*****************VKTQNLQEVYRLIVTSDAN****************************************************NCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAE*
MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRD********TSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
*****KLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELD*****************************AV******GEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGI**************HNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLL**********************************KANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLL***********************VFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDA**********VGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSKITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHHVDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query760 2.2.26 [Sep-21-2011]
Q9SMX5775 ADP-ribosylation factor G yes no 0.978 0.96 0.630 0.0
Q9C6C3776 ADP-ribosylation factor G no no 0.977 0.957 0.635 0.0
Q5W7F2827 ADP-ribosylation factor G no no 0.971 0.892 0.472 0.0
Q9FIT8828 ADP-ribosylation factor G no no 0.932 0.856 0.470 0.0
Q5ZK62 781 Arf-GAP with coiled-coil, no no 0.673 0.655 0.276 9e-53
Q5FVC7770 Arf-GAP with coiled-coil, yes no 0.848 0.837 0.261 1e-52
Q96P50 834 Arf-GAP with coiled-coil, yes no 0.652 0.594 0.280 2e-52
Q6ZQK5770 Arf-GAP with coiled-coil, no no 0.848 0.837 0.261 2e-52
Q15057 778 Arf-GAP with coiled-coil, no no 0.660 0.645 0.275 7e-52
Q6IVG4 778 Arf-GAP with coiled-coil, yes no 0.660 0.645 0.274 9e-52
>sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 Back     alignment and function desciption
 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/788 (63%), Positives = 601/788 (76%), Gaps = 44/788 (5%)

Query: 1   MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALE 60
           M+ FI LEDSPMFQKQ+ S+E +A+ELKDRCQ+LYKG KKF   LG A  G+SAFA  LE
Sbjct: 1   MATFINLEDSPMFQKQVCSLEGTADELKDRCQKLYKGVKKFMGTLGEASKGESAFAACLE 60

Query: 61  AFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAK 120
            FGGG DDP+S+SIGGPVISKFI+A RELA+YKE L SQVEHVL+ RL  F++VDL +AK
Sbjct: 61  EFGGGPDDPISLSIGGPVISKFINALRELASYKEFLCSQVEHVLLERLMNFISVDLQEAK 120

Query: 121 ESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNI 180
           ESR RFDK+ H+YDQ+REKFVSLKKNTR +IVAELEEDL+NSKS FEKSRFNLV++L  I
Sbjct: 121 ESRHRFDKAAHSYDQSREKFVSLKKNTRGEIVAELEEDLENSKSTFEKSRFNLVNSLMTI 180

Query: 181 EAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAK 240
           EAKKKYEFLESISAIMD HLRYFKLG+DLL+++EP++HQ+LTYAQQSKE + +EQD+LA+
Sbjct: 181 EAKKKYEFLESISAIMDAHLRYFKLGYDLLNQLEPFIHQILTYAQQSKEQSKIEQDRLAR 240

Query: 241 RIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYL 300
           RIQEFRTQ+ELD+  +  + E S  A+G  VGG + YKN E    +S T + + IKQGYL
Sbjct: 241 RIQEFRTQSELDSQQLVANAESS-GANGNRVGGNIPYKNTE----TSLTADKEVIKQGYL 295

Query: 301 LKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHY 360
           LKRSS+LR DWKR+FFVL+S G++YYYR  G KSMGSHHHY+GS+DHN GVF RFR+RH 
Sbjct: 296 LKRSSSLRTDWKRKFFVLDSHGSMYYYRTNGNKSMGSHHHYSGSSDHNTGVFGRFRARHN 355

Query: 361 RSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSK 420
           RS S  E SL   T+DLRTS IK+D ED DLRLCFRIISP KTYTLQAE  ADRMDW +K
Sbjct: 356 RSGSLTEGSLGYNTIDLRTSLIKLDAEDMDLRLCFRIISPQKTYTLQAENGADRMDWVNK 415

Query: 421 ITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAIL 480
           IT  I +LLNS  LQQ     +++D ++  S      +S      ++ + N  D VS IL
Sbjct: 416 ITKAIGTLLNSHFLQQ--SPVRYLDKDNSSSAPANAVVSGDQIRHNDSRQNIGDDVSTIL 473

Query: 481 RQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTI 540
           R +PGN+ CAEC+AP+PDWASLNLG+LLCI+CSGVHRNLGVHISKVRSL+LDVKVWEPTI
Sbjct: 474 RGLPGNNACAECNAPEPDWASLNLGVLLCIQCSGVHRNLGVHISKVRSLSLDVKVWEPTI 533

Query: 541 LDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEK 600
           LDLF +LGN YCNS+WEGLL L D   D S  +  SV KPC +D F  KE+YI  KY+EK
Sbjct: 534 LDLFRNLGNVYCNSLWEGLLHLDDDCEDGSALSHASVSKPCPEDSFSVKEKYILGKYLEK 593

Query: 601 LLVIRDTSDAK-SRTTSIWEAVKTQNLQEVYRLIVTS-DANIINTTFDDVVGVDSYHHVD 658
            LVI+D S+A  S  + IWEAV+++N++E+YRLIVT+ D NIINT FDD+  +D+YHH+D
Sbjct: 594 ALVIKDESEANLSAASRIWEAVQSRNIREIYRLIVTTGDVNIINTKFDDITDIDAYHHID 653

Query: 659 NTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQF 718
             + +      VKK  +  P  CQRIK+SN+P +CLQG SLLH+AC  G+ V+LELL+QF
Sbjct: 654 AAEKA------VKKRHD--PTVCQRIKESNEPRSCLQGCSLLHVACHIGDSVLLELLLQF 705

Query: 719 GADINMR---------------------------ARPSIKDGGGLSSLERAMEMGAITDE 751
           GAD+N+R                           ARPSI+D GGLS LERAMEMGAITDE
Sbjct: 706 GADLNIRDYHGRTPLHHCISSGNHKFAKILLRRGARPSIEDDGGLSVLERAMEMGAITDE 765

Query: 752 ELFILLAE 759
           ELF+LLAE
Sbjct: 766 ELFLLLAE 773
Probable GTPase-activating protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 Back     alignment and function description
>sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=2 SV=1 Back     alignment and function description
>sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 Back     alignment and function description
>sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 Back     alignment and function description
>sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
255555567790 gcn4-complementing protein, putative [Ri 0.997 0.959 0.687 0.0
297738263822 unnamed protein product [Vitis vinifera] 0.989 0.914 0.690 0.0
225425094788 PREDICTED: ADP-ribosylation factor GTPas 0.989 0.954 0.690 0.0
297837399775 arf GTPase-activating domain-containing 0.980 0.961 0.645 0.0
30681946775 ADP-ribosylation factor GTPase-activatin 0.978 0.96 0.630 0.0
15219822776 ADP-ribosylation factor GTPase-activatin 0.977 0.957 0.635 0.0
356544659776 PREDICTED: ADP-ribosylation factor GTPas 0.971 0.951 0.626 0.0
356538609776 PREDICTED: ADP-ribosylation factor GTPas 0.971 0.951 0.625 0.0
297849450773 ARF-GAP domain 4 [Arabidopsis lyrata sub 0.975 0.958 0.629 0.0
449449144 890 PREDICTED: ADP-ribosylation factor GTPas 0.968 0.826 0.613 0.0
>gi|255555567|ref|XP_002518820.1| gcn4-complementing protein, putative [Ricinus communis] gi|223542201|gb|EEF43745.1| gcn4-complementing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/790 (68%), Positives = 638/790 (80%), Gaps = 32/790 (4%)

Query: 1   MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALE 60
           M+AFI LEDSPMFQK++ S+E+ +EE+ DRCQRLYKGCK F  ALG AC+ D+ FA++LE
Sbjct: 1   MAAFINLEDSPMFQKEICSLEQISEEMNDRCQRLYKGCKSFMAALGDACNADTTFAESLE 60

Query: 61  AFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAK 120
           AFGGGHDDPVSVSIGGPVISKFI+AFRELATYKELLRSQVEHVLI+RL  F+ VDL +AK
Sbjct: 61  AFGGGHDDPVSVSIGGPVISKFINAFRELATYKELLRSQVEHVLIDRLVHFMDVDLQNAK 120

Query: 121 ESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNI 180
           ESR+R+DK+IHAYDQ+REKFVSLKKNTR +I+ ELEED+QNSKSAFE+SRFNLVSAL NI
Sbjct: 121 ESRKRYDKAIHAYDQSREKFVSLKKNTRGNIIEELEEDMQNSKSAFERSRFNLVSALVNI 180

Query: 181 EAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAK 240
           EAKKKYEFLESISAIMD HLRYFKLG++LLS++EP++HQVLTYAQQSKE+AN EQDKLAK
Sbjct: 181 EAKKKYEFLESISAIMDAHLRYFKLGYELLSQMEPFIHQVLTYAQQSKELANSEQDKLAK 240

Query: 241 RIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYL 300
           RIQEFRTQAE +++    ++E S SADGIHV G  S+KNIEA+M S+A GEV  IKQGYL
Sbjct: 241 RIQEFRTQAEFNSIHASSNIEPSTSADGIHVVGMSSFKNIEAIMHSTAKGEVLIIKQGYL 300

Query: 301 LKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHY 360
           LKRSS LRGDWKRRFFVL+SQGTLYYYRNK  K +G  H    S +HN  VF+RFRSRH 
Sbjct: 301 LKRSSRLRGDWKRRFFVLDSQGTLYYYRNKATKPVGFQHRSTASIEHNSSVFARFRSRHN 360

Query: 361 RSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSK 420
           R+SS  E SL CR +DLRTS IKM+ EDTDLRLCFR+ISP+KTYTLQAE E DRMDW +K
Sbjct: 361 RASSLGEGSLACRIIDLRTSTIKMEAEDTDLRLCFRVISPLKTYTLQAENETDRMDWVNK 420

Query: 421 ITGVIASLLNSDLLQQLRPSAKHIDGNDPFS--TRDVPSLSSHCSLEDEVKANKSDSVSA 478
           ITGVIASLL +  +QQ  P  KH + ND  S  T  V  L  H  L D++K N++D VS+
Sbjct: 421 ITGVIASLLKAHFMQQPYPGMKHPECNDYTSGTTCVVQQLDGHQRLGDDLKVNRADCVSS 480

Query: 479 ILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEP 538
           +LR+IPGNDLCAECSAP+PDWASLNLGIL+CIECSGVHRNLGVHISKVRSLTLDVKVWEP
Sbjct: 481 VLRKIPGNDLCAECSAPEPDWASLNLGILVCIECSGVHRNLGVHISKVRSLTLDVKVWEP 540

Query: 539 TILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYV 598
           T+LDLF +LGNAYCNSIWEGLL+L++  VD+ +    S+ KPC KDV   KE+YI AKYV
Sbjct: 541 TVLDLFHALGNAYCNSIWEGLLMLRNERVDEPSAFASSIEKPCPKDVIFCKEKYIQAKYV 600

Query: 599 EKLLVIRD--TSDAKSRTTSIWEAVKTQNLQEVYRLIVTSDANIINTTFDDVVGVDSYHH 656
           EKLLVIR+   S + S  + IW+AVKT NL+E+YR IV SD NI+NTTFD+VVG++S HH
Sbjct: 601 EKLLVIREASVSGSFSHASGIWQAVKTNNLREIYRHIVISDINIVNTTFDEVVGIESLHH 660

Query: 657 VDNTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLI 716
           V +TQ S+ + H  ++++++ PA C RIKDS DP NCLQG SLLHLAC  GN VMLELL+
Sbjct: 661 VSDTQDSQFNSHTSERKQHD-PATCPRIKDSKDPENCLQGCSLLHLACHYGNPVMLELLL 719

Query: 717 QFGADINMR---------------------------ARPSIKDGGGLSSLERAMEMGAIT 749
           QFGAD+N+R                           A PS++DGGGLS LERAMEMGAIT
Sbjct: 720 QFGADVNLRDFHHRTPLHHCISKGNYPLAKFLLRRGASPSVRDGGGLSVLERAMEMGAIT 779

Query: 750 DEELFILLAE 759
           DEELF++LAE
Sbjct: 780 DEELFVMLAE 789

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297738263|emb|CBI27464.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225425094|ref|XP_002272175.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297837399|ref|XP_002886581.1| arf GTPase-activating domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297332422|gb|EFH62840.1| arf GTPase-activating domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30681946|ref|NP_172556.2| ADP-ribosylation factor GTPase-activating protein AGD4 [Arabidopsis thaliana] gi|75313633|sp|Q9SMX5.2|AGD4_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD4; Short=ARF GAP AGD4; AltName: Full=GCN4-complementing protein 1; AltName: Full=Protein ARF-GAP DOMAIN 4; Short=AtAGD4 gi|6465806|emb|CAB61505.1| GCN4-complementing protein (GCP1) [Arabidopsis thaliana] gi|332190537|gb|AEE28658.1| ADP-ribosylation factor GTPase-activating protein AGD4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15219822|ref|NP_176283.1| ADP-ribosylation factor GTPase-activating protein AGD2 [Arabidopsis thaliana] gi|75308813|sp|Q9C6C3.1|AGD2_ARATH RecName: Full=ADP-ribosylation factor GTPase-activating protein AGD2; Short=ARF GAP AGD2; AltName: Full=Protein ARF-GAP DOMAIN 2; Short=AtAGD2 gi|12323799|gb|AAG51867.1|AC079675_2 GCN4-complementing protein, putative; 3111-9506 [Arabidopsis thaliana] gi|332195620|gb|AEE33741.1| ADP-ribosylation factor GTPase-activating protein AGD2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356544659|ref|XP_003540765.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD2-like [Glycine max] Back     alignment and taxonomy information
>gi|356538609|ref|XP_003537794.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD2-like [Glycine max] Back     alignment and taxonomy information
>gi|297849450|ref|XP_002892606.1| ARF-GAP domain 4 [Arabidopsis lyrata subsp. lyrata] gi|297338448|gb|EFH68865.1| ARF-GAP domain 4 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449449144|ref|XP_004142325.1| PREDICTED: ADP-ribosylation factor GTPase-activating protein AGD4-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
TAIR|locus:2197359775 AGD4 "ARF-GAP domain 4" [Arabi 0.978 0.96 0.620 5e-250
TAIR|locus:2025850776 AGD2 "ARF-GAP domain 2" [Arabi 0.978 0.958 0.622 1.3e-249
TAIR|locus:2183916827 SFC "SCARFACE" [Arabidopsis th 0.576 0.529 0.555 1e-178
UNIPROTKB|D4AAD1 833 Acap3 "Protein Acap3" [Rattus 0.309 0.282 0.368 8.4e-49
ZFIN|ZDB-GENE-070209-274 846 acap3b "ArfGAP with coiled-coi 0.277 0.249 0.388 1.3e-48
RGD|1310711625 Acap3 "ArfGAP with coiled-coil 0.309 0.376 0.368 5e-48
DICTYBASE|DDB_G0276395843 acapB "Arf GTPase activating p 0.163 0.147 0.4 1.6e-47
ZFIN|ZDB-GENE-050208-640 802 acap2 "ArfGAP with coiled-coil 0.275 0.260 0.388 3.3e-47
UNIPROTKB|F1MWF6 820 ACAP3 "Uncharacterized protein 0.309 0.286 0.368 5.7e-47
UNIPROTKB|Q96P50 834 ACAP3 "Arf-GAP with coiled-coi 0.276 0.251 0.391 7.1e-47
TAIR|locus:2197359 AGD4 "ARF-GAP domain 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2408 (852.7 bits), Expect = 5.0e-250, P = 5.0e-250
 Identities = 489/788 (62%), Positives = 592/788 (75%)

Query:     1 MSAFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALE 60
             M+ FI LEDSPMFQKQ+ S+E +A+ELKDRCQ+LYKG KKF   LG A  G+SAFA  LE
Sbjct:     1 MATFINLEDSPMFQKQVCSLEGTADELKDRCQKLYKGVKKFMGTLGEASKGESAFAACLE 60

Query:    61 AFGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAK 120
              FGGG DDP+S+SIGGPVISKFI+A RELA+YKE L SQVEHVL+ RL  F++VDL +AK
Sbjct:    61 EFGGGPDDPISLSIGGPVISKFINALRELASYKEFLCSQVEHVLLERLMNFISVDLQEAK 120

Query:   121 ESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNI 180
             ESR RFDK+ H+YDQ+REKFVSLKKNTR +IVAELEEDL+NSKS FEKSRFNLV++L  I
Sbjct:   121 ESRHRFDKAAHSYDQSREKFVSLKKNTRGEIVAELEEDLENSKSTFEKSRFNLVNSLMTI 180

Query:   181 EAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAK 240
             EAKKKYEFLESISAIMD HLRYFKLG+DLL+++EP++HQ+LTYAQQSKE + +EQD+LA+
Sbjct:   181 EAKKKYEFLESISAIMDAHLRYFKLGYDLLNQLEPFIHQILTYAQQSKEQSKIEQDRLAR 240

Query:   241 RIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYL 300
             RIQEFRTQ+ELD+  +  + E S  A+G  VGG + YKN E    +S T + + IKQGYL
Sbjct:   241 RIQEFRTQSELDSQQLVANAESS-GANGNRVGGNIPYKNTE----TSLTADKEVIKQGYL 295

Query:   301 LKRSSNLRGDWKRRFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVXXXXXXXXX 360
             LKRSS+LR DWKR+FFVL+S G++YYYR  G KSMGSHHHY+GS+DHN GV         
Sbjct:   296 LKRSSSLRTDWKRKFFVLDSHGSMYYYRTNGNKSMGSHHHYSGSSDHNTGVFGRFRARHN 355

Query:   361 XXXXXNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPVKTYTLQAETEADRMDWTSK 420
                   E SL   T+DLRTS IK+D ED DLRLCFRIISP KTYTLQAE  ADRMDW +K
Sbjct:   356 RSGSLTEGSLGYNTIDLRTSLIKLDAEDMDLRLCFRIISPQKTYTLQAENGADRMDWVNK 415

Query:   421 ITGVIASLLNSDLLQQLRPSAKHIDGNDPFSTRDVPSLSSHCSLEDEVKANKSDSVSAIL 480
             IT  I +LLNS  LQQ  P  +++D ++  S      +S      ++ + N  D VS IL
Sbjct:   416 ITKAIGTLLNSHFLQQ-SP-VRYLDKDNSSSAPANAVVSGDQIRHNDSRQNIGDDVSTIL 473

Query:   481 RQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTI 540
             R +PGN+ CAEC+AP+PDWASLNLG+LLCI+CSGVHRNLGVHISKVRSL+LDVKVWEPTI
Sbjct:   474 RGLPGNNACAECNAPEPDWASLNLGVLLCIQCSGVHRNLGVHISKVRSLSLDVKVWEPTI 533

Query:   541 LDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEK 600
             LDLF +LGN YCNS+WEGLL L D   D S  +  SV KPC +D F  KE+YI  KY+EK
Sbjct:   534 LDLFRNLGNVYCNSLWEGLLHLDDDCEDGSALSHASVSKPCPEDSFSVKEKYILGKYLEK 593

Query:   601 LLVIRDTSDAK-SRTTSIWEAVKTQNLQEVYRLIVTS-DANIINTTFDDVVGVDSYHHVD 658
              LVI+D S+A  S  + IWEAV+++N++E+YRLIVT+ D NIINT FDD+  +D+YHH+D
Sbjct:   594 ALVIKDESEANLSAASRIWEAVQSRNIREIYRLIVTTGDVNIINTKFDDITDIDAYHHID 653

Query:   659 NTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQF 718
               + +      VKK  +  P  CQRIK+SN+P +CLQG SLLH+AC  G+ V+LELL+QF
Sbjct:   654 AAEKA------VKKRHD--PTVCQRIKESNEPRSCLQGCSLLHVACHIGDSVLLELLLQF 705

Query:   719 GADINMR---------------------------ARPSIKDGGGLSSLERAMEMGAITDE 751
             GAD+N+R                           ARPSI+D GGLS LERAMEMGAITDE
Sbjct:   706 GADLNIRDYHGRTPLHHCISSGNHKFAKILLRRGARPSIEDDGGLSVLERAMEMGAITDE 765

Query:   752 ELFILLAE 759
             ELF+LLAE
Sbjct:   766 ELFLLLAE 773
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008060 "ARF GTPase activator activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0032312 "regulation of ARF GTPase activity" evidence=IEA
TAIR|locus:2025850 AGD2 "ARF-GAP domain 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2183916 SFC "SCARFACE" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|D4AAD1 Acap3 "Protein Acap3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070209-274 acap3b "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1310711 Acap3 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0276395 acapB "Arf GTPase activating protein B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-640 acap2 "ArfGAP with coiled-coil, ankyrin repeat and PH domains 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWF6 ACAP3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96P50 ACAP3 "Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SMX5AGD4_ARATHNo assigned EC number0.63070.97890.96yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
cd07606202 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (B 5e-98
smart00105119 smart00105, ArfGap, Putative GTP-ase activating pr 1e-43
pfam01412117 pfam01412, ArfGap, Putative GTPase activating prot 1e-41
cd07307194 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain 4e-31
cd1325098 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin 3e-30
smart00721239 smart00721, BAR, BAR domain 5e-30
COG5347319 COG5347, COG5347, GTPase-activating protein that r 1e-26
cd07603200 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) 6e-15
PLN03114 395 PLN03114, PLN03114, ADP-ribosylation factor GTPase 4e-13
cd07638200 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) 6e-13
smart00233102 smart00233, PH, Pleckstrin homology domain 2e-12
pfam00169101 pfam00169, PH, PH domain 9e-11
cd07601215 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) d 2e-10
cd13276117 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin 2e-10
cd07637200 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) 3e-10
cd0082192 cd00821, PH, Pleckstrin homology (PH) domain 1e-09
cd07634207 cd07634, BAR_GAP10-like, The Bin/Amphiphysin/Rvs ( 1e-08
cd1328296 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology 2e-08
cd07635207 cd07635, BAR_GRAF2, The Bin/Amphiphysin/Rvs (BAR) 2e-07
cd07631215 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) 2e-07
cd13255110 cd13255, PH_TAAP2-like, Tandem PH-domain-containin 6e-07
cd07602207 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysi 7e-07
cd07639200 cd07639, BAR_ACAP1, The Bin/Amphiphysin/Rvs (BAR) 7e-07
cd07636207 cd07636, BAR_GRAF, The Bin/Amphiphysin/Rvs (BAR) d 2e-06
pfam03114230 pfam03114, BAR, BAR domain 2e-06
cd1057396 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin 4e-06
cd13296111 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P 7e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 8e-06
cd01265101 cd01265, PH_TBC1D2A, TBC1 domain family member 2A 1e-05
cd13248104 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate 2e-05
cd13215130 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 2e-05
cd07641215 cd07641, BAR_ASAP1, The Bin/Amphiphysin/Rvs (BAR) 3e-05
cd01250114 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat 3e-05
cd13265108 cd13265, PH_evt, Evectin Pleckstrin homology (PH) 6e-05
cd07604215 cd07604, BAR_ASAPs, The Bin/Amphiphysin/Rvs (BAR) 6e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 7e-05
cd1328499 cd13284, PH_OSBP_ORP4, Human Oxysterol binding pro 7e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 9e-05
cd13273110 cd13273, PH_SWAP-70, Switch-associated protein-70 9e-05
cd07633207 cd07633, BAR_OPHN1, The Bin/Amphiphysin/Rvs (BAR) 1e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-04
cd13380106 cd13380, PH_Skap1, Src kinase-associated phosphopr 4e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-04
cd13271114 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 5e-04
cd13302109 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin 5e-04
cd01235106 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als 6e-04
cd13251108 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin 6e-04
cd13277111 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) P 7e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.001
cd13263114 cd13263, PH_RhoGap25-like, Rho GTPase activating p 0.001
cd13308113 cd13308, PH_3BP2, SH3 domain-binding protein 2 Ple 0.001
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
cd13247125 cd13247, BAR-PH_APPL, Adaptor protein containing P 0.002
cd01252118 cd01252, PH_GRP1-like, General Receptor for Phosph 0.002
cd13301108 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin 0.002
cd1331695 cd13316, PH_Boi, Boi family Pleckstrin homology do 0.002
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.003
cd01251105 cd01251, PH2_ADAP, ArfGAP with dual PH domains Ple 0.003
>gnl|CDD|153290 cd07606, BAR_SFC_plant, The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information 
 Score =  301 bits (772), Expect = 5e-98
 Identities = 113/202 (55%), Positives = 158/202 (78%)

Query: 15  KQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGGHDDPVSVSI 74
           KQL  +E SA+EL+DR  +LYKGC+K+ +ALG A  GDSAFA++LE FGGGHDDP+SV++
Sbjct: 1   KQLQELEGSADELRDRSLKLYKGCRKYRDALGEAYDGDSAFAESLEEFGGGHDDPISVAV 60

Query: 75  GGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYD 134
           GGPV++KF SA RE+ +YKE+LRSQVEH+L +RL +F   DL + K++RRRFDK+   Y+
Sbjct: 61  GGPVMTKFTSALREIGSYKEVLRSQVEHMLNDRLAQFADTDLQEVKDARRRFDKASLDYE 120

Query: 135 QAREKFVSLKKNTRDDIVAELEEDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISA 194
           QAR KF+SL K+ + +I+A  EEDL  ++SAFE +RF+L++ L   +A+K+ EFLE +S 
Sbjct: 121 QARSKFLSLTKDAKPEILAAAEEDLGTTRSAFETARFDLMNRLHAADARKRVEFLERLSG 180

Query: 195 IMDVHLRYFKLGFDLLSKIEPY 216
            MD HL +FK G++LL ++EPY
Sbjct: 181 SMDAHLAFFKSGYELLRQLEPY 202

BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions including organelle biogenesis, membrane trafficking or remodeling, and cell division and migration. The plant protein SCARFACE (SFC), also called VAscular Network 3 (VAN3), is a plant ACAP (ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein), an Arf GTPase Activating Protein (GAP) that plays a role in the trafficking of auxin efflux regulators from the plasma membrane to the endosome. It is required for the normal vein patterning in leaves. SCF contains an N-terminal BAR domain, followed by a Pleckstrin Homology (PH) domain, an Arf GAP domain, and C-terminal ankyrin (ANK) repeats. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 202
>gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf Back     alignment and domain information
>gnl|CDD|153271 cd07307, BAR, The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|214787 smart00721, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|153287 cd07603, BAR_ACAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>gnl|CDD|153322 cd07638, BAR_ACAP2, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information
>gnl|CDD|153285 cd07601, BAR_APPL, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain Back     alignment and domain information
>gnl|CDD|153321 cd07637, BAR_ACAP3, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153318 cd07634, BAR_GAP10-like, The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain containing, family H (with MyTH4 domain) members 1 and 2 (PLEKHH1) PH domain, repeat 1 Back     alignment and domain information
>gnl|CDD|153319 cd07635, BAR_GRAF2, The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>gnl|CDD|153315 cd07631, BAR_APPL1, The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153286 cd07602, BAR_RhoGAP_OPHN1-like, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|153323 cd07639, BAR_ACAP1, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|153320 cd07636, BAR_GRAF, The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>gnl|CDD|145973 pfam03114, BAR, BAR domain Back     alignment and domain information
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|153325 cd07641, BAR_ASAP1, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153288 cd07604, BAR_ASAPs, The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and OSBP-related protein 4 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|153317 cd07633, BAR_OPHN1, The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2 Pleckstrin homology (PH) domain, C-terminal repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain Back     alignment and domain information
>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH domain Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167 (BAR)-Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 Back     alignment and domain information
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology (PH) domain, repeat 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
KOG0521785 consensus Putative GTPase activating proteins (GAP 100.0
KOG0705749 consensus GTPase-activating protein Centaurin gamm 100.0
KOG1451 812 consensus Oligophrenin-1 and related Rho GTPase-ac 100.0
cd07606202 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain 100.0
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 100.0
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 100.0
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 100.0
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 100.0
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07632215 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 100.0
KOG0703287 consensus Predicted GTPase-activating protein [Sig 100.0
cd07641215 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
PF01412116 ArfGap: Putative GTPase activating protein for Arf 100.0
cd07642215 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07640213 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
smart00105112 ArfGap Putative GTP-ase activating proteins for th 99.98
cd07609214 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domai 99.97
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 99.97
COG5347319 GTPase-activating protein that regulates ARFs (ADP 99.96
PLN03119 648 putative ADP-ribosylation factor GTPase-activating 99.95
PLN03131 705 hypothetical protein; Provisional 99.95
PLN03114 395 ADP-ribosylation factor GTPase-activating protein 99.92
KOG0704386 consensus ADP-ribosylation factor GTPase activator 99.91
KOG0706 454 consensus Predicted GTPase-activating protein [Sig 99.91
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 99.8
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.78
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 99.78
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 99.78
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 99.77
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.74
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 99.74
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 99.73
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 99.73
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 99.72
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 99.71
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.7
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 99.7
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 99.68
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 99.66
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.66
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 99.65
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 99.63
smart00721239 BAR BAR domain. 99.62
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 99.62
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.62
PHA02743166 Viral ankyrin protein; Provisional 99.62
PHA02741169 hypothetical protein; Provisional 99.6
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 99.6
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 99.59
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 99.59
PHA02791 284 ankyrin-like protein; Provisional 99.59
cd07608192 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) dom 99.58
PHA02736154 Viral ankyrin protein; Provisional 99.57
PHA02884 300 ankyrin repeat protein; Provisional 99.57
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 99.56
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 99.56
PHA02878 477 ankyrin repeat protein; Provisional 99.55
PHA02791284 ankyrin-like protein; Provisional 99.55
KOG0508 615 consensus Ankyrin repeat protein [General function 99.53
PHA02875 413 ankyrin repeat protein; Provisional 99.53
PHA02859209 ankyrin repeat protein; Provisional 99.52
KOG0508 615 consensus Ankyrin repeat protein [General function 99.52
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 99.51
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.51
PHA02874 434 ankyrin repeat protein; Provisional 99.51
PHA02859209 ankyrin repeat protein; Provisional 99.51
PHA02795 437 ankyrin-like protein; Provisional 99.5
KOG0930395 consensus Guanine nucleotide exchange factor Cytoh 99.5
PHA02874 434 ankyrin repeat protein; Provisional 99.5
PF1540989 PH_8: Pleckstrin homology domain 99.48
PHA02946 446 ankyin-like protein; Provisional 99.48
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 99.48
PHA02875 413 ankyrin repeat protein; Provisional 99.48
PHA02878 477 ankyrin repeat protein; Provisional 99.47
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.47
PHA03095 471 ankyrin-like protein; Provisional 99.47
PHA03100 480 ankyrin repeat protein; Provisional 99.47
KOG0514452 consensus Ankyrin repeat protein [General function 99.46
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.46
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 99.45
PHA02798 489 ankyrin-like protein; Provisional 99.45
cd07594229 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom 99.45
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.44
PHA02946 446 ankyin-like protein; Provisional 99.44
PHA02876 682 ankyrin repeat protein; Provisional 99.43
PHA02989 494 ankyrin repeat protein; Provisional 99.42
PHA02989 494 ankyrin repeat protein; Provisional 99.4
cd07593215 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom 99.4
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.39
PHA03100 480 ankyrin repeat protein; Provisional 99.39
cd0122099 PH_CDEP Chondrocyte-derived ezrin-like domain cont 99.39
PHA03095 471 ankyrin-like protein; Provisional 99.38
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 99.38
PHA02917 661 ankyrin-like protein; Provisional 99.38
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.37
cd07615223 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do 99.37
cd07592223 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom 99.37
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.36
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.36
PHA02876 682 ankyrin repeat protein; Provisional 99.36
PHA02798 489 ankyrin-like protein; Provisional 99.35
cd07614223 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do 99.35
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 99.35
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.35
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.34
KOG0510 929 consensus Ankyrin repeat protein [General function 99.34
PHA02741169 hypothetical protein; Provisional 99.34
cd07595244 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) 99.34
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 99.34
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 99.33
cd07616229 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do 99.33
KOG0510 929 consensus Ankyrin repeat protein [General function 99.33
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.33
KOG0514452 consensus Ankyrin repeat protein [General function 99.32
PHA02795 437 ankyrin-like protein; Provisional 99.32
PHA02792 631 ankyrin-like protein; Provisional 99.32
PHA02917 661 ankyrin-like protein; Provisional 99.31
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.31
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.31
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.31
cd01237106 Unc112 Unc-112 pleckstrin homology (PH) domain. Un 99.3
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.29
PHA02884 300 ankyrin repeat protein; Provisional 99.27
cd07613223 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do 99.26
PHA02730 672 ankyrin-like protein; Provisional 99.26
cd07618246 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of 99.25
PHA02743166 Viral ankyrin protein; Provisional 99.25
cd07617220 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do 99.25
PHA02730 672 ankyrin-like protein; Provisional 99.25
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 99.22
cd07619248 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of 99.21
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.21
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.2
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.2
PHA02792 631 ankyrin-like protein; Provisional 99.19
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.16
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.15
PHA02736154 Viral ankyrin protein; Provisional 99.13
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 99.1
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 99.1
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.09
KOG4424623 consensus Predicted Rho/Rac guanine nucleotide exc 99.06
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.05
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.04
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.04
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 99.03
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.03
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.01
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.01
cd07600242 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of 99.01
KOG0702 524 consensus Predicted GTPase-activating protein [Sig 99.0
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.0
cd01256110 PH_dynamin Dynamin pleckstrin homology (PH) domain 98.97
cd01218104 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain 98.96
cd07620257 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.93
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.93
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 98.91
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 98.91
cd07591224 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o 98.89
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 98.88
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 98.87
cd07588211 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma 98.85
PF1360630 Ank_3: Ankyrin repeat 98.84
PF08397219 IMD: IRSp53/MIM homology domain; InterPro: IPR0136 98.84
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.83
cd07599216 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o 98.82
cd01234117 PH_CADPS CADPS (Ca2+-dependent activator protein) 98.82
cd07598211 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of 98.8
KOG1118366 consensus Lysophosphatidic acid acyltransferase en 98.79
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 98.71
PF06456229 Arfaptin: Arfaptin-like domain; InterPro: IPR01050 98.7
cd07660201 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain 98.69
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 98.68
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.67
cd00011203 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do 98.67
cd07611211 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) 98.64
cd07612211 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B 98.62
KOG0515 752 consensus p53-interacting protein 53BP/ASPP, conta 98.62
cd07659215 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.61
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 98.6
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.59
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 98.58
cd01261112 PH_SOS Son of Sevenless (SOS) Pleckstrin homology 98.56
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.55
KOG10901732 consensus Predicted dual-specificity phosphatase [ 98.53
PF14593104 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. 98.51
cd01242112 PH_ROK Rok (Rho- associated kinase) pleckstrin hom 98.45
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 98.43
cd01243122 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin 98.42
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 98.4
cd07624200 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o 98.39
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 98.38
cd01259114 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr 98.36
cd07628185 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of 98.36
PF10455289 BAR_2: Bin/amphiphysin/Rvs domain for vesicular tr 98.34
cd07605223 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp5 98.3
cd01239117 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom 98.28
KOG0522 560 consensus Ankyrin repeat protein [General function 98.27
cd07623224 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.25
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 98.24
cd07664234 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S 98.21
KOG3725375 consensus SH3 domain protein SH3GLB [Signal transd 98.2
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.2
cd07589195 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of 98.2
KOG3771460 consensus Amphiphysin [Intracellular trafficking, 98.14
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.11
cd07661204 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of 98.11
PF06730219 FAM92: FAM92 protein; InterPro: IPR009602 This fam 98.08
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.07
cd07665234 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S 98.05
KOG2059800 consensus Ras GTPase-activating protein [Signal tr 98.01
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.0
KOG36401116 consensus Actin binding protein Anillin [Cell cycl 97.99
KOG3751622 consensus Growth factor receptor-bound proteins (G 97.98
KOG2384 223 consensus Major histocompatibility complex protein 97.9
KOG0932774 consensus Guanine nucleotide exchange factor EFA6 97.89
cd07622201 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.86
cd07630198 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain 97.84
PTZ00267478 NIMA-related protein kinase; Provisional 97.84
cd07645226 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as 97.82
cd07644215 I-BAR_IMD_BAIAP2L2 Inverse (I)-BAR, also known as 97.78
cd07629187 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of 97.76
cd07646232 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as th 97.75
cd07621219 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of 97.73
KOG0522 560 consensus Ankyrin repeat protein [General function 97.71
cd07662218 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.7
cd0126289 PH_PDK1 3-Phosphoinositide dependent protein kinas 97.69
cd07667240 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of 97.68
KOG1739 611 consensus Serine/threonine protein kinase GPBP [Si 97.63
cd07663218 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.62
cd07607209 BAR_SH3P_plant The Bin/Amphiphysin/Rvs (BAR) domai 97.51
cd01226100 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin 97.5
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.48
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 97.48
cd07625230 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of 97.46
cd01240116 PH_beta-ARK Beta adrenergic receptor kinase 1(beta 97.4
cd0122297 PH_clg Clg (common-site lymphoma/leukemia guanine 97.37
KOG0783 1267 consensus Uncharacterized conserved protein, conta 97.36
KOG3876341 consensus Arfaptin and related proteins [Signal tr 97.35
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 97.31
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.29
cd07666243 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S 97.29
cd07643231 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the I 97.29
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 97.28
PLN02866 1068 phospholipase D 97.28
PF1360630 Ank_3: Ankyrin repeat 97.27
cd01224109 PH_Collybistin Collybistin pleckstrin homology (PH 97.26
PTZ00283496 serine/threonine protein kinase; Provisional 97.21
KOG3723851 consensus PH domain protein Melted [Signal transdu 97.16
PF12814123 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin 97.16
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 97.06
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 97.03
PLN00188 719 enhanced disease resistance protein (EDR2); Provis 97.02
KOG3651429 consensus Protein kinase C, alpha binding protein 96.99
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.99
cd07658239 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin 96.94
cd07626199 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain 96.89
cd07674261 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A 96.86
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 96.77
cd07648261 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am 96.72
KOG0511 516 consensus Ankyrin repeat protein [General function 96.7
cd01221125 PH_ephexin Ephexin Pleckstrin homology (PH) domain 96.65
cd07610191 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or 96.61
KOG35311036 consensus Rho guanine nucleotide exchange factor C 96.5
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 96.45
KOG0511 516 consensus Ankyrin repeat protein [General function 96.42
cd01223116 PH_Vav Vav pleckstrin homology (PH) domain. Vav pl 96.42
cd07673269 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A 96.36
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 96.35
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 96.34
cd07675252 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/ 96.29
cd07657237 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin 96.24
cd07650228 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and 96.22
cd07676253 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A 96.14
cd07597246 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of S 96.13
KOG2505 591 consensus Ankyrin repeat protein [General function 95.99
cd01232114 PH_TRIO Trio pleckstrin homology (PH) domain. Trio 95.94
cd01225111 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- 95.92
KOG1117 1186 consensus Rho- and Arf-GTPase activating protein A 95.88
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 95.88
PF10456237 BAR_3_WASP_bdg: WASP-binding domain of Sorting nex 95.65
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 95.55
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 95.49
PF15406112 PH_6: Pleckstrin homology domain 95.37
cd07649233 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am 95.36
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 95.22
KOG0520 975 consensus Uncharacterized conserved protein, conta 95.16
PF15404185 PH_4: Pleckstrin homology domain 95.09
PF15408104 PH_7: Pleckstrin homology domain 95.04
KOG3543 1218 consensus Ca2+-dependent activator protein [Signal 94.98
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 94.97
KOG2273503 consensus Membrane coat complex Retromer, subunit 94.86
cd0122896 PH_BCR-related BCR (breakpoint cluster region)-rel 94.85
KOG2384 223 consensus Major histocompatibility complex protein 94.7
cd07680258 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin 94.41
cd01231107 PH_Lnk LNK-family Pleckstrin homology (PH) domain. 94.39
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 93.97
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 93.87
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 93.81
cd07652234 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Am 93.81
KOG1737 799 consensus Oxysterol-binding protein [Lipid transpo 93.62
cd01227133 PH_Dbs Dbs (DBL's big sister) pleckstrin homology 93.46
cd07681258 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin 93.4
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 93.21
cd07668210 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of S 93.17
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 92.88
cd07669207 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of 92.81
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 91.93
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 91.72
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 91.33
cd01248115 PH_PLC Phospholipase C (PLC) pleckstrin homology ( 91.17
cd07663218 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S 91.12
PF08458110 PH_2: Plant pleckstrin homology-like region; Inter 90.94
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 89.75
smart00721239 BAR BAR domain. 88.76
cd07685237 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amp 88.52
KOG2070661 consensus Guanine nucleotide exchange factor [Nucl 88.23
KOG3891436 consensus Secretory vesicle-associated protein ICA 87.69
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 87.55
cd07670207 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of 87.01
cd07656241 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/A 86.95
KOG35311036 consensus Rho guanine nucleotide exchange factor C 86.89
KOG2856472 consensus Adaptor protein PACSIN [Signal transduct 86.05
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 85.88
KOG0248 936 consensus Cytoplasmic protein Max-1, contains PH, 84.85
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 84.7
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 83.76
KOG1451812 consensus Oligophrenin-1 and related Rho GTPase-ac 83.28
PF15405135 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. 82.18
cd01255160 PH_TIAM TIAM Pleckstrin homology (PH) domain. TIAM 82.05
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 81.61
KOG4807 593 consensus F-actin binding protein, regulates actin 80.71
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-85  Score=750.51  Aligned_cols=656  Identities=36%  Similarity=0.535  Sum_probs=508.0

Q ss_pred             ccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhchHHHHHHHHHhh-CCCCCCCccccchhHHHH
Q 046849            3 AFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFG-GGHDDPVSVSIGGPVISK   81 (760)
Q Consensus         3 ~~e~~~DSP~FRa~l~~~e~~l~~l~~~l~kl~k~~k~~~~~~~~~~~~~~~~~~~l~~~~-~~~~d~~~~~~~~~~l~~   81 (760)
                      ..|++.|||+||+++..+|+++..+++.++++++.+..++++..++..+.+.|...+..+. -+.++++.    .++|.+
T Consensus         9 ~~e~lkdsp~fr~~~~~~ee~~~~~~~~l~k~~~~~~~~~~~~~~~~~~~~~f~~~~~d~~~~~~~~~~~----~~~l~~   84 (785)
T KOG0521|consen    9 AEEFLKDSPQFRSTLDVFEEDAGTLEKYLNKLLKAMTRKYDAGKEFVQATEQFGKGLKDLFSLGQDEEVI----SETLQK   84 (785)
T ss_pred             hHHHhhcChhHHHHHHHHHHHHHhhhhhHHHHHHHHHhhhcccHHHHHHHHHHHHHHHHHHHhccCchhh----hhHHHH
Confidence            4689999999999999999999999999999999999999998888888899998888764 23333332    368999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCChhhHHHHHHHHHH
Q 046849           82 FISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDIVAELEEDLQN  161 (760)
Q Consensus        82 f~~~l~el~~~~~~l~~~~~~~~~~pL~~f~~~~l~~~ke~rk~fek~~~~Yd~al~ky~s~~k~k~~~~~~e~~~~l~~  161 (760)
                      |+..++|+.++++.|..++++.+..||.+|++.+|.++++.|++|++++++||.++.||.+++|++++....|.+++|..
T Consensus        85 fs~~~~e~~~~~~~L~~q~~~~~~~~l~~f~k~dl~~v~~~kk~f~ka~~~~d~a~~k~~~l~k~~~~~~~~e~~~~l~~  164 (785)
T KOG0521|consen   85 FSKVLRELGTYHTELRSQLAHTLSLPLSQFVKGDLHEVKELKKLFEKASEEYDLALVKYSRLPKKRRSKVKTEVEEELAA  164 (785)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhHHHHHHHhhHHHHHHHhhhhhhccccchhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999998877778889999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 046849          162 SKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLSKIEPYVHQVLTYAQQSKEVANVEQDKLAKR  241 (760)
Q Consensus       162 ~Rk~f~~asldyv~~i~~l~~~k~~e~l~~l~~~~~a~~~ff~~g~~~~~~~~~~~~~l~~~~~~~r~~~~~~~~~l~~~  241 (760)
                      +|++|++++|||+..++.++.++++++++.+++||++|.+||++|++++.+++||++.+..++++++..++.+++.+.++
T Consensus       165 ~r~~f~~~~~~y~~~ln~~q~kk~~~~le~~l~~~~aq~~fF~~g~~l~~~m~p~~~~i~~~v~ql~~~~~~e~~am~~~  244 (785)
T KOG0521|consen  165 ARRKFQLTALDYVLALNVLQAKKQFEILETLLGFMHAQINFFKQGEDLLSQMDPYIKKVATYVQQLREESDAEQRAMEQR  244 (785)
T ss_pred             HHHHHHHHHHHHHHhhhhhhcccchHHHHHHHHHHHhccchhcccHhHHhhhhHHHHHHHHHHHHHHHhhHHHHHHHHhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhhhhccCCCCCCccCCCCCCCcccccCccchhhHHHhhhcCCCCcceeEEEEEEeeCCCCCCCceeeEEEEecC
Q 046849          242 IQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSNLRGDWKRRFFVLNSQ  321 (760)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~G~L~K~~~~~~~~W~rR~fvl~~~  321 (760)
                      ++++..+.+........ + ..|..                     ........+.|||+|+.+...+.|+||||..+ +
T Consensus       245 ~q~l~~~~~~~~~~~~~-~-~~~~~---------------------~~~~~~~~~~~~l~~k~~~~~~tw~r~~f~~q-~  300 (785)
T KOG0521|consen  245 YQELRSASNLESRPKSD-S-ASPSG---------------------GNLKLGYRMEGYLRKKASNASKTWKRRWFSIQ-D  300 (785)
T ss_pred             HHHHHHHhhhhhhcccc-c-ccccc---------------------ccccchhhhhhhhhhhcccchhhHHhhhhhhh-c
Confidence            99888776555443111 0 11111                     11223455689999999887889999999998 6


Q ss_pred             ceEEEEecCCCCCCCCCcccCCCCCCCCCccccccccccCCCCCCCCccccccccccCceeccCCCCCCCCceEEEEecC
Q 046849          322 GTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRLCFRIISPV  401 (760)
Q Consensus       322 ~~l~y~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~v~~~~~~~~~~~~F~i~~~~  401 (760)
                      +.+.|........                         +           ....+|.+|.|++.++..++||||+|++|+
T Consensus       301 ~~l~~~~r~~~~~-------------------------~-----------~~~~dL~~csvk~~~~~~drr~CF~iiS~t  344 (785)
T KOG0521|consen  301 GQLGYQHRGADAE-------------------------N-----------VLIEDLRTCSVKPDAEQRDRRFCFEIISPT  344 (785)
T ss_pred             ccccccccccccc-------------------------c-----------cccccchhccccCCcccccceeeEEEecCC
Confidence            6665544322211                         0           225689999999987777999999999999


Q ss_pred             ceeEEEcCCHHHHHHHHHHHHHHHHHhhhhhhhhccCCCCCCCCCC-CCCCCCCCCCCCCCCccchhhhccCchHHHHHH
Q 046849          402 KTYTLQAETEADRMDWTSKITGVIASLLNSDLLQQLRPSAKHIDGN-DPFSTRDVPSLSSHCSLEDEVKANKSDSVSAIL  480 (760)
Q Consensus       402 ~~~~lqA~s~~e~~~Wi~ai~~~i~~~~~~~~~~~~~~~~~~~~~~-~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (760)
                      |+|+|||+|+.|+.+||.+|++.|..+++...+.+...+..+.... +.+.+....  +......+  ........+..+
T Consensus       345 ks~~lQAes~~d~~~Wi~~i~nsi~s~l~~~~~~~~~~~~~~~~~~~~~~~s~~~~--~s~~~s~~--~~~~~~~~~~~v  420 (785)
T KOG0521|consen  345 KSYLLQAESEKDCQDWISALQNSILSALNSAFLGQDSTGGRNTQSGHSSSASYSTI--TSANTSRE--RLNKGISVIEEV  420 (785)
T ss_pred             cceEEecCchhHHHHHHHHHHHHHHHHHhccCcccccccCCCcccccccccccccc--cccccccc--ccccCcchhhhh
Confidence            9999999999999999999999999999988776543321111111 111110000  00000000  112223368899


Q ss_pred             hcCCCCCccccCCCCCCCeEEeccceeEccchhhHhhcCCCCccceeEeccCCCCCCHHHHHHHHhhchHHHHHHHhccc
Q 046849          481 RQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPTILDLFGSLGNAYCNSIWEGLL  560 (760)
Q Consensus       481 ~~~~~n~~C~dC~~~~p~w~s~n~g~~~C~~Csg~Hr~lg~~~s~v~s~~ld~~~w~~~~~~~~~~~GN~~~n~~~e~~~  560 (760)
                      +..|||..|||||+++|+|+|+|+||.+||+|||+||+||||+||||||+||  .|+++.+.+++.+||..+|.|||+.+
T Consensus       421 q~~pgN~~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD--~~~~~l~~l~~~lgn~~~N~i~e~~l  498 (785)
T KOG0521|consen  421 QSVPGNAQCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLD--VWEPELLLLFKNLGNKYVNEIYEALL  498 (785)
T ss_pred             hcCCchhhhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhh--ccCcHHHHHHHHhCcchhhhhhhccc
Confidence            9999999999999999999999999999999999999999999999999999  69999999999999999999999999


Q ss_pred             cCccccccCCCCCCCCcCCCCCCCcHHHHHHHHHHHHhhhhhhhcCCCCccccchh------------------hhHHHH
Q 046849          561 LLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVEKLLVIRDTSDAKSRTTS------------------IWEAVK  622 (760)
Q Consensus       561 ~~~~~~~~~~~~~~~~~~kp~~~~~~~~re~fI~~KY~~k~Fv~~~~~~~~~~~~~------------------L~~A~~  622 (760)
                      +...            ..+|.+..+...|+.||++||+++.|....+.........                  ++.++.
T Consensus       499 ~~~~------------~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  566 (785)
T KOG0521|consen  499 PSYD------------SSKPTASSSRQAREAWIKAKYVERRFSVKEPQIKRLYLERLLEAIKSILESASASGVQISEGVS  566 (785)
T ss_pred             cccc------------ccCCCCccchhhhhHhhhcccceeeEeecccchhhhhhhhhhhhhhhhhhhhhhhhhhHhhccc
Confidence            9731            4578887779999999999999999998877654211122                  222221


Q ss_pred             hcCHHH-HHHHHHhcCCcccCcccCC--------CCCCcccccccc-cc--ccchhhh-hh----cccccCCCCcccCcC
Q 046849          623 TQNLQE-VYRLIVTSDANIINTTFDD--------VVGVDSYHHVDN-TQ--YSEIDFH-KV----KKEENNGPAGCQRIK  685 (760)
Q Consensus       623 ~~~~~~-v~~ll~~g~~d~~n~~~~d--------~~g~t~Lh~A~~-~g--~~~~~~~-~~----~~~~~~~~~ll~~ga  685 (760)
                      .+.... +..++..+..+ .+....+        ..|.+.+|.... ..  ...+..+ ..    -.+...+..-..+|+
T Consensus       567 ~~~~~~~v~~l~~~~~~d-~~~~~~~~~~~~~~~~~~~~~~h~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~  645 (785)
T KOG0521|consen  567 GSSREETVYHLIVSTLND-ASIRSADFSVPDKSSADGSTTLHYEILECLKLLLFIKELLVKASSDGECLPRIATALAHGC  645 (785)
T ss_pred             cCCccccceeeeccCccc-ccccccccccccccccccccccchhhhhccccccchHHHHHHhccCccchhhhhhhhcchh
Confidence            222222 45555444222 3332221        134455665541 10  0000000 00    011112222367888


Q ss_pred             CCCCCCCCCCCChHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCCCCCCcHHHHHHHcCC
Q 046849          686 DSNDPGNCLQGGSLLHLACQCGNLVMLELLIQFGADINMRARPSIKDGGGLSSLERAMEMGA  747 (760)
Q Consensus       686 dvn~~~~~~~G~TpLh~Aa~~g~~~~v~lLL~~GAdvn~~Ad~~~~d~~G~TpL~~A~~~g~  747 (760)
                      ++|+.++-..|.|+||.|+..|...++++||++||++|.      +|..|+||||.+...|+
T Consensus       646 ~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~vn~------~d~~g~~plh~~~~~g~  701 (785)
T KOG0521|consen  646 CENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGADVNA------LDSKGRTPLHHATASGH  701 (785)
T ss_pred             hhccchhhhcccchhhhhhccchHHHHHHHHhcCCcchh------hhccCCCcchhhhhhcc
Confidence            999887777899999999999999999999999999998      55555555555555555

>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] Back     alignment and domain information
>cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>cd07609 BAR_SIP3_fungi The Bin/Amphiphysin/Rvs (BAR) domain of fungal Snf1p-interacting protein 3 Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional Back     alignment and domain information
>PLN03131 hypothetical protein; Provisional Back     alignment and domain information
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional Back     alignment and domain information
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>KOG0706 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>cd07608 BAR_ArfGAP_fungi The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized fungal Arf GAP proteins Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0930 consensus Guanine nucleotide exchange factor Cytohesin, contains PH and Sec7 domains [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF15409 PH_8: Pleckstrin homology domain Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 Back     alignment and domain information
>cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4424 consensus Predicted Rho/Rac guanine nucleotide exchange factor/faciogenital dysplasia protein 3 [Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>KOG0702 consensus Predicted GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins Back     alignment and domain information
>cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) Back     alignment and domain information
>KOG1118 consensus Lysophosphatidic acid acyltransferase endophilin/SH3GL, involved in synaptic vesicle formation [Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules Back     alignment and domain information
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II Back     alignment and domain information
>cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07659 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of Protein Interacting with C Kinase 1 Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1090 consensus Predicted dual-specificity phosphatase [General function prediction only] Back     alignment and domain information
>PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A Back     alignment and domain information
>cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07628 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p Back     alignment and domain information
>PF10455 BAR_2: Bin/amphiphysin/Rvs domain for vesicular trafficking; InterPro: IPR018859 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd07605 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), a dimerization module that binds and bends membranes Back     alignment and domain information
>cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 Back     alignment and domain information
>KOG3725 consensus SH3 domain protein SH3GLB [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>cd07589 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of Dynamin Binding Protein Back     alignment and domain information
>KOG3771 consensus Amphiphysin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07661 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of Islet Cell Autoantigen 69-kDa Back     alignment and domain information
>PF06730 FAM92: FAM92 protein; InterPro: IPR009602 This family consists of several eukaryotic sequences of around 270 residues in length Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 Back     alignment and domain information
>KOG2059 consensus Ras GTPase-activating protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3640 consensus Actin binding protein Anillin [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG3751 consensus Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0932 consensus Guanine nucleotide exchange factor EFA6 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>cd07630 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07645 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1 Back     alignment and domain information
>cd07644 I-BAR_IMD_BAIAP2L2 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 2 Back     alignment and domain information
>cd07629 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg20p Back     alignment and domain information
>cd07646 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Insulin Receptor tyrosine kinase Substrate p53 Back     alignment and domain information
>cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6 Back     alignment and domain information
>cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>KOG1739 consensus Serine/threonine protein kinase GPBP [Signal transduction mechanisms; Defense mechanisms] Back     alignment and domain information
>cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 Back     alignment and domain information
>cd07607 BAR_SH3P_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant SH3 domain-containing proteins Back     alignment and domain information
>cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>cd07625 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps17p Back     alignment and domain information
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG3876 consensus Arfaptin and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 Back     alignment and domain information
>cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>PLN02866 phospholipase D Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG3723 consensus PH domain protein Melted [Signal transduction mechanisms] Back     alignment and domain information
>PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>KOG3651 consensus Protein kinase C, alpha binding protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) Back     alignment and domain information
>cd07626 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 and Similar Proteins Back     alignment and domain information
>cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07610 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or F-BAR (FCH and Bin/Amphiphysin/Rvs) domain, a dimerization module that binds and bends membranes Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01223 PH_Vav Vav pleckstrin homology (PH) domain Back     alignment and domain information
>cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07675 F-BAR_FNBP1L The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 1-Like Back     alignment and domain information
>cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases Back     alignment and domain information
>cd07650 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of yeast Syp1 protein Back     alignment and domain information
>cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 Back     alignment and domain information
>cd07597 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 8 Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>cd01232 PH_TRIO Trio pleckstrin homology (PH) domain Back     alignment and domain information
>cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain Back     alignment and domain information
>KOG1117 consensus Rho- and Arf-GTPase activating protein ARAP3 [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>PF10456 BAR_3_WASP_bdg: WASP-binding domain of Sorting nexin protein; InterPro: IPR019497 The C-terminal region of the Sorting nexin group of proteins appears to carry a BAR-like (Bin/amphiphysin/Rvs) domain Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>PF15406 PH_6: Pleckstrin homology domain Back     alignment and domain information
>cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>PF15404 PH_4: Pleckstrin homology domain Back     alignment and domain information
>PF15408 PH_7: Pleckstrin homology domain Back     alignment and domain information
>KOG3543 consensus Ca2+-dependent activator protein [Signal transduction mechanisms] Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>KOG2273 consensus Membrane coat complex Retromer, subunit VPS5/SNX1, Sorting nexins, and related PX domain-containing proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) Back     alignment and domain information
>cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>cd07652 F-BAR_Rgd1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Saccharomyces cerevisiae Rho GTPase activating protein Rgd1 and similar proteins Back     alignment and domain information
>KOG1737 consensus Oxysterol-binding protein [Lipid transport and metabolism] Back     alignment and domain information
>cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07681 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07668 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07669 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 33 Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain Back     alignment and domain information
>cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 Back     alignment and domain information
>PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>cd07685 F-BAR_Fes The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) tyrosine kinase Back     alignment and domain information
>KOG2070 consensus Guanine nucleotide exchange factor [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3891 consensus Secretory vesicle-associated protein ICA69, contains Arfaptin domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>cd07670 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 18 Back     alignment and domain information
>cd07656 F-BAR_srGAP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>KOG3531 consensus Rho guanine nucleotide exchange factor CDEP [Signal transduction mechanisms] Back     alignment and domain information
>KOG2856 consensus Adaptor protein PACSIN [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>KOG0248 consensus Cytoplasmic protein Max-1, contains PH, MyTH4 and FERM domains [Cytoskeleton] Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>KOG1451 consensus Oligophrenin-1 and related Rho GTPase-activating proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A Back     alignment and domain information
>cd01255 PH_TIAM TIAM Pleckstrin homology (PH) domain Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-24
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-24
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-24
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 3e-23
3feh_A386 Crystal Structure Of Full Length Centaurin Alpha-1 3e-18
3fm8_C392 Crystal Structure Of Full Length Centaurin Alpha-1 3e-18
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 6e-18
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 6e-18
2iqj_A134 Crystal Structure Of The Gap Domain Of Smap1l (Loc6 2e-15
2crr_A141 Solution Structure Of Arfgap Domain From Human Smap 4e-14
2p57_A144 Gap Domain Of Znf289, An Id1-Regulated Zinc Finger 6e-14
2crw_A149 Solution Structure Of The Arfgap Domain Of Adp-Ribo 2e-13
3sub_A163 Crystal Structure Of The Catalytic Domain Of Plasmo 8e-13
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 2e-12
3dwd_A147 Crystal Structure Of The Arfgap Domain Of Human Arf 3e-12
2q13_A385 Crystal Structure Of Bar-Ph Domain Of Appl1 Length 9e-12
2owa_A138 Crystal Structure Of Putative Gtpase Activating Pro 1e-09
2elb_A396 Crystal Structure Of The Bar-Ph Domain Of Human App 3e-09
2z0o_A387 Crystal Structure Of Appl1-Bar-Ph Domain Length = 3 7e-09
2z0n_A280 Crystal Structure Of Appl1-Bar Domain Length = 280 9e-07
2q12_A265 Crystal Structure Of Bar Domain Of Appl1 Length = 2 2e-06
2olm_A140 Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 5e-05
2d9l_A134 Solution Structure Of The Arfgap Domain Of Human Ri 8e-05
4h8s_A407 Crystal Structure Of Human Appl2barph Domain Length 3e-04
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure 
Iteration: 1

 Score =  111 bits (278), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 77/130 (59%), Gaps = 14/130 (10%)
Query: 476 VSAILRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKV 535
           V A ++ + GN  C +C  P P+WAS+NLG+ LCI+CSG+HR+LGVH SKVRSLTLD   
Sbjct: 35  VVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLD--S 92
Query: 536 WEPTILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINA 595
           WEP ++ L   LGN   N I+E            +     +V+KP        KE +I+A
Sbjct: 93  WEPELVKLMCELGNVIINQIYE------------ARVEAMAVKKPGPSCSRQEKEAWIHA 140
Query: 596 KYVEKLLVIR 605
           KYVEK  + +
Sbjct: 141 KYVEKKFLTK 150
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 Back     alignment and structure
>pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 Back     alignment and structure
>pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 Back     alignment and structure
>pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 Back     alignment and structure
>pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 Back     alignment and structure
>pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 Back     alignment and structure
>pdb|2Q13|A Chain A, Crystal Structure Of Bar-Ph Domain Of Appl1 Length = 385 Back     alignment and structure
>pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 Back     alignment and structure
>pdb|2ELB|A Chain A, Crystal Structure Of The Bar-Ph Domain Of Human Appl1 Length = 396 Back     alignment and structure
>pdb|2Z0O|A Chain A, Crystal Structure Of Appl1-Bar-Ph Domain Length = 387 Back     alignment and structure
>pdb|2Z0N|A Chain A, Crystal Structure Of Appl1-Bar Domain Length = 280 Back     alignment and structure
>pdb|2Q12|A Chain A, Crystal Structure Of Bar Domain Of Appl1 Length = 265 Back     alignment and structure
>pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 Back     alignment and structure
>pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 Back     alignment and structure
>pdb|4H8S|A Chain A, Crystal Structure Of Human Appl2barph Domain Length = 407 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-63
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-61
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-60
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-58
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 2e-56
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 1e-47
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 3e-45
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 5e-44
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 2e-43
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 5e-25
2owa_A138 Arfgap-like finger domain containing protein; zinc 4e-40
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 4e-39
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 9e-38
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 5e-37
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 1e-36
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 1e-35
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 8e-23
3o47_A329 ADP-ribosylation factor GTPase-activating protein 3e-22
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 4e-20
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 4e-20
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 2e-19
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 3e-19
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 6e-19
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 7e-19
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 9e-19
1wi1_A126 Calcium-dependent activator protein for secretion, 2e-18
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 2e-18
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 4e-18
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 7e-18
1v5p_A126 Pleckstrin homology domain-containing, family A; T 1e-17
2d9v_A130 Pleckstrin homology domain-containing protein fami 1e-17
3aj4_A112 Pleckstrin homology domain-containing family B ME; 2e-17
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 3e-17
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 3e-17
2dkp_A128 Pleckstrin homology domain-containing family A mem 3e-17
1u5e_A211 SRC-associated adaptor protein; novel dimerization 5e-17
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 1e-16
2d9y_A117 Pleckstrin homology domain-containing protein fami 2e-16
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 2e-16
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 5e-16
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 7e-16
2yry_A122 Pleckstrin homology domain-containing family A mem 1e-15
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 1e-15
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 2e-15
3rcp_A103 Pleckstrin homology domain-containing family A ME; 3e-15
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 3e-15
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 3e-15
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 4e-15
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 2e-14
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3cxb_B112 Pleckstrin homology domain-containing family M mem 5e-14
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 7e-14
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 7e-14
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 3e-13
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 2e-12
4avm_A237 Bridging integrator 2; protein binding, plasma mem 2e-12
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 2e-12
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 4e-12
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 4e-12
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 9e-12
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 2e-11
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 1e-10
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 2e-10
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 5e-10
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 1e-09
1v88_A130 Oxysterol binding protein-related protein 8; vesic 2e-09
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 3e-09
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 5e-09
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 1e-08
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 2e-08
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 7e-08
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 3e-07
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 4e-07
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 6e-07
3ok8_A222 Brain-specific angiogenesis inhibitor 1-associate 4e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 8e-06
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 1e-05
2ykt_A253 Brain-specific angiogenesis inhibitor 1-associate 2e-05
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-05
2d1l_A253 Metastasis suppressor protein 1; IRSP53, actin bin 2e-04
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-04
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-04
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-04
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-04
2rfa_A232 Transient receptor potential cation channel subfa 5e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-04
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 6e-04
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 7e-04
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-04
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 8e-04
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 8e-04
2etb_A 256 Transient receptor potential cation channel subfam 8e-04
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
 Score =  211 bits (539), Expect = 4e-63
 Identities = 82/281 (29%), Positives = 124/281 (44%), Gaps = 30/281 (10%)

Query: 480 LRQIPGNDLCAECSAPDPDWASLNLGILLCIECSGVHRNLGVHISKVRSLTLDVKVWEPT 539
           ++++ GND+C +C APDP W S NLGIL CIECSG+HR LGVH S+++SLTLD  V   +
Sbjct: 11  VQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLD--VLGTS 68

Query: 540 ILDLFGSLGNAYCNSIWEGLLLLKDREVDKSNTTIPSVRKPCSKDVFHYKEQYINAKYVE 599
            L L  ++GNA  N I E  L  +D              KP        ++ YI AKY+E
Sbjct: 69  ELLLAKNIGNAGFNEIMECCLPSEDP------------VKPNPGSDMIARKDYITAKYME 116

Query: 600 KLLVIRDTSDAKSRTTSIWEAVKTQNLQEVYRLIVTS-DANIINTTFDDVVGVDSYHHVD 658
           +    +  +D  ++  S+ EAVKT+++  + +      D        +     ++  H+ 
Sbjct: 117 RRYARKKHADTAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLA 176

Query: 659 NTQYSEIDFHKVKKEENNGPAGCQRIKDSNDPGNCLQGGSLLHLACQCGNLVMLELLIQF 718
                    H V     N       +      G+     + LH  C   N   L+LL++ 
Sbjct: 177 VRSVDRTSLHIVDFLVQNS----GNLDKQTGKGS-----TALHYCCLTDNAECLKLLLRG 227

Query: 719 GADINMRARPSIKDGGGLSSLERAMEMGAITDEELFILLAE 759
            A I       I +  G + L+ A  +     EEL      
Sbjct: 228 KASIE------IANESGETPLDIAKRLKHEHCEELLTQALS 262
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Length = 385 Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Length = 265 Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Length = 240 Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Length = 256 Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 126 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Length = 244 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Length = 264 Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 123 Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Length = 251 Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Length = 124 Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Length = 224 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Length = 122 Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 Back     alignment and structure
>3ok8_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 2; I-BAR, protein binding; 2.25A {Mus musculus} Length = 222 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Length = 106 Back     alignment and structure
>2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A Length = 253 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} Length = 253 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Length = 510 Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Length = 113 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 100.0
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 100.0
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 100.0
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 100.0
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 100.0
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 100.0
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 100.0
2iqj_A134 Stromal membrane-associated protein 1-like; zinc, 100.0
2crr_A141 Stromal membrane-associated protein SMAP1B; arfgap 100.0
2olm_A140 Nucleoporin-like protein RIP; arfgap, GTPase-activ 100.0
2owa_A138 Arfgap-like finger domain containing protein; zinc 99.97
2crw_A149 ARF GAP 3, ADP-ribosylation factor GTPase-activati 99.96
3dwd_A147 ADP-ribosylation factor GTPase-activating protein; 99.96
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.96
2p57_A144 GTPase-activating protein ZNF289; zinc finger, GAP 99.95
3sub_A163 ADP-ribosylation factor GTPase-activating protein; 99.95
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.9
1wi1_A126 Calcium-dependent activator protein for secretion, 99.83
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.83
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 99.81
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 99.81
1v88_A130 Oxysterol binding protein-related protein 8; vesic 99.77
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 99.77
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 99.76
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.76
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.76
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 99.75
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 99.75
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 99.75
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 99.74
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 99.74
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.74
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 99.74
1v5p_A126 Pleckstrin homology domain-containing, family A; T 99.74
3cxb_B112 Pleckstrin homology domain-containing family M mem 99.74
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.74
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 99.73
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 99.73
2d9v_A130 Pleckstrin homology domain-containing protein fami 99.73
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 99.73
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 99.73
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 99.73
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 99.73
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 99.73
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 99.73
2dkp_A128 Pleckstrin homology domain-containing family A mem 99.71
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.71
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 99.71
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.71
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 99.71
2yry_A122 Pleckstrin homology domain-containing family A mem 99.71
2d9y_A117 Pleckstrin homology domain-containing protein fami 99.71
3aj4_A112 Pleckstrin homology domain-containing family B ME; 99.71
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 99.7
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 99.7
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 99.7
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.7
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.7
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.7
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.7
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 99.7
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 99.7
3rcp_A103 Pleckstrin homology domain-containing family A ME; 99.7
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.7
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 99.7
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.7
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 99.7
1u5e_A211 SRC-associated adaptor protein; novel dimerization 99.7
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.7
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 99.7
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.69
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.69
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.69
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.69
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.69
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.69
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.68
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 99.68
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 99.68
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 99.68
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.68
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 99.68
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.67
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 99.67
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.67
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.66
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.66
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 99.66
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.66
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.66
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 99.65
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.65
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.65
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.65
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.65
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.64
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.64
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.63
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.63
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.63
2etb_A256 Transient receptor potential cation channel subfam 99.63
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.63
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.63
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.62
3hra_A201 Ankyrin repeat family protein; structural protein; 99.62
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 99.62
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.62
3a8p_A263 T-lymphoma invasion and metastasis-inducing protei 99.62
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.62
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.62
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 99.61
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.61
2pnn_A273 Transient receptor potential cation channel subfa 99.61
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.61
2rfa_A232 Transient receptor potential cation channel subfa 99.61
3hra_A201 Ankyrin repeat family protein; structural protein; 99.61
2rfa_A232 Transient receptor potential cation channel subfa 99.61
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.6
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.6
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.59
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.59
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.59
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.59
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.58
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.58
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.58
2etb_A256 Transient receptor potential cation channel subfam 99.58
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.58
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.58
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.57
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 99.57
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.57
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.57
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 99.57
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 99.57
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.57
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.56
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 99.56
1qqg_A264 IRS-1, insulin receptor substrate 1; beta-sandwhic 99.56
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.56
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.56
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.56
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.55
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.55
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.55
2pnn_A273 Transient receptor potential cation channel subfa 99.55
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.55
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.54
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.54
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.54
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.54
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.53
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.53
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.53
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.53
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.53
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.51
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 99.51
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.51
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.51
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.5
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.49
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.49
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.49
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.46
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.45
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 99.45
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.45
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.44
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.44
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 99.44
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.43
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.43
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.43
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.42
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.42
2d9w_A127 Docking protein 2; PH domain, structural genomics, 99.39
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.38
3a8n_A279 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.37
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 99.36
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.33
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.32
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.27
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 99.21
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.18
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.16
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 99.12
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 99.1
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.1
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 99.09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.08
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 99.06
1w1g_A151 HPDK1, 3-phosphoinositide dependent protein kinase 99.04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.02
4bbk_A165 Kindlin-1, fermitin family homolog 1; PH domain, c 99.02
4f7h_A173 Fermitin family homolog 2; beta-barrel, membrane b 99.0
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 98.88
2coa_A125 Protein kinase C, D2 type; protein kinase D2, PH d 98.8
4avm_A237 Bridging integrator 2; protein binding, plasma mem 98.78
2d9z_A129 Protein kinase C, NU type; PH domain, structural g 98.75
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 98.7
2vrw_B406 P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP 98.67
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 98.6
3ky9_A587 Proto-oncogene VAV; calponin homology domain, DBL 98.54
1zc3_B113 Exocyst complex protein EXO84; exocytosis, small G 98.31
2ykt_A253 Brain-specific angiogenesis inhibitor 1-associate 98.15
1v5m_A136 SH2 and PH domain-containing adapter protein APS; 98.05
3odw_A536 RHO guanine nucleotide exchange factor 1; regulati 97.93
3t06_A418 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.92
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 97.87
1dbh_A354 Protein (human SOS 1); guanine nucleotide exchange 97.85
2d1l_A253 Metastasis suppressor protein 1; IRSP53, actin bin 97.82
4akv_A386 Sorting nexin-33; transport protein, organelle bio 97.82
2dfk_A402 Collybistin II; DH domain, PH domain, cell cycle; 97.8
3p6a_A377 RHO guanine nucleotide exchange factor 1; regulati 97.75
1v61_A132 RAC/CDC42 guanine nucleotide exchange factor (GEF) 97.75
3ok8_A222 Brain-specific angiogenesis inhibitor 1-associate 97.69
3qwm_A140 Iqsec1, IQ motif and SEC7 domain-containing protei 97.67
1txd_A385 RHO guanine nucleotide exchange factor 12; helical 97.63
2efl_A305 Formin-binding protein 1; EFC domain, structural g 97.62
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.55
3dyt_A366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 97.55
1xcg_A368 PDZ-rhogef, RHO guanine nucleotide exchange factor 97.54
2lg1_A185 A-kinase anchor protein 13; metal binding protein; 97.43
3ml4_A224 Protein DOK-7; tyrosine phosphorylation, adapter p 97.4
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 97.16
1mai_A131 Phospholipase C delta-1; pleckstrin, inositol tris 97.08
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 97.05
2rgn_B354 RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p 96.97
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 96.84
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 96.81
1kz7_A353 Guanine nucleotide exchange factor DBS; guanine nu 96.79
1nty_A311 Triple functional domain protein; DBL, pleckstrin, 96.74
2z0q_A346 XPLN, RHO guanine nucleotide exchange factor 3; DH 96.73
2x3v_A337 Syndapin I, protein kinase C and casein kinase sub 96.61
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 96.48
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 96.45
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 96.45
3aco_A350 Pacsin2, protein kinase C and casein kinase substr 96.38
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 96.35
3caz_A294 BAR protein; thermo-acidophilic RED ALGA, protein 96.14
3abh_A312 Pacsin2, protein kinase C and casein kinase substr 95.98
4dyl_A406 Tyrosine-protein kinase FES/FPS; structural genomi 95.94
1foe_A377 T-lymphoma invasion and metastasis inducing protei 95.9
3g9g_A287 Suppressor of yeast profilin deletion; SYP1, BAR d 95.78
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 95.43
3m3w_A320 Pacsin3, protein kinase C and casein kinase II sub 94.76
3i2w_A290 Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt 93.03
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 92.84
2adz_A178 Alpha-1-syntrophin; protein binding; NMR {Mus musc 92.41
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 91.99
1fho_A119 UNC-89; pleckstrin homology domain, electrostatics 91.79
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 83.26
3plt_A234 Sphingolipid long chain base-responsive protein L; 82.62
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 80.97
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
Probab=100.00  E-value=6.5e-58  Score=502.66  Aligned_cols=361  Identities=22%  Similarity=0.365  Sum_probs=300.9

Q ss_pred             ccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhchHHHHHHHHHhhC-----CCCCCCccccchh
Q 046849            3 AFIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGG-----GHDDPVSVSIGGP   77 (760)
Q Consensus         3 ~~e~~~DSP~FRa~l~~~e~~l~~l~~~l~kl~k~~k~~~~~~~~~~~~~~~~~~~l~~~~~-----~~~d~~~~~~~~~   77 (760)
                      .-||++|||.||++|+++|++++.++.||++++|.|+.+++++++++.+...|+++|..++.     +.+|+..    ..
T Consensus         9 f~e~~~DSP~FR~~l~~~E~~~~~l~~~l~kl~k~~~~~~~a~~~~~~a~~~f~~~L~~~~~~~~~~~~~d~~v----~~   84 (385)
T 2q13_A            9 IEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEVM----SS   84 (385)
T ss_dssp             GGGTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTSCCCC---CCHH----HH
T ss_pred             chHhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCCCCcHHH----HH
Confidence            34899999999999999999999999999999999999999999999999999999999764     2344432    26


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCChhh-HHHHH
Q 046849           78 VISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDI-VAELE  156 (760)
Q Consensus        78 ~l~~f~~~l~el~~~~~~l~~~~~~~~~~pL~~f~~~~l~~~ke~rk~fek~~~~Yd~al~ky~s~~k~k~~~~-~~e~~  156 (760)
                      +|.+|+.+++++..++..|+.++++.++.||++|++++|+++++.||+||+++.+||++++||++++|+++++. ..|++
T Consensus        85 ~l~~f~~~~~ei~~~~~~l~~~~~~~~~~PL~~f~~~di~~~ke~kk~fek~~~~yd~al~k~~~~~k~k~~e~~~~ea~  164 (385)
T 2q13_A           85 TLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVT  164 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCSSSCCHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCchhhHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999887764 46778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHh-hhhHHHHHHHHHHHHHHHHHHHHH
Q 046849          157 EDLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLLS-KIEPYVHQVLTYAQQSKEVANVEQ  235 (760)
Q Consensus       157 ~~l~~~Rk~f~~asldyv~~i~~l~~~k~~e~l~~l~~~~~a~~~ff~~g~~~~~-~~~~~~~~l~~~~~~~r~~~~~~~  235 (760)
                      ++|+++|+.|++++|||+..|++++.++++++|+.+++|+++|.+||++|++++. +++||++.+...++++|..+++++
T Consensus       165 ~~l~~~rk~f~~~~ldy~~~l~~l~~rk~~e~le~l~~~~~a~~~ff~~g~~~~~~~~~~~~~~l~~~l~~~r~~~~~~~  244 (385)
T 2q13_A          165 EDVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDI  244 (385)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999985 999999999999999999999887


Q ss_pred             HHHHHHHHHHhhhhhhccCCCCCCccCCCCCCCcccccCccchhhHHHhhhcCCCCcceeEEEEEEeeCCC--CCCCcee
Q 046849          236 DKLAKRIQEFRTQAELDNLGVPVDVEHSVSADGIHVGGTVSYKNIEAVMRSSATGEVQTIKQGYLLKRSSN--LRGDWKR  313 (760)
Q Consensus       236 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~G~L~K~~~~--~~~~W~r  313 (760)
                      +.+.+.+.++...    ..     +.+.|+....               + .......++|+|||+|+++.  .++.|+|
T Consensus       245 ~~~~~~~~~l~~~----~~-----~~~~~~~~~~---------------~-~~~~~~~~~k~G~L~K~~~~~~~~~~Wkk  299 (385)
T 2q13_A          245 ETMQQTIEDLEVA----SD-----PLYVPDPDPT---------------K-FPVNRNLTRKAGYLNARNKTGLVSSTWDR  299 (385)
T ss_dssp             HHHHHHHHHHHHH----HG-----GGSSSSCCTT---------------T-SCCCCCCSCCEEEEEEC--------CCEE
T ss_pred             HHHHHHHHHHhcc----CC-----CCCCCCCccc---------------c-cccCCCCccEEEEEEEecCCCCCcCCcee
Confidence            7666555543321    00     0111111000               0 01123467899999999865  3457999


Q ss_pred             eEEEEecCceEEEEecCCCCCCCCCcccCCCCCCCCCccccccccccCCCCCCCCccccccccccCceeccCCCCCCCCc
Q 046849          314 RFFVLNSQGTLYYYRNKGIKSMGSHHHYAGSADHNGGVFSRFRSRHYRSSSFNEDSLNCRTVDLRTSAIKMDGEDTDLRL  393 (760)
Q Consensus       314 R~fvl~~~~~l~y~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~v~~~~~~~~~~~  393 (760)
                      |||||+ +|.|+||++....                                     +.+.|+|..|+|+. .++.+|+|
T Consensus       300 RwfvL~-~~~L~y~k~~~~~-------------------------------------~~~~i~l~~~~v~~-~~~~~r~~  340 (385)
T 2q13_A          300 QFYFTQ-GGNLMSQARGDVA-------------------------------------GGLAMDIDNCSVMA-VDCEDRRY  340 (385)
T ss_dssp             EEEEEE-TTEEEEECSSCSS-------------------------------------CEEEEECTTCEEEE-ECCTTCSS
T ss_pred             EEEEEE-CCEEEEecCCCcC-------------------------------------CCceEEccceEEEe-ccccCCCc
Confidence            999999 7888888873221                                     13578999999887 44568899


Q ss_pred             eEEEEecC--ceeEEEcCCHHHHHHHHHHHHHHHHHhhhh
Q 046849          394 CFRIISPV--KTYTLQAETEADRMDWTSKITGVIASLLNS  431 (760)
Q Consensus       394 ~F~i~~~~--~~~~lqA~s~~e~~~Wi~ai~~~i~~~~~~  431 (760)
                      ||+|++|+  ++|+|||+|++||++||.+|+.++..+...
T Consensus       341 ~F~i~t~~~~~~~~l~A~s~~e~~~Wi~ai~~~~~~~~~~  380 (385)
T 2q13_A          341 CFQITSFDGKKSSILQAESKKDHEEWICTINNISKQIYLS  380 (385)
T ss_dssp             EEEEECTTSCBCCCEECSSHHHHHHHHHHHHHHHTTCC--
T ss_pred             eEEEEeCCCCeEEEEEeCCHHHHHHHHHHHHHHHHhhccc
Confidence            99999999  999999999999999999999998765544
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Back     alignment and structure
>2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Back     alignment and structure
>2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Back     alignment and structure
>3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} Back     alignment and structure
>4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} Back     alignment and structure
>2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Back     alignment and structure
>3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A Back     alignment and structure
>1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* Back     alignment and structure
>2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A Back     alignment and structure
>1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A Back     alignment and structure
>3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A Back     alignment and structure
>2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Back     alignment and structure
>2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A Back     alignment and structure
>1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3ok8_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 2; I-BAR, protein binding; 2.25A {Mus musculus} Back     alignment and structure
>3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} Back     alignment and structure
>1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Back     alignment and structure
>1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* Back     alignment and structure
>2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A Back     alignment and structure
>1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A Back     alignment and structure
>2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A Back     alignment and structure
>2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>3caz_A BAR protein; thermo-acidophilic RED ALGA, protein structure initiative, PSI, center for eukaryotic structural genomics, signaling protein; 3.34A {Galdieria sulphuraria} Back     alignment and structure
>3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Back     alignment and structure
>4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} Back     alignment and structure
>1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 Back     alignment and structure
>3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A Back     alignment and structure
>3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 760
d2elba1268 a.238.1.1 (A:6-273) DCC-interacting protein 13-alp 3e-49
d1dcqa2122 g.45.1.1 (A:247-368) Pyk2-associated protein beta 2e-36
d1y2oa1248 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain 3e-26
d1btka_169 b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom 9e-22
d1urua_217 a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila 4e-21
d2d4ca1237 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sap 2e-19
d1i4da_200 a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Hum 3e-18
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 3e-17
d1fgya_127 b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 3e-15
d1eaza_103 b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 8e-15
d1wi1a_126 b.55.1.1 (A:) Calcium-dependent activator protein 2e-13
d1faoa_100 b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 9e-13
d1plsa_113 b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta 1e-12
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 2e-12
d1v89a_118 b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI 5e-12
d1v5ua_117 b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M 1e-11
d1v88a_130 b.55.1.1 (A:) Oxysterol binding protein-related pr 2e-11
d1x1ga1116 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie 3e-11
d1v5pa_126 b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 4e-11
d2coda1102 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo 4e-11
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 4e-11
d1unqa_118 b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H 4e-11
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 2e-10
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 1e-09
d1qqga1103 b.55.1.2 (A:12-114) Insulin receptor substrate 1, 1e-09
d1u5fa1111 b.55.1.1 (A:109-219) Src-associated adaptor protei 6e-09
d2fjla1101 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phosph 8e-09
d2j59m1133 b.55.1.1 (M:931-1063) Rho GTPase-activating protei 2e-08
d2dyna_111 b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId 2e-08
d1wgqa_109 b.55.1.1 (A:) FYVE, RhoGEF and PH domain containin 3e-08
d2coaa1112 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Huma 6e-08
d1x1fa1136 b.55.1.1 (A:8-143) Signal-transducing adaptor prot 7e-08
d1v5ma_136 b.55.1.1 (A:) SH2 and PH domain-containing adapter 7e-08
d2coca199 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain cont 1e-07
d1wg7a_150 b.55.1.1 (A:) Dedicator of cytokinesis protein 9, 2e-07
d1omwa2119 b.55.1.1 (A:550-668) G-protein coupled receptor ki 5e-07
d2cofa195 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) 1e-06
d1wjma_123 b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), 3e-06
d2elba2101 b.55.1.1 (A:274-374) DCC-interacting protein 13-al 5e-06
d1btna_106 b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), 1e-05
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-05
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.002
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-04
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1maia_119 b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-04
d1w1ha_147 b.55.1.1 (A:) 3-phosphoinositide dependent protein 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 0.002
d1xcga2140 b.55.1.1 (A:942-1081) Rho guanine nucleotide excha 0.002
d1zc3b1109 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 0.003
d1ki1b2142 b.55.1.1 (B:1439-1580) GEF of intersectin {Human ( 0.004
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure

class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: BAR domain
domain: DCC-interacting protein 13-alpha, APPL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  172 bits (436), Expect = 3e-49
 Identities = 53/251 (21%), Positives = 112/251 (44%), Gaps = 11/251 (4%)

Query: 7   LEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADAL-----EA 61
           LEDSP  +  L   EE A  + +   +LY+   +  +A     +     +  L     + 
Sbjct: 8   LEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQR 67

Query: 62  FGGGHDDPVSVSIGGPVISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKE 121
           F  G DD V        + +F     EL++   +L +Q+   ++  +T+F   DL +   
Sbjct: 68  FPLGGDDEVM----SSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILT 123

Query: 122 SRRRFDKSIHAYDQAREKFVSLKKNTRDD-IVAELEEDLQNSKSAFEKSRFNLVSALTNI 180
            +  F  + + +D A  ++  L K   +D +  E+ ED+  S+    ++  +   AL  +
Sbjct: 124 LKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTEDVYTSRKKQHQTMMHYFCALNTL 183

Query: 181 EAKKKYEFLESISAIMDVHLRYFKLGFDLLSK-IEPYVHQVLTYAQQSKEVANVEQDKLA 239
           + KKK   LE +   M   + +FK+G + L++ +E ++  + T  Q  +   + + + + 
Sbjct: 184 QYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQ 243

Query: 240 KRIQEFRTQAE 250
           + I++    ++
Sbjct: 244 QTIEDLEVASD 254
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Length = 200 Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 101 Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 136 Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 119 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 109 Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 100.0
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 100.0
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 99.8
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 99.79
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.79
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.78
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 99.75
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.75
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 99.74
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.74
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 99.73
d1wi1a_126 Calcium-dependent activator protein for secretion, 99.73
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 99.72
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.72
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 99.71
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 99.7
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.7
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 99.69
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 99.69
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 99.69
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 99.69
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 99.69
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 99.68
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 99.67
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 99.67
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.66
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 99.66
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.66
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.66
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 99.65
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 99.65
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 99.64
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 99.64
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 99.63
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 99.62
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.6
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.6
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 99.6
d2d4ca1237 Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 99.59
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 99.57
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 99.56
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.56
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.55
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.52
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.5
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.5
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.48
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.48
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.47
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.4
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.4
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.39
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.39
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.36
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.35
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.35
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.35
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.31
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.28
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.27
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.21
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.21
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.17
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.15
d1v61a_132 Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ 98.99
d1zc3b1109 Exocyst complex protein EXO84 {Rat (Rattus norvegi 98.84
d2dfka2162 Rho guanine nucleotide exchange factor 9, Collybis 98.66
d1dbha2133 Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ 98.44
d1ki1b2142 GEF of intersectin {Human (Homo sapiens) [TaxId: 9 98.39
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 98.28
d1ntya2121 Triple functional domain protein TRIO {Human (Homo 98.0
d1xcga2140 Rho guanine nucleotide exchange factor 11, PDZ-Rho 97.99
d1txda2114 Rho guanine nucleotide exchange factor 12 {Human ( 97.74
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 97.63
d1kz7a2147 Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId 97.38
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 97.0
d1fhoa_119 UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 96.94
d2adza1105 Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 96.21
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 96.12
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 95.25
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 94.04
d2zkmx3131 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 93.0
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 88.39
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 84.3
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 82.12
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: BAR/IMD domain-like
superfamily: BAR/IMD domain-like
family: BAR domain
domain: DCC-interacting protein 13-alpha, APPL1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-38  Score=326.38  Aligned_cols=242  Identities=21%  Similarity=0.353  Sum_probs=216.3

Q ss_pred             cccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhchHHHHHHHHHhhCC-----CCCCCccccchhH
Q 046849            4 FIKLEDSPMFQKQLFSMEESAEELKDRCQRLYKGCKKFTEALGVACSGDSAFADALEAFGGG-----HDDPVSVSIGGPV   78 (760)
Q Consensus         4 ~e~~~DSP~FRa~l~~~e~~l~~l~~~l~kl~k~~k~~~~~~~~~~~~~~~~~~~l~~~~~~-----~~d~~~~~~~~~~   78 (760)
                      =||++|||.||++|+++|++++.++.||++|+|.|+.|+++++.++.++..|+++|.+++..     .+|+.    .+.+
T Consensus         5 ~E~~~DSP~FRa~l~~~E~~~~~l~~~l~kl~k~~~~~~~~~~~~~~~~~~f~~~L~~~~~~~~~~~~dd~~----~~~~   80 (268)
T d2elba1           5 EETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHLTSKLLKEYEKQRFPLGGDDEV----MSST   80 (268)
T ss_dssp             GGTTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTGGGSCCC-----CH----HHHH
T ss_pred             HHHHhcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcccccCCcHH----HHHH
Confidence            38999999999999999999999999999999999999999999999999999999987632     22222    1578


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHhhhhcCCChhh-HHHHHH
Q 046849           79 ISKFISAFRELATYKELLRSQVEHVLINRLTEFLTVDLHDAKESRRRFDKSIHAYDQAREKFVSLKKNTRDDI-VAELEE  157 (760)
Q Consensus        79 l~~f~~~l~el~~~~~~l~~~~~~~~~~pL~~f~~~~l~~~ke~rk~fek~~~~Yd~al~ky~s~~k~k~~~~-~~e~~~  157 (760)
                      |.+|+.++++++.++..++.+++..++.||.+|++++|+++++.||+|++.+.+||++++||++++|+++++. ..|++.
T Consensus        81 l~~f~~~~~el~~~~~~l~~~~~~~~~~pL~~f~~~di~~~ke~kk~fek~~~~yd~~l~k~~~~~k~k~~~~~~~Ea~~  160 (268)
T d2elba1          81 LQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKERDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYEVTE  160 (268)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTCCCC-----HHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCcchhhhhHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999998877554 458889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHH-hhhhHHHHHHHHHHHHHHHHHHHHHH
Q 046849          158 DLQNSKSAFEKSRFNLVSALTNIEAKKKYEFLESISAIMDVHLRYFKLGFDLL-SKIEPYVHQVLTYAQQSKEVANVEQD  236 (760)
Q Consensus       158 ~l~~~Rk~f~~asldyv~~i~~l~~~k~~e~l~~l~~~~~a~~~ff~~g~~~~-~~~~~~~~~l~~~~~~~r~~~~~~~~  236 (760)
                      +|+++|+.|+++++||+..|+.++.++++++|+.+++|++++++||++|++.+ .++++|++++..|+++.+..++.+++
T Consensus       161 ~l~~~r~~f~~~~~d~~~~l~~l~~~k~~~~l~~l~~~~~a~~~ff~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~~~~~  240 (268)
T d2elba1         161 DVYTSRKKQHQTMMHYFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIE  240 (268)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999988 57999999999999999998888776


Q ss_pred             HHHHHHHHHhhhh
Q 046849          237 KLAKRIQEFRTQA  249 (760)
Q Consensus       237 ~l~~~~~~~~~~~  249 (760)
                      .+...|++.....
T Consensus       241 ~~~~~~~~~~~~~  253 (268)
T d2elba1         241 TMQQTIEDLEVAS  253 (268)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHccc
Confidence            6666666555443
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure