Citrus Sinensis ID: 046854

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL
ccccccccccccccccHHHHcccccccccEEEEcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccccccc
ccccccccccccccHHHHHHHcHHHHHccEEEEccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccc
sksggitgwepagapswiellnpieflDEVIIEHDYVECTASALKAMTLFQklhpkhrkneVNNFIINAVKFIEdlqkpdgswygrwgvCFIYSTWWAISGLVAAEktysnclpirkaTDFLLniqcgdggwgesylscpnkvkl
sksggitgwepagapsWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGdggwgesylscpnkvkl
SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL
*******GWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSC******
SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL
SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL
****GITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
E2IUA7767 Glutinol synthase OS=Kala N/A no 0.979 0.185 0.640 1e-54
E2IUA9765 Lupeol synthase OS=Kalanc N/A no 0.979 0.185 0.633 2e-54
O82140763 Beta-Amyrin Synthase 1 OS N/A no 0.979 0.186 0.640 2e-54
A8CDT2759 Beta-amyrin synthase OS=B N/A no 0.979 0.187 0.640 2e-54
E2IUA6779 Taraxerol synthase OS=Kal N/A no 0.979 0.182 0.640 4e-54
E2IUA8767 Friedelin synthase OS=Kal N/A no 0.979 0.185 0.633 7e-54
O82146761 Beta-Amyrin Synthase 2 OS N/A no 0.979 0.186 0.626 3e-53
E7DN64763 Delta-amyrin synthase OS= N/A no 0.986 0.187 0.615 3e-53
Q2XPU7769 Lupeol synthase OS=Ricinu N/A no 0.986 0.185 0.615 1e-52
A8CDT3761 Lupeol synthase OS=Brugui N/A no 0.986 0.187 0.608 2e-52
>sp|E2IUA7|GLUTS_KALDA Glutinol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function desciption
 Score =  211 bits (537), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (78%)

Query: 1   SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
           SK+GG+ GWEPAGA  W+ELLNP EF + ++IEH+YVECT+SA++A+ LF+KLHP HR+ 
Sbjct: 526 SKNGGMPGWEPAGASEWLELLNPTEFFENIVIEHEYVECTSSAVQALVLFKKLHPGHRRK 585

Query: 61  EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATD 120
           EV  FI N  K+IED+Q PDG+WYG WGVCF Y  W+A+ GL AA KTY+NC  +RK  D
Sbjct: 586 EVERFITNGAKYIEDIQMPDGAWYGNWGVCFTYGAWFALGGLAAAGKTYNNCAAVRKGVD 645

Query: 121 FLLNIQCGDGGWGESYLSCPNK 142
           FLL IQ  DGGWGESY SCP+K
Sbjct: 646 FLLRIQLEDGGWGESYQSCPDK 667
Oxidosqualene cyclase that generates glutinol, a triterpenoid product. Glutinol is probably required to coat the leaf exterior as a defense compound against pathogens or herbivores.
Kalanchoe daigremontiana (taxid: 23013)
EC: 5EC: .EC: 4EC: .EC: 9EC: 9EC: .EC: 4EC: 9
>sp|E2IUA9|LUPS_KALDA Lupeol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|O82140|BAMS1_PANGI Beta-Amyrin Synthase 1 OS=Panax ginseng GN=OSCPNY1 PE=1 SV=1 Back     alignment and function description
>sp|A8CDT2|BAS_BRUGY Beta-amyrin synthase OS=Bruguiera gymnorhiza GN=BAS PE=1 SV=1 Back     alignment and function description
>sp|E2IUA6|TARS_KALDA Taraxerol synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|E2IUA8|FRIES_KALDA Friedelin synthase OS=Kalanchoe daigremontiana PE=1 SV=1 Back     alignment and function description
>sp|O82146|BAMS2_PANGI Beta-Amyrin Synthase 2 OS=Panax ginseng GN=OSCPNY2 PE=2 SV=1 Back     alignment and function description
>sp|E7DN64|DAMS_SOLLC Delta-amyrin synthase OS=Solanum lycopersicum GN=TTS2 PE=1 SV=1 Back     alignment and function description
>sp|Q2XPU7|LUPS_RICCO Lupeol synthase OS=Ricinus communis PE=1 SV=1 Back     alignment and function description
>sp|A8CDT3|LUPS_BRUGY Lupeol synthase OS=Bruguiera gymnorhiza GN=LUS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
300431227 763 beta-amyrin synthase [Aralia elata] 0.986 0.187 0.650 6e-54
224057567 759 predicted protein [Populus trichocarpa] 0.979 0.187 0.654 2e-53
403399398 767 RecName: Full=Glutinol synthase; Short=K 0.979 0.185 0.640 8e-53
46242744 762 beta-armyrin synthase [Bupleurum kaoi] 0.965 0.183 0.65 9e-53
297735719 910 unnamed protein product [Vitis vinifera] 0.979 0.156 0.654 9e-53
225443448 769 PREDICTED: beta-Amyrin Synthase 1 [Vitis 0.979 0.184 0.654 1e-52
147840575 755 hypothetical protein VITISV_033299 [Viti 0.979 0.188 0.654 1e-52
403399452 765 RecName: Full=Lupeol synthase; Short=KdL 0.979 0.185 0.633 1e-52
75220214 763 RecName: Full=Beta-Amyrin Synthase 1 gi| 0.979 0.186 0.640 1e-52
392621787 763 lupeol synthase [Eleutherococcus trifoli 0.986 0.187 0.643 1e-52
>gi|300431227|gb|ADK12003.1| beta-amyrin synthase [Aralia elata] Back     alignment and taxonomy information
 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 117/143 (81%)

Query: 1   SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
           SK+GG+  WEPAGA  W+ELLNP EF  +++IEH+YVECT+SA++A+ LF+KL+P HRK 
Sbjct: 527 SKNGGLAAWEPAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIQALVLFKKLYPGHRKK 586

Query: 61  EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATD 120
           E++NFI+NAV+++ED+Q PDGSWYG WGVCF Y +W+A+ GL AA KTY NC  +RKA D
Sbjct: 587 EIDNFIMNAVRYLEDIQMPDGSWYGNWGVCFTYGSWFALGGLAAAGKTYYNCAAVRKAVD 646

Query: 121 FLLNIQCGDGGWGESYLSCPNKV 143
           FLL  Q  DGGWGESYLSCP KV
Sbjct: 647 FLLKSQMDDGGWGESYLSCPKKV 669

Source: Aralia elata

Species: Aralia elata

Genus: Aralia

Family: Araliaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224057567|ref|XP_002299271.1| predicted protein [Populus trichocarpa] gi|222846529|gb|EEE84076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|403399398|sp|E2IUA7.1|GLUTS_KALDA RecName: Full=Glutinol synthase; Short=KdGLS gi|300807976|gb|ADK35124.1| glutinol synthase [Kalanchoe daigremontiana] Back     alignment and taxonomy information
>gi|46242744|gb|AAS83468.1| beta-armyrin synthase [Bupleurum kaoi] Back     alignment and taxonomy information
>gi|297735719|emb|CBI18406.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225443448|ref|XP_002271333.1| PREDICTED: beta-Amyrin Synthase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147840575|emb|CAN77299.1| hypothetical protein VITISV_033299 [Vitis vinifera] Back     alignment and taxonomy information
>gi|403399452|sp|E2IUA9.1|LUPS_KALDA RecName: Full=Lupeol synthase; Short=KdLUS gi|300807980|gb|ADK35126.1| lupeol synthase [Kalanchoe daigremontiana] Back     alignment and taxonomy information
>gi|75220214|sp|O82140.1|BAMS1_PANGI RecName: Full=Beta-Amyrin Synthase 1 gi|3688600|dbj|BAA33461.1| beta-Amyrin Synthase [Panax ginseng] Back     alignment and taxonomy information
>gi|392621787|gb|AFM82492.1| lupeol synthase [Eleutherococcus trifoliatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
UNIPROTKB|A8CDT2759 BAS "Beta-amyrin synthase" [Br 0.979 0.187 0.640 1.9e-53
UNIPROTKB|E2IUA7767 E2IUA7 "Glutinol synthase" [Ka 0.979 0.185 0.640 1.9e-53
UNIPROTKB|E2IUA9765 E2IUA9 "Lupeol synthase" [Kala 0.979 0.185 0.633 3e-53
UNIPROTKB|E2IUA6779 E2IUA6 "Taraxerol synthase" [K 0.979 0.182 0.640 6.8e-53
UNIPROTKB|E2IUA8767 E2IUA8 "Friedelin synthase" [K 0.979 0.185 0.633 8e-53
UNIPROTKB|Q2XPU7769 Q2XPU7 "Lupeol synthase" [Rici 0.986 0.185 0.615 8.4e-52
UNIPROTKB|A8CDT3761 LUS "Lupeol synthase" [Bruguie 0.986 0.187 0.608 1.2e-51
UNIPROTKB|Q8W3Z1 779 OSCBPY "Beta-amyrin synthase" 0.979 0.182 0.612 7e-51
UNIPROTKB|F8WQD0761 SHS1 "Shionone synthase" [Aste 0.986 0.187 0.566 1.1e-48
UNIPROTKB|Q9LRH7764 OSCPSM "Mixed-amyrin synthase" 0.979 0.185 0.598 4.1e-48
UNIPROTKB|A8CDT2 BAS "Beta-amyrin synthase" [Bruguiera gymnorhiza (taxid:39984)] Back     alignment and assigned GO terms
 Score = 553 (199.7 bits), Expect = 1.9e-53, P = 1.9e-53
 Identities = 91/142 (64%), Positives = 116/142 (81%)

Query:     1 SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
             SK+GG++ WEPAGA  W+ELLNP EF  +++IEH+YVECT+SA+ A+ LF+KL+P HRK 
Sbjct:   526 SKNGGLSAWEPAGAQEWLELLNPTEFFADIVIEHEYVECTSSAIHALVLFKKLYPGHRKK 585

Query:    61 EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATD 120
             E++NFI+NAV+++E +Q  DG WYG WGVCF Y TW+A+ GL AA KTY+NCL +RKA D
Sbjct:   586 EIDNFIVNAVRYLESIQTSDGGWYGNWGVCFTYGTWFALGGLAAAGKTYNNCLAMRKAVD 645

Query:   121 FLLNIQCGDGGWGESYLSCPNK 142
             FLL IQ  +GGWGESYLSCP K
Sbjct:   646 FLLRIQRDNGGWGESYLSCPEK 667
GO:0016104 "triterpenoid biosynthetic process" evidence=IDA
GO:0042300 "beta-amyrin synthase activity" evidence=IDA
UNIPROTKB|E2IUA7 E2IUA7 "Glutinol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA9 E2IUA9 "Lupeol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA6 E2IUA6 "Taraxerol synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|E2IUA8 E2IUA8 "Friedelin synthase" [Kalanchoe daigremontiana (taxid:23013)] Back     alignment and assigned GO terms
UNIPROTKB|Q2XPU7 Q2XPU7 "Lupeol synthase" [Ricinus communis (taxid:3988)] Back     alignment and assigned GO terms
UNIPROTKB|A8CDT3 LUS "Lupeol synthase" [Bruguiera gymnorhiza (taxid:39984)] Back     alignment and assigned GO terms
UNIPROTKB|Q8W3Z1 OSCBPY "Beta-amyrin synthase" [Betula platyphylla (taxid:78630)] Back     alignment and assigned GO terms
UNIPROTKB|F8WQD0 SHS1 "Shionone synthase" [Aster tataricus (taxid:588669)] Back     alignment and assigned GO terms
UNIPROTKB|Q9LRH7 OSCPSM "Mixed-amyrin synthase" [Pisum sativum (taxid:3888)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.4.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
PLN02993763 PLN02993, PLN02993, lupeol synthase 3e-63
PLN03012759 PLN03012, PLN03012, Camelliol C synthase 4e-62
cd02892634 cd02892, SQCY_1, Squalene cyclase (SQCY) domain su 2e-61
cd02889348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 1e-53
TIGR01787621 TIGR01787, squalene_cyclas, squalene/oxidosqualene 2e-49
TIGR03463634 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase 7e-34
COG1657517 COG1657, SqhC, Squalene cyclase [Lipid metabolism] 3e-23
cd00688300 cd00688, ISOPREN_C2_like, This group contains clas 2e-18
TIGR01507635 TIGR01507, hopene_cyclase, squalene-hopene cyclase 7e-13
pfam13249112 pfam13249, Prenyltrans_2, Prenyltransferase-like 3e-11
TIGR04277624 TIGR04277, squa_tetra_cyc, squalene--tetrahymanol 1e-08
pfam13243109 pfam13243, Prenyltrans_1, Prenyltransferase-like 1e-08
cd00688 300 cd00688, ISOPREN_C2_like, This group contains clas 2e-08
pfam13249112 pfam13249, Prenyltrans_2, Prenyltransferase-like 1e-07
pfam0043244 pfam00432, Prenyltrans, Prenyltransferase and squa 4e-07
cd02894 287 cd02894, GGTase-II, Geranylgeranyltransferase type 3e-05
cd00688 300 cd00688, ISOPREN_C2_like, This group contains clas 9e-05
TIGR01507635 TIGR01507, hopene_cyclase, squalene-hopene cyclase 9e-05
cd02889 348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 2e-04
cd02889 348 cd02889, SQCY, Squalene cyclase (SQCY) domain; fou 0.003
>gnl|CDD|215537 PLN02993, PLN02993, lupeol synthase Back     alignment and domain information 
 Score =  205 bits (523), Expect = 3e-63
 Identities = 80/142 (56%), Positives = 106/142 (74%)

Query: 1   SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
           S++GG+T WEP  A  W+ELLNP +F    ++E +YVECT++ ++A+ LF++L+P HR  
Sbjct: 527 SENGGVTAWEPVRAYKWLELLNPTDFFANTMVEREYVECTSAVIQALVLFKQLYPDHRTK 586

Query: 61  EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATD 120
           E+   I  AV+FIE  Q PDGSWYG WG+CFIY+TW+A+ GL AA KTY++CL +RK   
Sbjct: 587 EIIKSIEKAVQFIESKQTPDGSWYGNWGICFIYATWFALGGLAAAGKTYNDCLAMRKGVH 646

Query: 121 FLLNIQCGDGGWGESYLSCPNK 142
           FLL IQ  DGGWGESYLSCP +
Sbjct: 647 FLLTIQRDDGGWGESYLSCPEQ 668

Length = 763
>gnl|CDD|166653 PLN03012, PLN03012, Camelliol C synthase Back     alignment and domain information
>gnl|CDD|239222 cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|233578 TIGR01787, squalene_cyclas, squalene/oxidosqualene cyclases Back     alignment and domain information
>gnl|CDD|234220 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase Back     alignment and domain information
>gnl|CDD|224571 COG1657, SqhC, Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|233442 TIGR01507, hopene_cyclase, squalene-hopene cyclase Back     alignment and domain information
>gnl|CDD|222007 pfam13249, Prenyltrans_2, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|212000 TIGR04277, squa_tetra_cyc, squalene--tetrahymanol cyclase Back     alignment and domain information
>gnl|CDD|205423 pfam13243, Prenyltrans_1, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|222007 pfam13249, Prenyltrans_2, Prenyltransferase-like Back     alignment and domain information
>gnl|CDD|109488 pfam00432, Prenyltrans, Prenyltransferase and squalene oxidase repeat Back     alignment and domain information
>gnl|CDD|239224 cd02894, GGTase-II, Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>gnl|CDD|238362 cd00688, ISOPREN_C2_like, This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>gnl|CDD|233442 TIGR01507, hopene_cyclase, squalene-hopene cyclase Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
PLN03012759 Camelliol C synthase 100.0
PLN02993763 lupeol synthase 100.0
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 99.97
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 99.96
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 99.96
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 99.96
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 99.94
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in clas 99.83
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 99.83
PLN03012759 Camelliol C synthase 99.77
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 99.75
PLN02993763 lupeol synthase 99.71
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 99.71
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 99.7
PLN03201 316 RAB geranylgeranyl transferase beta-subunit; Provi 99.67
cd02890 286 PTase Protein prenyltransferase (PTase) domain, be 99.67
cd02894 287 GGTase-II Geranylgeranyltransferase type II (GGTas 99.67
KOG0366 329 consensus Protein geranylgeranyltransferase type I 99.65
cd02893 299 FTase Protein farnesyltransferase (FTase)_like pro 99.6
cd02895 307 GGTase-I Geranylgeranyltransferase types I (GGTase 99.59
PLN02710 439 farnesyltranstransferase subunit beta 99.58
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 99.55
cd02894287 GGTase-II Geranylgeranyltransferase type II (GGTas 99.54
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 99.54
COG5029 342 CAL1 Prenyltransferase, beta subunit [Posttranslat 99.54
cd00688300 ISOPREN_C2_like This group contains class II terpe 99.54
cd02892 634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 99.52
cd02890286 PTase Protein prenyltransferase (PTase) domain, be 99.51
PF13249113 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 99.49
cd00688 300 ISOPREN_C2_like This group contains class II terpe 99.48
cd02895307 GGTase-I Geranylgeranyltransferase types I (GGTase 99.47
PLN03201316 RAB geranylgeranyl transferase beta-subunit; Provi 99.46
PF13243109 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 99.45
KOG0365 423 consensus Beta subunit of farnesyltransferase [Pos 99.45
cd02889 348 SQCY Squalene cyclase (SQCY) domain; found in clas 99.45
PLN02710 439 farnesyltranstransferase subunit beta 99.35
cd02897292 A2M_2 Proteins similar to alpha2-macroglobulin (al 99.35
cd02893299 FTase Protein farnesyltransferase (FTase)_like pro 99.34
cd02896297 complement_C3_C4_C5 Proteins similar to C3, C4 and 99.2
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 99.16
KOG0367 347 consensus Protein geranylgeranyltransferase Type I 99.15
COG5029342 CAL1 Prenyltransferase, beta subunit [Posttranslat 99.14
cd02897 292 A2M_2 Proteins similar to alpha2-macroglobulin (al 99.13
cd02896 297 complement_C3_C4_C5 Proteins similar to C3, C4 and 99.1
cd02891282 A2M_like Proteins similar to alpha2-macroglobulin 99.04
TIGR02474 290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 99.02
cd02891 282 A2M_like Proteins similar to alpha2-macroglobulin 99.02
PF07678 246 A2M_comp: A-macroglobulin complement component; In 98.94
KOG0365 423 consensus Beta subunit of farnesyltransferase [Pos 98.9
KOG0366329 consensus Protein geranylgeranyltransferase type I 98.89
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 98.88
KOG0497760 consensus Oxidosqualene-lanosterol cyclase and rel 98.84
PF01122326 Cobalamin_bind: Eukaryotic cobalamin-binding prote 98.71
PF09492 289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 98.55
KOG0367347 consensus Protein geranylgeranyltransferase Type I 98.44
PF07678 246 A2M_comp: A-macroglobulin complement component; In 98.34
) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF0043244 Prenyltrans: Prenyltransferase and squalene oxidas 98.21
COG1689274 Uncharacterized protein conserved in archaea [Func 97.9
COG1657517 SqhC Squalene cyclase [Lipid metabolism] 97.73
COG1689274 Uncharacterized protein conserved in archaea [Func 97.6
PF09492289 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 97.33
PLN02592 800 ent-copalyl diphosphate synthase 97.12
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 96.28
PLN02279 784 ent-kaur-16-ene synthase 96.24
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 95.93
PLN02592 800 ent-copalyl diphosphate synthase 95.8
PF01122326 Cobalamin_bind: Eukaryotic cobalamin-binding prote 95.0
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 94.4
PLN02279 784 ent-kaur-16-ene synthase 94.06
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 92.91
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 92.07
COG4225357 Predicted unsaturated glucuronyl hydrolase involve 92.03
COG2373 1621 Large extracellular alpha-helical protein [General 91.67
cd00249 384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d 91.39
KOG1366 1436 consensus Alpha-macroglobulin [Posttranslational m 90.54
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 90.48
PF07221 346 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN 89.83
PF07944 520 DUF1680: Putative glycosyl hydrolase of unknown fu 89.34
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 87.92
>PLN03012 Camelliol C synthase Back     alignment and domain information 
Probab=100.00  E-value=1.6e-37  Score=265.54  Aligned_cols=145  Identities=57%  Similarity=1.196  Sum_probs=138.4

Q ss_pred             CCCCCccccccccccchhhhcCccccccCccccCCChhHHHHHHHHHHHhhhhCCccchhhhHHHHHHHHHHHHHhCCCC
Q 046854            1 SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPD   80 (145)
Q Consensus         1 n~dGgw~~~~~~~~~~~l~~~~~~~~~~~~~~d~~~~~~T~~al~aL~~~~~~~~~~~~~~i~~~i~ka~~~L~~~Q~~d   80 (145)
                      |+||||++|+.+++..||+.|||.|.|+++++|++++++|+.+|.+|..+++..|.++.++++++|+||++||++.|++|
T Consensus       527 n~dGGwaafe~~~~~~~le~lnp~E~F~d~mid~~y~dcTa~~l~aL~~f~~~~~~~r~~~i~~~i~rAv~~L~~~Q~~D  606 (759)
T PLN03012        527 SKNGGMTAWEPAGAPEWLELLNPTEMFADIVIEHEYNECTSSAIQALILFKQLYPDHRTEEINAFIKKAAEYIENIQMLD  606 (759)
T ss_pred             CCCCCEeeecCCcchHHHHhcChhhhhcCeecCCCcccHHHHHHHHHHHHhhhCcccchhhhHHHHHHHHHHHHHhcCCC
Confidence            78999999999999999999999999999999999999999999999999988777777778899999999999999999


Q ss_pred             CCccccCCcchhhHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHhcccCCCCcCCCCCCCCCCccC
Q 046854           81 GSWYGRWGVCFIYSTWWAISGLVAAEKTYSNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL  145 (145)
Q Consensus        81 G~w~~~~g~~~~~~T~~al~aL~~~g~~~~~~~~v~~a~~~L~~~Q~~dGgwg~~~~s~~~~~~~  145 (145)
                      |||.++|+.+++|+|++||.+|.++|..+...+.|+||++||+++|++|||||++..||+++.|+
T Consensus       607 GsW~G~Wgv~y~YgT~~aL~aL~a~g~~~~~~~~Irrav~fLls~Q~~DGGWGEs~~Sc~~~~y~  671 (759)
T PLN03012        607 GSWYGNWGICFTYGTWFALAGLAAAGKTFNDCEAIRKGVHFLLAAQKDNGGWGESYLSCPKKIYI  671 (759)
T ss_pred             CCCcccccccCCcHHHHHHHHHHHhCccCCCcHHHHHHHHHHHHhcCCCCCcCCCCCCCCCcccc
Confidence            99999999999999999999999999876566999999999999999999999999999999986

>PLN02993 lupeol synthase Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>PLN03012 Camelliol C synthase Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>COG5029 CAL1 Prenyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C Back     alignment and domain information
>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement Back     alignment and domain information
>cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional Back     alignment and domain information
>PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A Back     alignment and domain information
>KOG0365 consensus Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PLN02710 farnesyltranstransferase subunit beta Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>KOG0367 consensus Protein geranylgeranyltransferase Type I, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5029 CAL1 Prenyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>KOG0365 consensus Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF01122 Cobalamin_bind: Eukaryotic cobalamin-binding protein; InterPro: IPR002157 Cobalamin (Cbl or vitamin B12) is only accessible through diet in mammals Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>KOG0367 consensus Protein geranylgeranyltransferase Type I, beta subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family Back     alignment and domain information
>PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family Back     alignment and domain information
>COG1689 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>COG1657 SqhC Squalene cyclase [Lipid metabolism] Back     alignment and domain information
>COG1689 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information
>PLN02592 ent-copalyl diphosphate synthase Back     alignment and domain information
>PF01122 Cobalamin_bind: Eukaryotic cobalamin-binding protein; InterPro: IPR002157 Cobalamin (Cbl or vitamin B12) is only accessible through diet in mammals Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>PLN02279 ent-kaur-16-ene synthase Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>COG2373 Large extracellular alpha-helical protein [General function prediction only] Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>KOG1366 consensus Alpha-macroglobulin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5 Back     alignment and domain information
>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
1w6j_A732 Structure Of Human Osc In Complex With Ro 48-8071 L 5e-29
1w6k_A732 Structure Of Human Osc In Complex With Lanosterol L 5e-29
1gsz_A631 Crystal Structure Of A Squalene Cyclase In Complex 2e-09
2sqc_A631 Squalene-Hopene Cyclase From Alicyclobacillus Acido 2e-09
3sqc_A631 Squalene-Hopene Cyclase Length = 631 2e-09
3pz1_B 330 Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) 5e-04
1dce_B 331 Crystal Structure Of Rab Geranylgeranyltransferase 5e-04
>pdb|1W6J|A Chain A, Structure Of Human Osc In Complex With Ro 48-8071 Length = 732 Back     alignment and structure 
Iteration: 1

 Score =  122 bits (307), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 81/142 (57%), Gaps = 3/142 (2%)
Query: 4   GGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVN 63
           GG   +E       +ELLNP E   +++I++ YVECT++ ++A+  F K  P+HR  E+ 
Sbjct: 498 GGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIR 557
Query: 64  NFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSN---CLPIRKATD 120
             +   ++F    Q+ DGSW G WGVCF Y TW+ +       +TY +   C  + +A D
Sbjct: 558 ETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACD 617
Query: 121 FLLNIQCGDGGWGESYLSCPNK 142
           FLL+ Q  DGGWGE + SC  +
Sbjct: 618 FLLSRQMADGGWGEDFESCEER 639
>pdb|1W6K|A Chain A, Structure Of Human Osc In Complex With Lanosterol Length = 732 Back     alignment and structure
>pdb|1GSZ|A Chain A, Crystal Structure Of A Squalene Cyclase In Complex With The Potential Anticholesteremic Drug Ro48-8071 Length = 631 Back     alignment and structure
>pdb|2SQC|A Chain A, Squalene-Hopene Cyclase From Alicyclobacillus Acidocaldarius Length = 631 Back     alignment and structure
>pdb|3SQC|A Chain A, Squalene-Hopene Cyclase Length = 631 Back     alignment and structure
>pdb|3PZ1|B Chain B, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) In Complex With Bms3 Length = 330 Back     alignment and structure
>pdb|1DCE|B Chain B, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 331 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 3e-39
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 2e-09
1w6k_A 732 Lanosterol synthase; cyclase, cholesterol, monotop 6e-06
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 1e-33
2sqc_A 631 Squalene-hopene cyclase; isomerase, triterpene cyc 3e-08
1r76_A 408 Pectate lyase; A-helical structure; 2.65A {Azospir 5e-09
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 4e-05
3dss_B 331 Geranylgeranyl transferase type-2 subunit beta; pr 4e-08
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 2e-06
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 7e-06
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 6e-05
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
 Score =  139 bits (350), Expect = 3e-39
 Identities = 54/146 (36%), Positives = 82/146 (56%), Gaps = 3/146 (2%)

Query: 1   SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
           +  GG   +E       +ELLNP E   +++I++ YVECT++ ++A+  F K  P+HR  
Sbjct: 495 NPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAA 554

Query: 61  EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSN---CLPIRK 117
           E+   +   ++F    Q+ DGSW G WGVCF Y TW+ +       +TY +   C  + +
Sbjct: 555 EIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSR 614

Query: 118 ATDFLLNIQCGDGGWGESYLSCPNKV 143
           A DFLL+ Q  DGGWGE + SC  + 
Sbjct: 615 ACDFLLSRQMADGGWGEDFESCEERR 640
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Length = 408 Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Length = 408 Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* Length = 331 Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Length = 414 Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Length = 520 Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Length = 437 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 99.95
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 99.9
1n4q_B 377 Geranyltransferase type-I beta subunit; protein ge 99.89
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 99.85
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 99.84
3dss_B 331 Geranylgeranyl transferase type-2 subunit beta; pr 99.79
3dss_B331 Geranylgeranyl transferase type-2 subunit beta; pr 99.75
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospir 99.74
2h6f_B 437 Protein farnesyltransferase beta subunit; ftase, f 99.69
1gxm_A332 Pectate lyase; mechanism, elimination; 1.32A {Cell 99.67
2sqc_A631 Squalene-hopene cyclase; isomerase, triterpene cyc 99.62
1w6k_A 732 Lanosterol synthase; cyclase, cholesterol, monotop 99.58
3dra_B 390 Geranylgeranyltransferase type I beta subunit; ger 99.53
1qqf_A277 Protein (complement C3DG); alpha-alpha barrel, imm 99.5
2wy7_A 310 Complement C3D fragment; immune system, immune res 99.48
1gxm_A 332 Pectate lyase; mechanism, elimination; 1.32A {Cell 99.43
3q7a_B 520 Farnesyltransferase beta subunit; protein prenyltr 99.42
1n4q_B 377 Geranyltransferase type-I beta subunit; protein ge 99.42
1r76_A 408 Pectate lyase; A-helical structure; 2.65A {Azospir 99.35
1hzf_A 367 Complement factor C4A; alpha-alpha 6 barrel, immun 99.33
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 99.26
2pmv_A 399 Gastric intrinsic factor; cobalamin transport prot 99.22
1hzf_A 367 Complement factor C4A; alpha-alpha 6 barrel, immun 99.19
3dra_B 390 Geranylgeranyltransferase type I beta subunit; ger 99.04
1qqf_A 277 Protein (complement C3DG); alpha-alpha barrel, imm 99.03
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 99.02
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 99.01
2wy7_A 310 Complement C3D fragment; immune system, immune res 98.97
2hr0_B 915 Complement C3 alpha' chain; complement component C 98.92
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 98.48
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 98.36
2hr0_B 915 Complement C3 alpha' chain; complement component C 98.34
2bb6_A 414 TCII, TC II, transcobalamin II; alpha_6 - alpha_6 98.13
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 98.12
4fxk_B 767 Complement C4-A alpha chain; immune system, proteo 98.03
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 97.93
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 97.9
3prx_B 1642 Cobra venom factor; immune system, complement, imm 97.64
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 97.61
2pmv_A 399 Gastric intrinsic factor; cobalamin transport prot 97.57
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 97.41
3prx_B 1642 Cobra venom factor; immune system, complement, imm 97.38
3pya_A 727 ENT-copalyl diphosphate synthase, chloroplastic; c 97.31
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 97.28
3sdr_A 817 Alpha-bisabolene synthase; lyase, terpene synthase 97.26
3s9v_A 785 Abietadiene synthase, chloroplastic; alpha bundle/ 97.25
3pmm_A382 Putative cytoplasmic protein; structural genomics, 96.4
3k11_A445 Putative glycosyl hydrolase; structural genomics, 96.11
3s9v_A 785 Abietadiene synthase, chloroplastic; alpha bundle/ 95.96
3sdr_A 817 Alpha-bisabolene synthase; lyase, terpene synthase 95.89
3p5p_A 764 Taxadiene synthase; class I and II terpene cyclase 95.67
1nc5_A373 Hypothetical protein YTER; structural genomics, he 95.22
3pya_A 727 ENT-copalyl diphosphate synthase, chloroplastic; c 95.04
2gz6_A 388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 93.36
3gt5_A 402 N-acetylglucosamine 2-epimerase; structural genomi 91.12
3k11_A 445 Putative glycosyl hydrolase; structural genomics, 90.63
1fp3_A 402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 90.24
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 89.87
3pmm_A382 Putative cytoplasmic protein; structural genomics, 89.64
1ulv_A 1020 Glucodextranase; GH family 15, (alpha-alpha)6-barr 89.57
2dna_A67 Unnamed protein product; ubiquitin associated doma 88.94
1lf6_A 684 Glucoamylase; (alpha/alpha) barrel, 6 alpha-helica 88.92
1lf6_A 684 Glucoamylase; (alpha/alpha) barrel, 6 alpha-helica 88.61
1nc5_A373 Hypothetical protein YTER; structural genomics, he 86.16
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 85.61
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 83.74
1ulv_A 1020 Glucodextranase; GH family 15, (alpha-alpha)6-barr 81.88
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 81.34
1wji_A63 Tudor domain containing protein 3; UBA domain, str 80.23
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 80.15
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
Probab=99.95  E-value=3.1e-27  Score=203.01  Aligned_cols=144  Identities=37%  Similarity=0.822  Sum_probs=128.2

Q ss_pred             CCCCCccccccccccchhhhcCccccccCccccCCChhHHHHHHHHHHHhhhhCCccchhhhHHHHHHHHHHHHHhCCCC
Q 046854            1 SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPD   80 (145)
Q Consensus         1 n~dGgw~~~~~~~~~~~l~~~~~~~~~~~~~~d~~~~~~T~~al~aL~~~~~~~~~~~~~~i~~~i~ka~~~L~~~Q~~d   80 (145)
                      |+||||++|+.+++..+++.+||.+.|++.+++++++++|+++|.+|..++...|.++.++++++++|+++||+++|++|
T Consensus       495 ~~DGgw~a~~~~~~~~~l~~i~~~e~fg~~~~d~s~v~~Ta~vL~aL~~~~~~~~~~~~~~~~~~i~rAv~yL~~~Q~~D  574 (732)
T 1w6k_A          495 NPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRAD  574 (732)
T ss_dssp             CTTSCBCSSSCCCSCGGGGGGCCCSSCSSCSSCCCBHHHHHHHHHHHHHHHHHCTTSSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             CCCCCEEeecCCCchHHHhhCcchhcccccccCCCcchHHHHHHHHHHHhccccccccchhhHHHHHHHHHHHHhhcCCC
Confidence            68999999999999999999999999999899999999999999999999876666555567788999999999999999


Q ss_pred             CCccccCCcchhhHHHHHHHHHHHcCCCCCCc---HHHHHHHHHHHhcccCCCCcCCCCCCCCCCcc
Q 046854           81 GSWYGRWGVCFIYSTWWAISGLVAAEKTYSNC---LPIRKATDFLLNIQCGDGGWGESYLSCPNKVK  144 (145)
Q Consensus        81 G~w~~~~g~~~~~~T~~al~aL~~~g~~~~~~---~~v~~a~~~L~~~Q~~dGgwg~~~~s~~~~~~  144 (145)
                      |+|.+.|+.+++|.|++|+.+|..+|......   +.++|+++||+++|++||||++...+|+++.|
T Consensus       575 GsW~g~wg~~~~Y~T~~al~AL~~aG~~~~~~~~~~~i~rav~~Lls~Q~~DGGWge~~~s~~~~~y  641 (732)
T 1w6k_A          575 GSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRY  641 (732)
T ss_dssp             SCCCCSSBSSHHHHHHHHHHHHHHTTCCCBTTBCCHHHHHHHHHHHTTCCTTSCCCBCTHHHHHTSC
T ss_pred             CCccCcCCCccchHHHHHHHHHHHhCCcccccchhHHHHHHHHHHHHhcccCCCCCCCCcccccccc
Confidence            99999999999999999999999999863233   78999999999999999999987766655544
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Back     alignment and structure
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
>3dra_B Geranylgeranyltransferase type I beta subunit; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* Back     alignment and structure
>1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 Back     alignment and structure
>3dra_B Geranylgeranyltransferase type I beta subunit; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... Back     alignment and structure
>2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>2pmv_A Gastric intrinsic factor; cobalamin transport protein alpha6-alpha6 motif two domain P transport protein; HET: NAG B12; 2.60A {Homo sapiens} PDB: 3kq4_A* Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} Back     alignment and structure
>3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* Back     alignment and structure
>3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>1ulv_A Glucodextranase; GH family 15, (alpha-alpha)6-barrel, SLH domain, hydrolase; HET: ACR; 2.42A {Arthrobacter globiformis} SCOP: a.102.1.5 b.1.18.2 b.1.9.3 b.30.5.5 PDB: 1ug9_A* Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1lf6_A Glucoamylase; (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15; 2.10A {Thermoanaerobacteriumthermosaccharolyticum} SCOP: a.102.1.5 b.30.5.5 PDB: 1lf9_A* Back     alignment and structure
>1lf6_A Glucoamylase; (alpha/alpha) barrel, 6 alpha-helical hairpin torroid, super beta sandwich, carbohydrase family GH15; 2.10A {Thermoanaerobacteriumthermosaccharolyticum} SCOP: a.102.1.5 b.30.5.5 PDB: 1lf9_A* Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1ulv_A Glucodextranase; GH family 15, (alpha-alpha)6-barrel, SLH domain, hydrolase; HET: ACR; 2.42A {Arthrobacter globiformis} SCOP: a.102.1.5 b.1.18.2 b.1.9.3 b.30.5.5 PDB: 1ug9_A* Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1w6ka1448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 8e-39
d1w6ka1448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 1e-07
d1w6ka1 448 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { 6e-05
d2sqca1352 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla 2e-23
d1r76a_408 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 3e-09
d1r76a_ 408 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 1e-08
d2h6fb1 401 a.102.4.3 (B:521-921) Protein farnesyltransferase, 3e-09
d3dssb1 325 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, 2e-08
d1gxma_324 a.102.5.1 (A:) Polygalacturonic acid lyase (pectat 4e-06
d1w6ka2 279 a.102.4.2 (A:100-378) Lanosterol synthase {Human ( 0.001
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  134 bits (337), Expect = 8e-39
 Identities = 54/146 (36%), Positives = 82/146 (56%), Gaps = 3/146 (2%)

Query: 1   SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKN 60
           +  GG   +E       +ELLNP E   +++I++ YVECT++ ++A+  F K  P+HR  
Sbjct: 211 NPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAA 270

Query: 61  EVNNFIINAVKFIEDLQKPDGSWYGRWGVCFIYSTWWAISGLVAAEKTYSN---CLPIRK 117
           E+   +   ++F    Q+ DGSW G WGVCF Y TW+ +       +TY +   C  + +
Sbjct: 271 EIRETLTQGLEFCRRQQRADGSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSR 330

Query: 118 ATDFLLNIQCGDGGWGESYLSCPNKV 143
           A DFLL+ Q  DGGWGE + SC  + 
Sbjct: 331 ACDFLLSRQMADGGWGEDFESCEERR 356
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Length = 408 Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Length = 408 Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 325 Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Length = 324 Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 279 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 100.0
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.96
d3dssb1 325 Rab geranylgeranyltransferase, beta subunit {Rat ( 99.73
d2h6fb1 401 Protein farnesyltransferase, beta-subunit {Human ( 99.68
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.67
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 99.65
d1n4qb_ 346 Protein farnesyltransferase, beta-subunit {Rat (Ra 99.64
d3dssb1 325 Rab geranylgeranyltransferase, beta subunit {Rat ( 99.47
d1r76a_ 408 Polygalacturonic acid lyase (pectate lyase) {Azosp 99.45
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azosp 99.44
d2h6fb1 401 Protein farnesyltransferase, beta-subunit {Human ( 99.41
d1gxma_324 Polygalacturonic acid lyase (pectate lyase) {Cellv 99.34
d2sqca2 271 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.32
d1gxma_ 324 Polygalacturonic acid lyase (pectate lyase) {Cellv 99.26
d2sqca2 271 Squalene-hopene cyclase {Alicyclobacillus acidocal 99.24
d1n4qb_346 Protein farnesyltransferase, beta-subunit {Rat (Ra 99.08
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 98.98
d1hzfa_ 326 C4adg fragment of complement factor C4a {Human (Ho 98.35
d1hzfa_ 326 C4adg fragment of complement factor C4a {Human (Ho 98.32
d1c3da_294 C3D, a C3 fragment and ligand for complement recep 98.09
d1c3da_ 294 C3D, a C3 fragment and ligand for complement recep 98.02
d1w6ka2 279 Lanosterol synthase {Human (Homo sapiens) [TaxId: 97.47
d1fp3a_ 402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 95.94
d1lf6a1 397 Bacterial glucoamylase, C-terminal domain {Thermoa 95.87
d1ulva1 413 Glucodextranase, domain A {Arthrobacter globiformi 94.6
d1lf6a1 397 Bacterial glucoamylase, C-terminal domain {Thermoa 93.82
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 93.33
d2afaa1 411 Putative NAG isomerase YihS {Salmonella typhimuriu 92.7
d1ulva1 413 Glucodextranase, domain A {Arthrobacter globiformi 92.44
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 87.7
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 87.34
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 84.35
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 84.03
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Terpenoid cyclases/Protein prenyltransferases
family: Terpene synthases
domain: Lanosterol synthase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-33  Score=228.95  Aligned_cols=145  Identities=37%  Similarity=0.850  Sum_probs=136.4

Q ss_pred             CCCCCccccccccccchhhhcCccccccCccccCCChhHHHHHHHHHHHhhhhCCccchhhhHHHHHHHHHHHHHhCCCC
Q 046854            1 SKSGGITGWEPAGAPSWIELLNPIEFLDEVIIEHDYVECTASALKAMTLFQKLHPKHRKNEVNNFIINAVKFIEDLQKPD   80 (145)
Q Consensus         1 n~dGgw~~~~~~~~~~~l~~~~~~~~~~~~~~d~~~~~~T~~al~aL~~~~~~~~~~~~~~i~~~i~ka~~~L~~~Q~~d   80 (145)
                      |+||||++|+.++...+|+.+|+.+.|++.++|++++++|+++|.+|..++...|+++..+++++|+|+++||++.|++|
T Consensus       211 n~dGGw~afd~~~~~~~l~~~~~~~~~~~~~~D~s~~d~T~~~l~aL~~~~~~~p~~r~~~~~~~i~ral~yL~~~Q~~D  290 (448)
T d1w6ka1         211 NPDGGFATYETKRGGHLLELLNPSEVFGDIMIDYTYVECTSAVMQALKYFHKRFPEHRAAEIRETLTQGLEFCRRQQRAD  290 (448)
T ss_dssp             CTTSCBCSSSCCCSCGGGGGGCCCSSCSSCSSCCCBHHHHHHHHHHHHHHHHHCTTSSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             CCCCCeeeccCCCChhhhhcccchhhhhccccCCCcchHHHHHHHHHHHHhhhCCccccccchHHHHHHHHHHHccCCCC
Confidence            79999999999999999999999999999999999999999999999999998888888899999999999999999999


Q ss_pred             CCccccCCcchhhHHHHHHHHHHHcCCCC---CCcHHHHHHHHHHHhcccCCCCcCCCCCCCCCCccC
Q 046854           81 GSWYGRWGVCFIYSTWWAISGLVAAEKTY---SNCLPIRKATDFLLNIQCGDGGWGESYLSCPNKVKL  145 (145)
Q Consensus        81 G~w~~~~g~~~~~~T~~al~aL~~~g~~~---~~~~~v~~a~~~L~~~Q~~dGgwg~~~~s~~~~~~~  145 (145)
                      |+|.++||.+++|.|++||.+|..+|..+   ...+.|+||++||+++|++||||++...||+++.|+
T Consensus       291 GsW~g~wg~~~~ygT~~al~aL~~~G~~~~~~~~~~~v~ka~~wLls~Q~~DGGWge~~~s~~~~~~~  358 (448)
T d1w6ka1         291 GSWEGSWGVCFTYGTWFGLEAFACMGQTYRDGTACAEVSRACDFLLSRQMADGGWGEDFESCEERRYV  358 (448)
T ss_dssp             SCCCCSSBSSHHHHHHHHHHHHHHTTCCCBTTBCCHHHHHHHHHHHTTCCTTSCCCBCTHHHHHTSCC
T ss_pred             CcccccCCCcccHHHHHHHHHHHHhCcCcccccccHHHHHHHHHHHhccCCCCCccCCCccccCcccC
Confidence            99999999999999999999999998763   246899999999999999999999999988888774
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Back     information, alignment and structure
>d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1lf6a1 a.102.1.5 (A:288-684) Bacterial glucoamylase, C-terminal domain {Thermoanaerobacterium thermosaccharolyticum [TaxId: 1517]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ulva1 a.102.1.5 (A:274-686) Glucodextranase, domain A {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure