Citrus Sinensis ID: 046900

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--
MAIEIEQPSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNFMQKRERRRN
ccccccccccccccHHHHHHcccccccccHHHHHHHcccccccccccccEEEEEccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEccHHHHHHHHHHHHcccccEEEEcccccccHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHcccEEEEccccccccccccccccHHEEcccccccccccEEEEEcccccccccccEEEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccEEEEEEccccccccccHHHHHHHHHHHHHHccEEEEcccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcc
ccEEEcccccccEEEHEEcccccccccccHccHHHHcccccccccccccEEEEccccccccHHHHHHHHHHcccHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEcccccEEEEccccHHHHHHHHHHcccccEEEEccccccccccccEEccccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEcHEHccccccccccEEHHHHHHHcccccccEEEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHHHHHHccEEEccccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHccccc
maieieqpsvsvgLSKVAvsethgedspyfagwkaydenpyeestnpsgviqmglaeNQVSFDLLEEYLEqqpeastwgkgapgfrenalfQDYHGLKSFRQAMASFMEQIRggrakfdlNRIVVTAGATAANELLTFIladpgdallvptpyypgfdrdlrwrtgikivpihcdssnnfqiTPQALEAAYKEAESKDMRVRGVlitnpsnplgatIQRSVLEELLDFAtrknihlvsdeiysgsafssseFVSIAEILEARQYKDSERVHIVYSLSkdlglpgfrvgtiysyndKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIeclkgnaglfcwmnlsplleeqTREGELALWDSMLHEVklnispgsschcsepgwfRVCFANMSEQTLEVALKRIHNFMQKRERRRN
maieieqpsvsvgLSKVAVsethgedspyfaGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPihcdssnnfQITPQALEAAYKEAESKDMRVRGVlitnpsnplgatIQRSVLEELLDFATRKNIHLVSdeiysgsafssseFVSIAEILEArqykdserVHIVYSlskdlglpgfrVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIhnfmqkrerrrn
MAIEIEQPSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYsgsafsssefvsiaeiLEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNFMQKRERRRN
****************************YFAGWKAYD************VIQMGLAENQVSFDLLEEYLE******TWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAY*******MRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNF*********
************************EDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNF**KR*****
**********SVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNFMQKRERRRN
*AIEIE*PSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNFMQKRE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIEIEQPSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIHNFMQKRERRRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query442 2.2.26 [Sep-21-2011]
Q9STR4447 1-aminocyclopropane-1-car yes no 0.970 0.959 0.796 0.0
Q00257475 1-aminocyclopropane-1-car N/A no 0.952 0.886 0.611 1e-161
Q9T065469 1-aminocyclopropane-1-car no no 0.952 0.897 0.614 1e-160
P37821473 1-aminocyclopropane-1-car N/A no 0.952 0.890 0.598 1e-158
Q42881469 1-aminocyclopropane-1-car N/A no 0.954 0.899 0.605 1e-157
Q43309474 1-aminocyclopropane-1-car no no 0.947 0.883 0.603 1e-156
Q9M2Y8470 1-aminocyclopropane-1-car no no 0.968 0.910 0.592 1e-156
P18485485 1-aminocyclopropane-1-car N/A no 0.952 0.868 0.569 1e-155
Q37001470 1-aminocyclopropane-1-car no no 0.968 0.910 0.587 1e-155
Q9S9U6460 1-aminocyclopropane-1-car no no 0.954 0.917 0.588 1e-154
>sp|Q9STR4|1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana GN=ACS7 PE=1 SV=1 Back     alignment and function desciption
 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/432 (79%), Positives = 387/432 (89%), Gaps = 3/432 (0%)

Query: 11  SVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLE 70
           +V LS+VAVS+THGEDSPYFAGWKAYDENPY+ES NPSGVIQMGLAENQVSFDLLE YLE
Sbjct: 15  NVELSRVAVSDTHGEDSPYFAGWKAYDENPYDESHNPSGVIQMGLAENQVSFDLLETYLE 74

Query: 71  QQ-PEASTWG-KGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAG 128
           ++ PE S WG KGAPGFRENALFQDYHGLK+FRQAMASFMEQIRGG+A+FD +RIV+TAG
Sbjct: 75  KKNPEGSMWGSKGAPGFRENALFQDYHGLKTFRQAMASFMEQIRGGKARFDPDRIVLTAG 134

Query: 129 ATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALE 188
           ATAANELLTFILADP DALLVPTPYYPGFDRDLRWRTG+KIVPIHCDSSN+FQITP+ALE
Sbjct: 135 ATAANELLTFILADPNDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNHFQITPEALE 194

Query: 189 AAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFS 248
           +AY+ A   ++RVRGVLITNPSNPLGAT+Q+ VLE+LLDF  RKNIHLVSDEIYSGS F 
Sbjct: 195 SAYQTARDANIRVRGVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFH 254

Query: 249 SSEFVSIAEILE-ARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSF 307
           +SEF S+AEI+E        ERVHIVYSLSKDLGLPGFRVGTIYSYND VV TARRMSSF
Sbjct: 255 ASEFTSVAEIVENIDDVSVKERVHIVYSLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSF 314

Query: 308 TLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCW 367
           TL+SSQTQ++LASMLS+++FTE YI+ NRERL++RY  I+EGL+ AGIECLKGNAGLFCW
Sbjct: 315 TLVSSQTQHMLASMLSDEEFTEKYIRINRERLRRRYDTIVEGLKKAGIECLKGNAGLFCW 374

Query: 368 MNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVAL 427
           MNL  LLE++T++GEL LWD +L E+ LNISPGSSCHCSE GWFRVCFANMSE TLE+AL
Sbjct: 375 MNLGFLLEKKTKDGELQLWDVILKELNLNISPGSSCHCSEVGWFRVCFANMSENTLEIAL 434

Query: 428 KRIHNFMQKRER 439
           KRIH FM +R R
Sbjct: 435 KRIHEFMDRRRR 446
1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes catalyze the conversion of S-adenosyl-L-methionine (SAM) into 1-aminocyclopropane-1-carboxylate (ACC), a direct precursor of ethylene.
Arabidopsis thaliana (taxid: 3702)
EC: 4EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q00257|1A12_CUCMA 1-aminocyclopropane-1-carboxylate synthase CMA101 OS=Cucurbita maxima GN=ACS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9T065|1A18_ARATH 1-aminocyclopropane-1-carboxylate synthase 8 OS=Arabidopsis thaliana GN=ACS8 PE=1 SV=1 Back     alignment and function description
>sp|P37821|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase OS=Malus domestica GN=ACS-1 PE=1 SV=2 Back     alignment and function description
>sp|Q42881|1A13_SOLLC 1-aminocyclopropane-1-carboxylate synthase 3 OS=Solanum lycopersicum GN=ACS3 PE=1 SV=1 Back     alignment and function description
>sp|Q43309|1A14_ARATH 1-aminocyclopropane-1-carboxylate synthase 4 OS=Arabidopsis thaliana GN=ACS4 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2Y8|1A19_ARATH 1-aminocyclopropane-1-carboxylate synthase 9 OS=Arabidopsis thaliana GN=ACS9 PE=1 SV=1 Back     alignment and function description
>sp|P18485|1A12_SOLLC 1-aminocyclopropane-1-carboxylate synthase 2 OS=Solanum lycopersicum GN=ACS2 PE=1 SV=2 Back     alignment and function description
>sp|Q37001|1A15_ARATH 1-aminocyclopropane-1-carboxylate synthase 5 OS=Arabidopsis thaliana GN=ACS5 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9U6|1A111_ARATH 1-aminocyclopropane-1-carboxylate synthase 11 OS=Arabidopsis thaliana GN=ACS11 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query442
255546203440 acc synthase, putative [Ricinus communis 0.995 1.0 0.882 0.0
224088009440 1-aminocyclopropane-1-carboxylate [Popul 0.986 0.990 0.888 0.0
100811854445 1-aminocyclopropane-1-carboxylic acid sy 0.993 0.986 0.853 0.0
224122578446 1-aminocyclopropane-1-carboxylate [Popul 0.986 0.977 0.869 0.0
348652793446 1-aminocyclopropane-1-carboxylic acid sy 0.993 0.984 0.858 0.0
100811861446 1-aminocyclopropane-1-carboxylic acid sy 0.993 0.984 0.855 0.0
4586411446 1-aminocyclopropane -1-carboxylate synth 0.993 0.984 0.853 0.0
1658062446 ACC synthase [Malus x domestica] gi|1008 0.993 0.984 0.855 0.0
348652791446 1-aminocyclopropane-1-carboxylic acid sy 0.993 0.984 0.853 0.0
374862413446 ACC synthase [Pyrus pyrifolia] gi|448871 0.993 0.984 0.853 0.0
>gi|255546203|ref|XP_002514161.1| acc synthase, putative [Ricinus communis] gi|223546617|gb|EEF48115.1| acc synthase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/442 (88%), Positives = 417/442 (94%), Gaps = 2/442 (0%)

Query: 1   MAIEIEQPSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQV 60
           MAIEIEQP+V  GLSK+AVSETHGEDSPYFAGWKAYDE+PY E  NPSGVIQMGLAENQV
Sbjct: 1   MAIEIEQPAV--GLSKIAVSETHGEDSPYFAGWKAYDEDPYHEYENPSGVIQMGLAENQV 58

Query: 61  SFDLLEEYLEQQPEASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDL 120
           SFDLLEEYL +  EAS+WGKGA  FRENALFQDYHGL SFRQAMASFMEQIRGGRAKFD 
Sbjct: 59  SFDLLEEYLAKHSEASSWGKGALSFRENALFQDYHGLSSFRQAMASFMEQIRGGRAKFDS 118

Query: 121 NRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNF 180
           +RIV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTG+KIVPIHCDSSNNF
Sbjct: 119 DRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNNF 178

Query: 181 QITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDE 240
           QITPQALEAAYKEAE+K+++VRGVLITNPSNPLGATIQRSVLEE+LDFATRKNIHLVSDE
Sbjct: 179 QITPQALEAAYKEAEAKNIKVRGVLITNPSNPLGATIQRSVLEEILDFATRKNIHLVSDE 238

Query: 241 IYSGSAFSSSEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTT 300
           IYSGS FSSSEF+SIAE+LEAR YKD+ERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTT
Sbjct: 239 IYSGSVFSSSEFISIAEVLEARGYKDAERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTT 298

Query: 301 ARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKG 360
           ARRMSSFTLISSQTQ+LLASMLSNK+FT+NYIK NRERL KRY+MII+GLR AGIECLKG
Sbjct: 299 ARRMSSFTLISSQTQHLLASMLSNKEFTKNYIKINRERLNKRYEMIIQGLRDAGIECLKG 358

Query: 361 NAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSE 420
           NAGLFCWMNLSPLLE QTREGELALW S+L +VKLNISPGSSC CSEPGWFRVCFANMSE
Sbjct: 359 NAGLFCWMNLSPLLETQTREGELALWKSILRDVKLNISPGSSCRCSEPGWFRVCFANMSE 418

Query: 421 QTLEVALKRIHNFMQKRERRRN 442
           QTLEVALKRIH+FM +++   N
Sbjct: 419 QTLEVALKRIHDFMDQKKTGSN 440

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224088009|ref|XP_002308289.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] gi|222854265|gb|EEE91812.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] Back     alignment and taxonomy information
>gi|100811854|dbj|BAE94691.1| 1-aminocyclopropane-1-carboxylic acid synthase 3b [Malus x domestica] Back     alignment and taxonomy information
>gi|224122578|ref|XP_002330516.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] gi|222872450|gb|EEF09581.1| 1-aminocyclopropane-1-carboxylate [Populus trichocarpa] Back     alignment and taxonomy information
>gi|348652793|gb|AEP82201.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a-2 [Malus x domestica] Back     alignment and taxonomy information
>gi|100811861|dbj|BAE94692.1| 1-aminocyclopropane-1-carboxylic acid synthase 3c [Malus x domestica] Back     alignment and taxonomy information
>gi|4586411|dbj|BAA76388.1| 1-aminocyclopropane -1-carboxylate synthase [Pyrus pyrifolia] Back     alignment and taxonomy information
>gi|1658062|gb|AAB67989.1| ACC synthase [Malus x domestica] gi|100811847|dbj|BAE94690.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a [Malus x domestica] Back     alignment and taxonomy information
>gi|348652791|gb|AEP82200.1| 1-aminocyclopropane-1-carboxylic acid synthase 3a-1 [Malus x domestica] Back     alignment and taxonomy information
>gi|374862413|gb|AFA25803.1| ACC synthase [Pyrus pyrifolia] gi|448871864|gb|AGE45704.1| 1-aminocyclopropane-1-carboxylic acid synthase [Pyrus pyrifolia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query442
TAIR|locus:2136779447 ACS7 "1-amino-cyclopropane-1-c 0.970 0.959 0.770 1.6e-180
UNIPROTKB|Q09PK3481 ACS1 "1-aminocyclopropane-1-ca 0.957 0.879 0.590 3.9e-140
UNIPROTKB|Q43165465 ST ACS1A "Amino cyclopropane c 0.966 0.918 0.582 1.7e-139
UNIPROTKB|A5BL65469 VITISV_037836 "Putative unchar 0.970 0.914 0.591 3.5e-139
UNIPROTKB|Q00257475 ACS2 "1-aminocyclopropane-1-ca 0.952 0.886 0.592 7.2e-139
TAIR|locus:2137579469 ACS8 "1-amino-cyclopropane-1-c 0.952 0.897 0.6 1.5e-138
UNIPROTKB|O80334467 O80334 "1-aminocyclopropane-1- 0.954 0.903 0.595 2.4e-138
TAIR|locus:2097350470 ACS9 "1-aminocyclopropane-1-ca 0.968 0.910 0.578 5.1e-138
TAIR|locus:2169980470 ACS5 "ACC synthase 5" [Arabido 0.961 0.904 0.578 1.1e-137
UNIPROTKB|O65028470 ACS2 "Pollen-specific 1-aminoc 0.952 0.895 0.592 1.2e-136
TAIR|locus:2136779 ACS7 "1-amino-cyclopropane-1-carboxylate synthase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1752 (621.8 bits), Expect = 1.6e-180, P = 1.6e-180
 Identities = 333/432 (77%), Positives = 374/432 (86%)

Query:    11 SVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLE 70
             +V LS+VAVS+THGEDSPYFAGWKAYDENPY+ES NPSGVIQMGLAENQVSFDLLE YLE
Sbjct:    15 NVELSRVAVSDTHGEDSPYFAGWKAYDENPYDESHNPSGVIQMGLAENQVSFDLLETYLE 74

Query:    71 QQ-PEASTWG-KGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAG 128
             ++ PE S WG KGAPGFRENALFQDYHGLK+FRQAMASFMEQIRGG+A+FD +RIV+TAG
Sbjct:    75 KKNPEGSMWGSKGAPGFRENALFQDYHGLKTFRQAMASFMEQIRGGKARFDPDRIVLTAG 134

Query:   129 ATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALE 188
             ATAANELLTFILADP DALLVPTPYYPGFDRDLRWRTG+KIVPIHCDSSN+FQITP+ALE
Sbjct:   135 ATAANELLTFILADPNDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNHFQITPEALE 194

Query:   189 AAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYXXXXXX 248
             +AY+ A   ++RVRGVLITNPSNPLGAT+Q+ VLE+LLDF  RKNIHLVSDEIY      
Sbjct:   195 SAYQTARDANIRVRGVLITNPSNPLGATVQKKVLEDLLDFCVRKNIHLVSDEIYSGSVFH 254

Query:   249 XXXXXXXXXXLE-ARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSF 307
                       +E        ERVHIVYSLSKDLGLPGFRVGTIYSYND VV TARRMSSF
Sbjct:   255 ASEFTSVAEIVENIDDVSVKERVHIVYSLSKDLGLPGFRVGTIYSYNDNVVRTARRMSSF 314

Query:   308 TLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCW 367
             TL+SSQTQ++LASMLS+++FTE YI+ NRERL++RY  I+EGL+ AGIECLKGNAGLFCW
Sbjct:   315 TLVSSQTQHMLASMLSDEEFTEKYIRINRERLRRRYDTIVEGLKKAGIECLKGNAGLFCW 374

Query:   368 MNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVAL 427
             MNL  LLE++T++GEL LWD +L E+ LNISPGSSCHCSE GWFRVCFANMSE TLE+AL
Sbjct:   375 MNLGFLLEKKTKDGELQLWDVILKELNLNISPGSSCHCSEVGWFRVCFANMSENTLEIAL 434

Query:   428 KRIHNFMQKRER 439
             KRIH FM +R R
Sbjct:   435 KRIHEFMDRRRR 446
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0009058 "biosynthetic process" evidence=IEA
GO:0009693 "ethylene biosynthetic process" evidence=ISS;RCA;TAS
GO:0016740 "transferase activity" evidence=IEA
GO:0016847 "1-aminocyclopropane-1-carboxylate synthase activity" evidence=IEA;ISS;IDA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0042218 "1-aminocyclopropane-1-carboxylate biosynthetic process" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0042802 "identical protein binding" evidence=IPI
GO:0006865 "amino acid transport" evidence=RCA
UNIPROTKB|Q09PK3 ACS1 "1-aminocyclopropane-1-carboxylate synthase" [Cucumis sativus (taxid:3659)] Back     alignment and assigned GO terms
UNIPROTKB|Q43165 ST ACS1A "Amino cyclopropane carboxylate acid synthase" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
UNIPROTKB|A5BL65 VITISV_037836 "Putative uncharacterized protein" [Vitis vinifera (taxid:29760)] Back     alignment and assigned GO terms
UNIPROTKB|Q00257 ACS2 "1-aminocyclopropane-1-carboxylate synthase CMA101" [Cucurbita maxima (taxid:3661)] Back     alignment and assigned GO terms
TAIR|locus:2137579 ACS8 "1-amino-cyclopropane-1-carboxylate synthase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O80334 O80334 "1-aminocyclopropane-1-carboxylate synthase" [Actinidia deliciosa (taxid:3627)] Back     alignment and assigned GO terms
TAIR|locus:2097350 ACS9 "1-aminocyclopropane-1-carboxylate synthase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169980 ACS5 "ACC synthase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O65028 ACS2 "Pollen-specific 1-aminocyclopropane-1-carboxylate synthase" [Petunia x hybrida (taxid:4102)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q003791A12_CUCPE4, ., 4, ., 1, ., 1, 40.56270.97050.8684N/Ano
Q9MB951A11_PRUMU4, ., 4, ., 1, ., 1, 40.57440.96830.8699N/Ano
Q002571A12_CUCMA4, ., 4, ., 1, ., 1, 40.61170.95240.8863N/Ano
Q9STR41A17_ARATH4, ., 4, ., 1, ., 1, 40.79620.97050.9597yesno
Q428811A13_SOLLC4, ., 4, ., 1, ., 1, 40.60560.95470.8997N/Ano
P378211A1C_MALDO4, ., 4, ., 1, ., 1, 40.59850.95240.8900N/Ano
Q019121A1C_VIGRR4, ., 4, ., 1, ., 1, 40.57600.82570.9918N/Ano
A2XLL21A11_ORYSI4, ., 4, ., 1, ., 1, 40.57070.96600.8767N/Ano
P184851A12_SOLLC4, ., 4, ., 1, ., 1, 40.56970.95240.8680N/Ano
P274861A1C_DIACA4, ., 4, ., 1, ., 1, 40.54240.95470.8162N/Ano
P232791A11_CUCPE4, ., 4, ., 1, ., 1, 40.55580.97050.8701N/Ano
P295351A14_SOLLC4, ., 4, ., 1, ., 1, 40.54960.97730.9075N/Ano
P235991A11_CUCMA4, ., 4, ., 1, ., 1, 40.55580.97050.8701N/Ano
Q072621A1C_TOBAC4, ., 4, ., 1, ., 1, 40.57210.95240.8574N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.4.1LOW CONFIDENCE prediction!
4th Layer4.4.1.140.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
ACS6
1-aminocyclopropane-1-carboxylate (EC-4.4.1.14) (440 aa)
(Populus trichocarpa)
Predicted Functional Partners:
ACO5
1-aminocyclopropane-1-carboxylate (EC-1.14.11.9) (303 aa)
     •• 0.901
ACO3
SubName- Full=Putative uncharacterized protein; (320 aa)
     •• 0.901
ACO7
1-aminocyclopropane-1-carboxylate (EC-1.14.11.9) (319 aa)
     •• 0.901
ACO2
SubName- Full=Putative uncharacterized protein; (311 aa)
     •• 0.901
estExt_fgenesh4_pg.C_LG_IV1398
SubName- Full=Putative uncharacterized protein; (263 aa)
     •• 0.900
estExt_fgenesh4_kg.C_LG_IX0009
5'-methylthioadenosine nucleosidase (EC-3.2.2.16) (263 aa)
     •• 0.900
gw1.XVIII.3078.1
S-adenosylmethionine decarboxylase (EC-4.1.1.50) (348 aa)
     •  0.899
DMT902
DNA methyltransferase (1503 aa)
     •  0.899
gw1.X.5941.1
spermine synthase (EC-2.5.1.22) (303 aa)
     •  0.899
gw1.VIII.2435.1
S-adenosylmethionine decarboxylase (EC-4.1.1.50) (303 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
PLN02607447 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxyl 0.0
PLN02450468 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxyl 0.0
PLN02376496 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxyl 1e-178
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 1e-104
PLN02994153 PLN02994, PLN02994, 1-aminocyclopropane-1-carboxyl 3e-73
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 4e-66
COG0436393 COG0436, COG0436, Aspartate/tyrosine/aromatic amin 8e-62
PRK05764393 PRK05764, PRK05764, aspartate aminotransferase; Pr 2e-36
PRK07309391 PRK07309, PRK07309, aromatic amino acid aminotrans 8e-36
COG1167459 COG1167, ARO8, Transcriptional regulators containi 6e-34
PRK07683387 PRK07683, PRK07683, aminotransferase A; Validated 4e-30
TIGR01265403 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine 9e-28
PRK07568397 PRK07568, PRK07568, aspartate aminotransferase; Pr 3e-27
PRK07682378 PRK07682, PRK07682, hypothetical protein; Validate 1e-25
PRK06836394 PRK06836, PRK06836, aspartate aminotransferase; Pr 5e-25
PTZ00377481 PTZ00377, PTZ00377, alanine aminotransferase; Prov 3e-23
PRK08960387 PRK08960, PRK08960, hypothetical protein; Provisio 4e-23
PTZ00433412 PTZ00433, PTZ00433, tyrosine aminotransferase; Pro 8e-22
PRK08363398 PRK08363, PRK08363, alanine aminotransferase; Vali 1e-21
TIGR03540383 TIGR03540, DapC_direct, LL-diaminopimelate aminotr 3e-21
PRK06108382 PRK06108, PRK06108, aspartate aminotransferase; Pr 9e-21
PRK06107402 PRK06107, PRK06107, aspartate aminotransferase; Pr 2e-20
TIGR01264401 TIGR01264, tyr_amTase_E, tyrosine aminotransferase 7e-20
PRK07337388 PRK07337, PRK07337, aminotransferase; Validated 9e-20
PRK07550386 PRK07550, PRK07550, hypothetical protein; Provisio 1e-19
PLN02368407 PLN02368, PLN02368, alanine transaminase 7e-19
PRK08361391 PRK08361, PRK08361, aspartate aminotransferase; Pr 5e-18
COG1168388 COG1168, MalY, Bifunctional PLP-dependent enzyme w 5e-18
COG0079356 COG0079, HisC, Histidinol-phosphate/aromatic amino 7e-18
PRK06348384 PRK06348, PRK06348, aspartate aminotransferase; Pr 3e-17
PRK05957389 PRK05957, PRK05957, aspartate aminotransferase; Pr 3e-17
PRK09276385 PRK09276, PRK09276, LL-diaminopimelate aminotransf 8e-17
TIGR03537350 TIGR03537, DapC, succinyldiaminopimelate transamin 1e-16
PRK13355517 PRK13355, PRK13355, bifunctional HTH-domain contai 6e-16
PRK05942394 PRK05942, PRK05942, aspartate aminotransferase; Pr 1e-15
PRK07681399 PRK07681, PRK07681, aspartate aminotransferase; Pr 4e-15
TIGR01141346 TIGR01141, hisC, histidinol-phosphate aminotransfe 1e-14
PLN02656409 PLN02656, PLN02656, tyrosine transaminase 2e-14
PLN02231534 PLN02231, PLN02231, alanine transaminase 2e-14
PRK09265404 PRK09265, PRK09265, aminotransferase AlaT; Validat 2e-14
PRK07324373 PRK07324, PRK07324, transaminase; Validated 3e-14
TIGR04350384 TIGR04350, C_S_lyase_PatB, putative C-S lyase 4e-14
PRK06225380 PRK06225, PRK06225, aspartate aminotransferase; Pr 5e-14
PRK08068389 PRK08068, PRK08068, transaminase; Reviewed 6e-14
TIGR03947359 TIGR03947, viomycin_VioD, capreomycidine synthase 9e-14
PRK08636403 PRK08636, PRK08636, aspartate aminotransferase; Pr 1e-13
PRK08175395 PRK08175, PRK08175, aminotransferase; Validated 2e-13
PRK06290410 PRK06290, PRK06290, aspartate aminotransferase; Pr 3e-13
PRK08912387 PRK08912, PRK08912, hypothetical protein; Provisio 6e-13
PLN00145430 PLN00145, PLN00145, tyrosine/nicotianamine aminotr 3e-12
PRK09148405 PRK09148, PRK09148, aminotransferase; Validated 4e-12
PRK07366388 PRK07366, PRK07366, succinyldiaminopimelate transa 6e-12
PRK09082386 PRK09082, PRK09082, methionine aminotransferase; V 8e-12
PLN00143409 PLN00143, PLN00143, tyrosine/nicotianamine aminotr 1e-11
PRK07777387 PRK07777, PRK07777, aminotransferase; Validated 1e-11
PLN00175413 PLN00175, PLN00175, aminotransferase family protei 2e-11
PRK09275527 PRK09275, PRK09275, aspartate aminotransferase; Pr 8e-11
PLN02187462 PLN02187, PLN02187, rooty/superroot1 9e-11
TIGR03538393 TIGR03538, DapC_gpp, succinyldiaminopimelate trans 4e-10
PRK06358354 PRK06358, PRK06358, threonine-phosphate decarboxyl 9e-10
TIGR03542402 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotr 2e-09
TIGR01140330 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phospha 6e-09
PRK14809357 PRK14809, PRK14809, histidinol-phosphate aminotran 7e-09
TIGR03801521 TIGR03801, asp_4_decarbox, aspartate 4-decarboxyla 8e-09
TIGR03539357 TIGR03539, DapC_actino, succinyldiaminopimelate tr 1e-08
PRK06855433 PRK06855, PRK06855, aminotransferase; Validated 3e-08
PRK03967337 PRK03967, PRK03967, histidinol-phosphate aminotran 2e-07
PRK12414384 PRK12414, PRK12414, putative aminotransferase; Pro 3e-07
PRK08354311 PRK08354, PRK08354, putative aminotransferase; Pro 1e-06
pfam01212288 pfam01212, Beta_elim_lyase, Beta-eliminating lyase 1e-06
PRK06207405 PRK06207, PRK06207, aspartate aminotransferase; Pr 4e-06
PRK02731367 PRK02731, PRK02731, histidinol-phosphate aminotran 7e-06
PRK14807351 PRK14807, PRK14807, histidinol-phosphate aminotran 9e-06
PRK07590409 PRK07590, PRK07590, L,L-diaminopimelate aminotrans 1e-05
PRK09440416 PRK09440, avtA, valine--pyruvate transaminase; Pro 1e-05
COG2008342 COG2008, GLY1, Threonine aldolase [Amino acid tran 1e-05
PRK07865364 PRK07865, PRK07865, N-succinyldiaminopimelate amin 1e-05
PRK03321352 PRK03321, PRK03321, putative aminotransferase; Pro 3e-05
PRK08056356 PRK08056, PRK08056, threonine-phosphate decarboxyl 3e-05
PRK05839374 PRK05839, PRK05839, hypothetical protein; Provisio 3e-05
PRK15481431 PRK15481, PRK15481, transcriptional regulatory pro 9e-05
PRK03158359 PRK03158, PRK03158, histidinol-phosphate aminotran 3e-04
PRK00950361 PRK00950, PRK00950, histidinol-phosphate aminotran 3e-04
PRK08637388 PRK08637, PRK08637, hypothetical protein; Provisio 5e-04
PRK05166371 PRK05166, PRK05166, histidinol-phosphate aminotran 6e-04
PLN03026380 PLN03026, PLN03026, histidinol-phosphate aminotran 7e-04
COG3977417 COG3977, COG3977, Alanine-alpha-ketoisovalerate (o 9e-04
TIGR02080382 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (t 0.001
PRK09147396 PRK09147, PRK09147, succinyldiaminopimelate transa 0.002
PRK01688351 PRK01688, PRK01688, histidinol-phosphate aminotran 0.002
COG0399374 COG0399, WecE, Predicted pyridoxal phosphate-depen 0.003
PRK01533366 PRK01533, PRK01533, histidinol-phosphate aminotran 0.004
>gnl|CDD|215327 PLN02607, PLN02607, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information 
 Score =  904 bits (2337), Expect = 0.0
 Identities = 384/441 (87%), Positives = 419/441 (95%), Gaps = 4/441 (0%)

Query: 1   MAIEIEQPSVSVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQV 60
           MAIEI QP+V  GLSKVAVSETHGEDSPYFAGWKAYDE+PY+ES NPSGVIQMGLAENQV
Sbjct: 2   MAIEIAQPAV--GLSKVAVSETHGEDSPYFAGWKAYDEDPYDESHNPSGVIQMGLAENQV 59

Query: 61  SFDLLEEYLEQQPEASTWG-KGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFD 119
           SFDLLEEYL+Q PEAS+WG KGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGG+A+FD
Sbjct: 60  SFDLLEEYLKQHPEASSWGGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGKARFD 119

Query: 120 LNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNN 179
            +RIV+TAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTG+KIVPIHCDSSNN
Sbjct: 120 PDRIVLTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGVKIVPIHCDSSNN 179

Query: 180 FQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSD 239
           FQ+TPQALEAAY+EAE+ ++RVRGVLITNPSNPLGAT+QRSVLE++LDF  RKNIHLVSD
Sbjct: 180 FQVTPQALEAAYQEAEAANIRVRGVLITNPSNPLGATVQRSVLEDILDFVVRKNIHLVSD 239

Query: 240 EIYSGSAFSSSEFVSIAEILEARQYKD-SERVHIVYSLSKDLGLPGFRVGTIYSYNDKVV 298
           EIYSGS FS+SEFVS+AEI+EAR YK  +ERVHIVYSLSKDLGLPGFRVGTIYSYNDKVV
Sbjct: 240 EIYSGSVFSASEFVSVAEIVEARGYKGVAERVHIVYSLSKDLGLPGFRVGTIYSYNDKVV 299

Query: 299 TTARRMSSFTLISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECL 358
           TTARRMSSFTL+SSQTQ+LLASMLS+++FTENYI+TNRERL+KRY+MI++GLR AGIECL
Sbjct: 300 TTARRMSSFTLVSSQTQHLLASMLSDEEFTENYIRTNRERLRKRYEMIVQGLRRAGIECL 359

Query: 359 KGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANM 418
           KGNAGLFCWMNLSPLLE  TREGELALWDS+L EVKLNISPGSSCHCSEPGWFRVCFANM
Sbjct: 360 KGNAGLFCWMNLSPLLETPTREGELALWDSILREVKLNISPGSSCHCSEPGWFRVCFANM 419

Query: 419 SEQTLEVALKRIHNFMQKRER 439
           SE TLEVALKRIH FM +R+ 
Sbjct: 420 SEDTLEVALKRIHRFMDRRKT 440

Length = 447
>gnl|CDD|178069 PLN02450, PLN02450, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|178004 PLN02376, PLN02376, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|166635 PLN02994, PLN02994, 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|223513 COG0436, COG0436, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235596 PRK05764, PRK05764, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235985 PRK07309, PRK07309, aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|224089 COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236075 PRK07683, PRK07683, aminotransferase A; Validated Back     alignment and domain information
>gnl|CDD|188123 TIGR01265, tyr_nico_aTase, tyrosine/nicotianamine family aminotransferase Back     alignment and domain information
>gnl|CDD|181036 PRK07568, PRK07568, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181082 PRK07682, PRK07682, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|180720 PRK06836, PRK06836, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|240391 PTZ00377, PTZ00377, alanine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181595 PRK08960, PRK08960, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185613 PTZ00433, PTZ00433, tyrosine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181402 PRK08363, PRK08363, alanine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|234250 TIGR03540, DapC_direct, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|180404 PRK06108, PRK06108, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180403 PRK06107, PRK06107, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|188122 TIGR01264, tyr_amTase_E, tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>gnl|CDD|180937 PRK07337, PRK07337, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181026 PRK07550, PRK07550, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|177996 PLN02368, PLN02368, alanine transaminase Back     alignment and domain information
>gnl|CDD|236248 PRK08361, PRK08361, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224090 COG1168, MalY, Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223157 COG0079, HisC, Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180537 PRK06348, PRK06348, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235654 PRK05957, PRK05957, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181749 PRK09276, PRK09276, LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|163313 TIGR03537, DapC, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|237361 PRK13355, PRK13355, bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180317 PRK05942, PRK05942, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181081 PRK07681, PRK07681, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233290 TIGR01141, hisC, histidinol-phosphate aminotransferase Back     alignment and domain information
>gnl|CDD|178262 PLN02656, PLN02656, tyrosine transaminase Back     alignment and domain information
>gnl|CDD|177876 PLN02231, PLN02231, alanine transaminase Back     alignment and domain information
>gnl|CDD|181738 PRK09265, PRK09265, aminotransferase AlaT; Validated Back     alignment and domain information
>gnl|CDD|235989 PRK07324, PRK07324, transaminase; Validated Back     alignment and domain information
>gnl|CDD|213963 TIGR04350, C_S_lyase_PatB, putative C-S lyase Back     alignment and domain information
>gnl|CDD|235749 PRK06225, PRK06225, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181219 PRK08068, PRK08068, transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|188462 TIGR03947, viomycin_VioD, capreomycidine synthase Back     alignment and domain information
>gnl|CDD|236316 PRK08636, PRK08636, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181268 PRK08175, PRK08175, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|235772 PRK06290, PRK06290, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181580 PRK08912, PRK08912, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215074 PLN00145, PLN00145, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181674 PRK09148, PRK09148, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|180947 PRK07366, PRK07366, succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>gnl|CDD|181642 PRK09082, PRK09082, methionine aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|165711 PLN00143, PLN00143, tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236095 PRK07777, PRK07777, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|215089 PLN00175, PLN00175, aminotransferase family protein; Provisional Back     alignment and domain information
>gnl|CDD|236444 PRK09275, PRK09275, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215119 PLN02187, PLN02187, rooty/superroot1 Back     alignment and domain information
>gnl|CDD|234249 TIGR03538, DapC_gpp, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|180542 PRK06358, PRK06358, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|163316 TIGR03542, DAPAT_plant, LL-diaminopimelate aminotransferase Back     alignment and domain information
>gnl|CDD|233289 TIGR01140, L_thr_O3P_dcar, L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>gnl|CDD|184830 PRK14809, PRK14809, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|163513 TIGR03801, asp_4_decarbox, aspartate 4-decarboxylase Back     alignment and domain information
>gnl|CDD|132578 TIGR03539, DapC_actino, succinyldiaminopimelate transaminase Back     alignment and domain information
>gnl|CDD|180734 PRK06855, PRK06855, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|167650 PRK03967, PRK03967, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183514 PRK12414, PRK12414, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|169399 PRK08354, PRK08354, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|216367 pfam01212, Beta_elim_lyase, Beta-eliminating lyase Back     alignment and domain information
>gnl|CDD|235742 PRK06207, PRK06207, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235064 PRK02731, PRK02731, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|184829 PRK14807, PRK14807, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181053 PRK07590, PRK07590, L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236517 PRK09440, avtA, valine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|224919 COG2008, GLY1, Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236119 PRK07865, PRK07865, N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|179559 PRK03321, PRK03321, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181212 PRK08056, PRK08056, threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|180281 PRK05839, PRK05839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|185378 PRK15481, PRK15481, transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>gnl|CDD|235106 PRK03158, PRK03158, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|234872 PRK00950, PRK00950, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181512 PRK08637, PRK08637, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|179950 PRK05166, PRK05166, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178597 PLN03026, PLN03026, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|226485 COG3977, COG3977, Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|131135 TIGR02080, O_succ_thio_ly, O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>gnl|CDD|236393 PRK09147, PRK09147, succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|234972 PRK01688, PRK01688, histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|223476 COG0399, WecE, Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|134568 PRK01533, PRK01533, histidinol-phosphate aminotransferase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 442
KOG0256471 consensus 1-aminocyclopropane-1-carboxylate syntha 100.0
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 100.0
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 100.0
PRK07366388 succinyldiaminopimelate transaminase; Validated 100.0
PRK07681399 aspartate aminotransferase; Provisional 100.0
PRK06207405 aspartate aminotransferase; Provisional 100.0
PRK06855433 aminotransferase; Validated 100.0
PRK08636403 aspartate aminotransferase; Provisional 100.0
PLN02187462 rooty/superroot1 100.0
PTZ00377481 alanine aminotransferase; Provisional 100.0
PRK09147396 succinyldiaminopimelate transaminase; Provisional 100.0
PRK13355517 bifunctional HTH-domain containing protein/aminotr 100.0
PLN00175413 aminotransferase family protein; Provisional 100.0
PLN02231534 alanine transaminase 100.0
PRK08068389 transaminase; Reviewed 100.0
PLN02656409 tyrosine transaminase 100.0
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 100.0
PRK09148405 aminotransferase; Validated 100.0
PRK06348384 aspartate aminotransferase; Provisional 100.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 100.0
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 100.0
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 100.0
PTZ00433412 tyrosine aminotransferase; Provisional 100.0
PRK07682378 hypothetical protein; Validated 100.0
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 100.0
PRK05942394 aspartate aminotransferase; Provisional 100.0
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 100.0
PRK06290410 aspartate aminotransferase; Provisional 100.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 100.0
PRK08960387 hypothetical protein; Provisional 100.0
PRK08361391 aspartate aminotransferase; Provisional 100.0
PRK07309391 aromatic amino acid aminotransferase; Validated 100.0
PRK12414384 putative aminotransferase; Provisional 100.0
KOG0257420 consensus Kynurenine aminotransferase, glutamine t 100.0
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 100.0
PRK06107402 aspartate aminotransferase; Provisional 100.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 100.0
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 100.0
PRK05839374 hypothetical protein; Provisional 100.0
PRK06108382 aspartate aminotransferase; Provisional 100.0
KOG0259447 consensus Tyrosine aminotransferase [Amino acid tr 100.0
PRK07683387 aminotransferase A; Validated 100.0
PRK08912387 hypothetical protein; Provisional 100.0
PRK09082386 methionine aminotransferase; Validated 100.0
PRK07337388 aminotransferase; Validated 100.0
PRK05957389 aspartate aminotransferase; Provisional 100.0
PRK15481431 transcriptional regulatory protein PtsJ; Provision 100.0
PRK07324373 transaminase; Validated 100.0
PRK09265404 aminotransferase AlaT; Validated 100.0
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 100.0
PRK08175395 aminotransferase; Validated 100.0
PRK07568397 aspartate aminotransferase; Provisional 100.0
PRK08363398 alanine aminotransferase; Validated 100.0
PRK07550386 hypothetical protein; Provisional 100.0
PRK09275527 aspartate aminotransferase; Provisional 100.0
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 100.0
PRK06358354 threonine-phosphate decarboxylase; Provisional 100.0
PRK07777387 aminotransferase; Validated 100.0
PRK05764393 aspartate aminotransferase; Provisional 100.0
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 100.0
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 100.0
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PRK01533366 histidinol-phosphate aminotransferase; Validated 100.0
PLN026721082 methionine S-methyltransferase 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
PRK09440416 avtA valine--pyruvate transaminase; Provisional 100.0
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 100.0
PRK14809357 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 100.0
PRK08056356 threonine-phosphate decarboxylase; Provisional 100.0
PRK02610374 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06425332 histidinol-phosphate aminotransferase; Validated 100.0
PRK05166371 histidinol-phosphate aminotransferase; Provisional 100.0
PLN02368407 alanine transaminase 100.0
PRK07392360 threonine-phosphate decarboxylase; Validated 100.0
PRK06836394 aspartate aminotransferase; Provisional 100.0
PRK03158359 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08637388 hypothetical protein; Provisional 100.0
PRK04781364 histidinol-phosphate aminotransferase; Provisional 100.0
PLN03026380 histidinol-phosphate aminotransferase; Provisional 100.0
PRK03317368 histidinol-phosphate aminotransferase; Provisional 100.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 100.0
PRK01688351 histidinol-phosphate aminotransferase; Provisional 100.0
PLN02397423 aspartate transaminase 100.0
PRK04870356 histidinol-phosphate aminotransferase; Provisional 100.0
PRK07908349 hypothetical protein; Provisional 100.0
PRK09105370 putative aminotransferase; Provisional 100.0
PRK06225380 aspartate aminotransferase; Provisional 100.0
PRK02731367 histidinol-phosphate aminotransferase; Validated 100.0
PRK05387353 histidinol-phosphate aminotransferase; Provisional 100.0
PRK06959339 putative threonine-phosphate decarboxylase; Provis 100.0
PRK04635354 histidinol-phosphate aminotransferase; Provisional 100.0
PRK05664330 threonine-phosphate decarboxylase; Reviewed 100.0
PRK03321352 putative aminotransferase; Provisional 100.0
PRK08354311 putative aminotransferase; Provisional 100.0
PRK14807351 histidinol-phosphate aminotransferase; Provisional 100.0
KOG0634472 consensus Aromatic amino acid aminotransferase and 100.0
PRK00950361 histidinol-phosphate aminotransferase; Validated 100.0
PRK14808335 histidinol-phosphate aminotransferase; Provisional 100.0
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 100.0
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 100.0
PRK03967337 histidinol-phosphate aminotransferase; Provisional 100.0
KOG0258475 consensus Alanine aminotransferase [Amino acid tra 100.0
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 100.0
cd00609350 AAT_like Aspartate aminotransferase family. This f 100.0
KOG0633375 consensus Histidinol phosphate aminotransferase [A 100.0
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 100.0
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 100.0
PRK10534333 L-threonine aldolase; Provisional 100.0
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 100.0
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 100.0
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.98
PLN02822481 serine palmitoyltransferase 99.98
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.98
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.98
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.97
PLN02483489 serine palmitoyltransferase 99.97
PLN02721353 threonine aldolase 99.97
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.97
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.97
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.97
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.97
PF12897425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 99.97
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.97
PRK02627396 acetylornithine aminotransferase; Provisional 99.97
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.97
PRK13392410 5-aminolevulinate synthase; Provisional 99.97
TIGR00707379 argD acetylornithine and succinylornithine aminotr 99.96
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.96
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.96
PRK02948381 cysteine desulfurase; Provisional 99.96
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.96
PRK07049427 methionine gamma-lyase; Validated 99.96
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.96
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.96
PRK01278389 argD acetylornithine transaminase protein; Provisi 99.96
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.96
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.96
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.96
PRK09064407 5-aminolevulinate synthase; Validated 99.96
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.95
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.95
PRK07179407 hypothetical protein; Provisional 99.95
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.95
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.95
PLN02242418 methionine gamma-lyase 99.95
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.95
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.95
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.95
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.95
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 99.95
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.95
PLN02409401 serine--glyoxylate aminotransaminase 99.94
PRK13393406 5-aminolevulinate synthase; Provisional 99.94
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.94
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.94
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.94
PRK08247366 cystathionine gamma-synthase; Reviewed 99.94
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 99.94
PRK13520371 L-tyrosine decarboxylase; Provisional 99.94
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.94
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.93
PLN03227392 serine palmitoyltransferase-like protein; Provisio 99.93
PRK06234400 methionine gamma-lyase; Provisional 99.93
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 99.93
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 99.93
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 99.93
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.93
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.93
PRK08045386 cystathionine gamma-synthase; Provisional 99.92
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.92
PRK06767386 methionine gamma-lyase; Provisional 99.92
PRK14012404 cysteine desulfurase; Provisional 99.92
PRK06460376 hypothetical protein; Provisional 99.92
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 99.92
PRK04260375 acetylornithine aminotransferase; Provisional 99.92
PRK08088425 4-aminobutyrate aminotransferase; Validated 99.92
PRK12381406 bifunctional succinylornithine transaminase/acetyl 99.92
PRK07505402 hypothetical protein; Provisional 99.92
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.92
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.92
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 99.91
PRK08249398 cystathionine gamma-synthase; Provisional 99.91
PRK08776405 cystathionine gamma-synthase; Provisional 99.91
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 99.91
PRK08861388 cystathionine gamma-synthase; Provisional 99.91
PLN02955476 8-amino-7-oxononanoate synthase 99.91
PRK07582366 cystathionine gamma-lyase; Validated 99.91
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 99.91
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 99.9
PRK07811388 cystathionine gamma-synthase; Provisional 99.9
PRK07503403 methionine gamma-lyase; Provisional 99.9
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 99.9
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 99.9
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 99.9
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.9
PLN00144382 acetylornithine transaminase 99.9
PRK07050394 cystathionine beta-lyase; Provisional 99.9
PTZ00125400 ornithine aminotransferase-like protein; Provision 99.9
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.89
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 99.89
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.89
PRK08574385 cystathionine gamma-synthase; Provisional 99.89
PRK07269364 cystathionine gamma-synthase; Reviewed 99.89
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 99.89
PRK05968389 hypothetical protein; Provisional 99.88
PLN02651364 cysteine desulfurase 99.88
PRK09028394 cystathionine beta-lyase; Provisional 99.88
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.88
PRK08064390 cystathionine beta-lyase; Provisional 99.88
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 99.88
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 99.87
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 99.87
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 99.87
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.87
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.87
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 99.87
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.87
PRK07671377 cystathionine beta-lyase; Provisional 99.86
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 99.86
PRK09792421 4-aminobutyrate transaminase; Provisional 99.86
PRK04612408 argD acetylornithine transaminase protein; Provisi 99.86
PRK05939397 hypothetical protein; Provisional 99.86
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.86
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.86
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.85
PLN02624474 ornithine-delta-aminotransferase 99.85
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 99.85
PLN02509464 cystathionine beta-lyase 99.85
KOG1359417 consensus Glycine C-acetyltransferase/2-amino-3-ke 99.85
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 99.85
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.84
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 99.84
KOG1412410 consensus Aspartate aminotransferase/Glutamic oxal 99.84
PRK05967395 cystathionine beta-lyase; Provisional 99.84
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.84
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.84
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 99.84
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.83
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.83
TIGR01814406 kynureninase kynureninase. This model describes ky 99.83
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 99.83
PRK07495425 4-aminobutyrate aminotransferase; Provisional 99.82
PRK13580493 serine hydroxymethyltransferase; Provisional 99.82
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 99.82
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 99.81
PRK08117433 4-aminobutyrate aminotransferase; Provisional 99.81
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.81
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.81
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.8
PRK13237460 tyrosine phenol-lyase; Provisional 99.8
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.8
PF04864363 Alliinase_C: Allinase; InterPro: IPR006948 Allicin 99.8
KOG1549428 consensus Cysteine desulfurase NFS1 [Amino acid tr 99.79
KOG1411427 consensus Aspartate aminotransferase/Glutamic oxal 99.79
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 99.79
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 99.79
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.79
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 99.79
PLN02414993 glycine dehydrogenase (decarboxylating) 99.78
PRK06058443 4-aminobutyrate aminotransferase; Provisional 99.78
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.77
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.77
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 99.76
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 99.75
PRK03715395 argD acetylornithine transaminase protein; Provisi 99.75
PLN02724 805 Molybdenum cofactor sulfurase 99.75
PRK08114395 cystathionine beta-lyase; Provisional 99.74
KOG1368384 consensus Threonine aldolase [Amino acid transport 99.74
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.74
PLN03226475 serine hydroxymethyltransferase; Provisional 99.74
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 99.73
PLN02880490 tyrosine decarboxylase 99.73
PRK06541460 hypothetical protein; Provisional 99.73
PRK02769380 histidine decarboxylase; Provisional 99.73
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 99.73
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 99.73
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.72
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 99.72
PLN02590539 probable tyrosine decarboxylase 99.72
PRK05769441 4-aminobutyrate aminotransferase; Provisional 99.71
COG0160447 GabT 4-aminobutyrate aminotransferase and related 99.71
PRK06434384 cystathionine gamma-lyase; Validated 99.71
PRK08593445 4-aminobutyrate aminotransferase; Provisional 99.71
PLN02271586 serine hydroxymethyltransferase 99.71
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 99.71
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.7
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 99.7
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 99.69
PLN03032374 serine decarboxylase; Provisional 99.69
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.69
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.68
PRK05639457 4-aminobutyrate aminotransferase; Provisional 99.68
PRK03080378 phosphoserine aminotransferase; Provisional 99.67
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 99.67
KOG1360570 consensus 5-aminolevulinate synthase [Coenzyme tra 99.66
PRK07678451 aminotransferase; Validated 99.66
KOG0053409 consensus Cystathionine beta-lyases/cystathionine 99.65
PRK12403460 putative aminotransferase; Provisional 99.64
PLN02760504 4-aminobutyrate:pyruvate transaminase 99.64
PRK05965459 hypothetical protein; Provisional 99.64
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.63
PRK04311464 selenocysteine synthase; Provisional 99.63
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 99.63
PLN02263470 serine decarboxylase 99.63
PRK07482461 hypothetical protein; Provisional 99.62
PRK07046453 aminotransferase; Validated 99.62
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 99.62
PRK06082459 4-aminobutyrate aminotransferase; Provisional 99.62
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 99.62
PRK06917447 hypothetical protein; Provisional 99.61
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 99.61
PRK13360442 omega amino acid--pyruvate transaminase; Provision 99.61
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 99.61
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.61
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 99.61
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transam 99.61
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 99.6
PRK05367954 glycine dehydrogenase; Provisional 99.6
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.6
PRK06062451 hypothetical protein; Provisional 99.6
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transam 99.59
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.59
PRK06105460 aminotransferase; Provisional 99.59
PRK07481449 hypothetical protein; Provisional 99.58
PRK07036466 hypothetical protein; Provisional 99.58
PRK06149972 hypothetical protein; Provisional 99.58
PRK15029 755 arginine decarboxylase; Provisional 99.58
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.57
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 99.57
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 99.57
PRK07483443 hypothetical protein; Provisional 99.57
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.57
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 99.56
PRK061481013 hypothetical protein; Provisional 99.56
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 99.56
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.56
PRK12566954 glycine dehydrogenase; Provisional 99.56
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.56
PRK07480456 putative aminotransferase; Validated 99.55
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.55
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.53
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 99.53
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.53
KOG2862385 consensus Alanine-glyoxylate aminotransferase AGT1 99.53
PRK13578 720 ornithine decarboxylase; Provisional 99.52
KOG1357519 consensus Serine palmitoyltransferase [Posttransla 99.5
PRK15400 714 lysine decarboxylase CadA; Provisional 99.48
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.46
PRK15399 713 lysine decarboxylase LdcC; Provisional 99.45
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.4
KOG1358467 consensus Serine palmitoyltransferase [Posttransla 99.4
PRK08297443 L-lysine aminotransferase; Provisional 99.4
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 99.37
PLN02452365 phosphoserine transaminase 99.36
TIGR00699464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.36
PRK05367 954 glycine dehydrogenase; Provisional 99.35
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.33
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.32
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.31
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 99.31
KOG1404442 consensus Alanine-glyoxylate aminotransferase AGT2 99.3
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 99.3
PLN02974817 adenosylmethionine-8-amino-7-oxononanoate transami 99.28
KOG1402427 consensus Ornithine aminotransferase [Amino acid t 99.28
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 99.27
PF06838403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 99.19
PRK12462364 phosphoserine aminotransferase; Provisional 99.18
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.15
KOG1401433 consensus Acetylornithine aminotransferase [Amino 99.13
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.11
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.0
KOG1403452 consensus Predicted alanine-glyoxylate aminotransf 99.0
KOG1383491 consensus Glutamate decarboxylase/sphingosine phos 98.93
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.9
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 98.88
KOG2467477 consensus Glycine/serine hydroxymethyltransferase 98.81
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 98.8
KOG0629510 consensus Glutamate decarboxylase and related prot 98.78
COG4100416 Cystathionine beta-lyase family protein involved i 98.69
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.57
KOG0628511 consensus Aromatic-L-amino-acid/L-histidine decarb 98.49
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 98.44
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 98.3
KOG20401001 consensus Glycine dehydrogenase (decarboxylating) 98.24
KOG1405484 consensus 4-aminobutyrate aminotransferase [Amino 98.21
PRK12566 954 glycine dehydrogenase; Provisional 98.06
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 97.91
KOG3843432 consensus Predicted serine hydroxymethyltransferas 97.51
PLN02672 1082 methionine S-methyltransferase 97.42
KOG3846465 consensus L-kynurenine hydrolase [Amino acid trans 97.26
KOG2040 1001 consensus Glycine dehydrogenase (decarboxylating) 95.53
KOG2790370 consensus Phosphoserine aminotransferase [Coenzyme 94.65
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 87.66
COG2102223 Predicted ATPases of PP-loop superfamily [General 85.44
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 81.12
>KOG0256 consensus 1-aminocyclopropane-1-carboxylate synthase, and related proteins [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-73  Score=519.63  Aligned_cols=427  Identities=63%  Similarity=1.080  Sum_probs=405.3

Q ss_pred             ccccchhhhhcccCCCCcchhhhhhhhcCCCCCCCCCCceeeeecccccccHHHHHHHHHhCCCCcccC-CCCCCCCccc
Q 046900           11 SVGLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWG-KGAPGFRENA   89 (442)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~n~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~   89 (442)
                      -+.+|+++....||.+++++.+|++|..++|++.+||.|+|+|+.+||.++.+.+++++.+.+.+..+. +|...++++.
T Consensus        36 ~~~lS~~~~~~~~~e~S~yf~g~~~y~~npy~~~~Np~GiIQmGlaENqlc~DL~~~wl~k~~~~~~~~~eg~~~f~~la  115 (471)
T KOG0256|consen   36 NNLLSSKAVDDKHGEDSSYFYGWKAYEKNPYDPIKNPLGIIQMGLAENQLCFDLIESWLSKNPEASNCTREGQSSFDELA  115 (471)
T ss_pred             hhhcccccccccccccchHHHHHHhcccCCCCCCCCchHHHHhhhhhhHHHHHHHHHHHHhChhhhhcccccccchhhHh
Confidence            357899999999999999999999999999999999999999999999999999999999988877665 7777788899


Q ss_pred             ccCCCcchHHHHHHHHHHHHHHhCCCCccCCCcEEEecChHHHHHHHHHhhcCCCCeEEEcCCCCcChHHhHhhhcCcEE
Q 046900           90 LFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKI  169 (442)
Q Consensus        90 ~Y~~~~g~~~lr~~ia~~l~~~~~~~~~~~~~~i~~t~G~~~ai~~~~~~l~~~gd~Vl~~~p~y~~~~~~~~~~~G~~v  169 (442)
                      .|++++|++.+|+++|+|+.+.++.....+|+++++++|++.++..++.+|++|||..++|+|.|+++...++.+.|+++
T Consensus       116 ~fqdy~Gl~~frqa~A~Fm~~~r~~~v~fdP~~~Vv~~G~T~ane~l~fcLadpgdafLvPtPyY~gfdrdl~~rTgvei  195 (471)
T KOG0256|consen  116 MFQDYHGLPSFRQAVAEFMERARGNRVKFDPERVVVTNGATSANETLMFCLADPGDAFLVPTPYYPGFDRDLRWRTGVEI  195 (471)
T ss_pred             hcccccCchHHHHHHHHHHHHHhCCCCccCccceEEecccchhhHHHHHHhcCCCceeeecCCCCCcccccceeccCceE
Confidence            99999999999999999999999988899999999999999999999999999999999999999999998887899999


Q ss_pred             EEEecCCCCCCcCCHHHHHHHHHHHHhcCCceeEEEEeCCCCCCCcCCCHHHHHHHHHHHHhcCcEEEEeccCCcCCCCC
Q 046900          170 VPIHCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSS  249 (442)
Q Consensus       170 ~~v~~~~~~~~~~d~~~l~~~l~~~~~~~~~~~~v~l~~P~NPtG~~~~~~~l~~l~~~~~~~~~~vi~De~y~~~~~~~  249 (442)
                      ++|.+..+++|+++++.||+++.++++.+.++|.|+++||+||.|.+++++++..++++|.++|+++|+||+|+..+|+.
T Consensus       196 vpv~c~Ss~~f~itv~alE~A~~~A~~~~~kVkGvlitNPsNPLG~~~~~e~L~~ll~Fa~~kniHvI~DEIya~sVF~~  275 (471)
T KOG0256|consen  196 VPVHCSSSNGFQITVEALEAALNQARKLGLKVKGVLITNPSNPLGTTLSPEELISLLNFASRKNIHVISDEIYAGSVFDK  275 (471)
T ss_pred             EEEEeecCCCccccHHHHHHHHHHHHHhCCceeEEEEeCCCCCCCCccCHHHHHHHHHHHhhcceEEEeehhhcccccCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcccHHHHHhhhcCCCCCcEEEEecCcccCCCCCceeEEEeecCHHHHHHHHHccccCCCcHHHHHHHHHHhcCchhHH
Q 046900          250 SEFVSIAEILEARQYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTE  329 (442)
Q Consensus       250 ~~~~s~~~~~~~~~~~~~~~vi~~~S~SK~~g~~G~RiG~i~~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~~~~~~  329 (442)
                      ..+.|+.++..+.. ...++|.+++|+||.||+||+|+|.|...++.+..+..++..++.+|++.|..++++|.+..+.+
T Consensus       276 ~~F~Sv~ev~~~~~-~~~~rvHivyslSKD~GlpGfRvGviYS~ne~VvsaA~kmssf~~vSs~tQ~~la~LLSD~~f~~  354 (471)
T KOG0256|consen  276 SEFRSVLEVRKDPH-LDPDRVHIVYSLSKDFGLPGFRVGVIYSNNEDVVSAATKMSSFGLVSSQTQYLLASLLSDEEFTR  354 (471)
T ss_pred             cCceEHHHHhhccc-cCCCcEEEEEEeccccCCCceEEEEEEecChHHHHHHHHHhhccCCcHHHHHHHHHHhchHHHHH
Confidence            99999999887621 15689999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCCeeecCCceEEEEEecCCcccccChhhHHHHHHHHHHcCcEEEeCCCCCCCCCCC
Q 046900          330 NYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPG  409 (442)
Q Consensus       330 ~~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~gi~v~pg~~f~~~~~~  409 (442)
                      .++++++++++.+.+++.+.|+++||.+.+..+|+|+|+++...+...+++.+.+++++++++.++.+.||+.|.+..+|
T Consensus       355 ~yl~en~~Rl~~rh~~~~~gLk~lgI~cl~s~AGlF~wvDlr~lL~s~tfe~El~Lw~~i~~~vklnlSpG~s~~C~EpG  434 (471)
T KOG0256|consen  355 EYLRENNKRLRIRHRYIVEGLKALGIPCLKSNAGLFCWVDLRKLLTSLTFEGELELWERILDNVKLNLSPGSSCHCHEPG  434 (471)
T ss_pred             HHHHHHHHHHHHHHHHHHhhHHhcCCceeecCCeeEEEEEhHHhcCcCChHHHHHHHHHHHHhhccccCCCCcceecCCC
Confidence            99999999999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             EEEEEeecCCHHHHHHHHHHHHHHHHHHH
Q 046900          410 WFRVCFANMSEQTLEVALKRIHNFMQKRE  438 (442)
Q Consensus       410 ~iRls~~~~~~e~i~~~l~~l~~~l~~~~  438 (442)
                      |+|++|+++.++.++-+++||+.++.+..
T Consensus       435 WFRvcFAn~~~~t~~~am~Ri~~~~~~~~  463 (471)
T KOG0256|consen  435 WFRVCFANMSEETLEVAMRRLKQFLDSQV  463 (471)
T ss_pred             eEEEEeccCCHHHHHHHHHHHHHHHHhhh
Confidence            99999999778877779999999987543

>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>KOG0257 consensus Kynurenine aminotransferase, glutamine transaminase K [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0634 consensus Aromatic amino acid aminotransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0258 consensus Alanine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>KOG0633 consensus Histidinol phosphate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>KOG1359 consensus Glycine C-acetyltransferase/2-amino-3-ketobutyrate-CoA ligase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PF04864 Alliinase_C: Allinase; InterPro: IPR006948 Allicin is a thiosulphinate that gives rise to dithiines, allyl sulphides and ajoenes, the three groups of active compounds in Allium species Back     alignment and domain information
>KOG1549 consensus Cysteine desulfurase NFS1 [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1411 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT1/GOT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>KOG1368 consensus Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG1360 consensus 5-aminolevulinate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>KOG0053 consensus Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>KOG2862 consensus Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>KOG1357 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>KOG1358 consensus Serine palmitoyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1404 consensus Alanine-glyoxylate aminotransferase AGT2 [Amino acid transport and metabolism] Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>KOG1402 consensus Ornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1401 consensus Acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1403 consensus Predicted alanine-glyoxylate aminotransferase [General function prediction only] Back     alignment and domain information
>KOG1383 consensus Glutamate decarboxylase/sphingosine phosphate lyase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2467 consensus Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>KOG0629 consensus Glutamate decarboxylase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>KOG0628 consensus Aromatic-L-amino-acid/L-histidine decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1405 consensus 4-aminobutyrate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG3843 consensus Predicted serine hydroxymethyltransferase SLA/LP (autoimmune hepatitis marker in humans) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG3846 consensus L-kynurenine hydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2040 consensus Glycine dehydrogenase (decarboxylating) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2790 consensus Phosphoserine aminotransferase [Coenzyme transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
1b8g_A429 1-aminocyclopropane-1-carboxylate Synthase Length = 1e-151
1m7y_A435 Crystal Structure Of Apple Acc Synthase In Complex 1e-151
1ynu_A473 Crystal Structure Of Apple Acc Synthase In Complex 1e-151
1iax_A428 Crystal Structure Of Acc Synthase Complexed With Pl 1e-149
3piu_A410 High-Resolution Structure Of Native Malus Domestica 1e-145
1b5o_A385 Thermus Thermophilus Aspartate Aminotransferase Sin 2e-21
1bkg_A385 Aspartate Aminotransferase From Thermus Thermophilu 2e-21
1gck_A385 Thermus Thermophilus Aspartate Aminotransferase Dou 3e-21
5bj3_A385 Thermus Thermophilus Aspartate Aminotransferase Tet 4e-21
1gc3_A385 Thermus Thermophilus Aspartate Aminotransferase Tet 4e-21
1o4s_A389 Crystal Structure Of Aspartate Aminotransferase (Tm 1e-20
1bjw_A382 Aspartate Aminotransferase From Thermus Thermophilu 2e-20
2gb3_A409 Crystal Structure Of Aspartate Aminotransferase (Tm 2e-17
2z61_A370 Crystal Structure Of Mj0684 From Methanococcus Jann 2e-17
1dju_A388 Crystal Structure Of Aromatic Aminotransferase From 9e-16
1gde_A389 Crystal Structure Of Pyrococcus Protein A-1 E-form 1e-15
1xi9_A406 Alanine Aminotransferase From Pyrococcus Furiosus P 5e-15
1v2d_A381 Crystal Structure Of T.Th Hb8 Glutamine Aminotransf 8e-15
3ele_A398 Crystal Structure Of Amino Transferase (rer07020700 2e-13
2zc0_A407 Crystal Structure Of An Archaeal Alanine:glyoxylate 3e-12
3tcm_A500 Crystal Structure Of Alanine Aminotransferase From 1e-11
3h14_A391 Crystal Structure Of A Putative Aminotransferase Fr 4e-11
3pdx_A402 Crystal Structural Of Mouse Tyrosine Aminotransfera 5e-10
1u08_A386 Crystal Structure And Reactivity Of Ybdl From Esche 6e-10
2x5d_A412 Crystal Structure Of A Probable Aminotransferase Fr 7e-10
2o1b_A404 Structure Of Aminotransferase From Staphylococcus A 9e-10
3dyd_A427 Human Tyrosine Aminotransferase Length = 427 1e-09
3op7_A375 Crystal Structure Of A Plp-Dependent Aminotransfera 2e-09
3ihj_A498 Human Alanine Aminotransferase 2 In Complex With Pl 1e-08
3b1c_A392 Crystal Structure Of Betac-S Lyase From Streptococc 2e-08
1j32_A388 Aspartate Aminotransferase From Phormidium Lapideum 8e-08
3aov_A448 Crystal Structure Of Pyrococcus Horikoshii Kynureni 2e-07
1bw0_A416 Crystal Structure Of Tyrosine Aminotransferase From 2e-07
3e2z_B410 Crystal Structure Of Mouse Kynurenine Aminotransfer 2e-07
3e2f_A410 Crystal Structure Of Mouse Kynurenine Aminotransfer 2e-07
1x0m_A403 A Human Kynurenine Aminotransferase Ii Homologue Fr 2e-07
1w7n_A422 Crystal Structure Of Human Kynurenine Aminotransfer 5e-07
1yiz_A429 Aedes Aegypti Kynurenine Aminotrasferase Length = 4 7e-07
1yiy_A429 Aedes Aegypti Kynurenine Aminotransferase Length = 7e-07
2dou_A376 Probable N-Succinyldiaminopimelate Aminotransferase 1e-06
4dgt_A391 Crystal Structure Of Plp-Bound Putative Aminotransf 2e-06
1w7l_A422 Crystal Structure Of Human Kynurenine Aminotransfer 2e-06
3fvs_A422 Human Kynurenine Aminotransferase I In Complex With 2e-06
3asa_A400 Crystal Structure Of Apo-Ll-Diaminopimelate Aminotr 1e-05
1vp4_A425 Crystal Structure Of A Putative Aminotransferase (T 1e-05
1wst_A417 Crystal Structure Of Multiple Substrate Aminotransf 1e-05
1lkc_A364 Crystal Structure Of L-Threonine-O-3-Phosphate Deca 2e-05
1c7n_A399 Crystal Structure Of Cystalysin From Treponema Dent 5e-05
2o0r_A411 The Three-Dimensional Structure Of N-Succinyldiamin 1e-04
2zy2_A544 Dodecameric L-Aspartate Beta-Decarboxylase Length = 1e-04
3l8a_A421 Crystal Structure Of Metc From Streptococcus Mutans 3e-04
3p1t_A337 Crystal Structure Of A Putative Aminotransferase (B 3e-04
3fdb_A377 Crystal Structure Of A Putative Plp-Dependent Beta- 4e-04
3fkd_A350 The Crystal Structure Of L-Threonine-O-3-Phosphate 5e-04
3b46_A447 Crystal Structure Of Bna3p, A Putative Kynurenine A 6e-04
>pdb|1B8G|A Chain A, 1-aminocyclopropane-1-carboxylate Synthase Length = 429 Back     alignment and structure 
Iteration: 1

 Score =  531 bits (1368), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 246/426 (57%), Positives = 319/426 (74%), Gaps = 5/426 (1%)
Query: 14  LSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQP 73
           LS+ A   +HG+DS YF GW+ Y++NPY E  N +G+IQMGLAENQ+ FDLLE +L + P
Sbjct: 2   LSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNP 61
Query: 74  EASTWGK-GAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAA 132
           EA+ + K G   F E ALFQDYHGL +F++AM  FM +IRG +  FD N +V+TAGAT+A
Sbjct: 62  EAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSA 121
Query: 133 NELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYK 192
           NE   F LADPG+A+L+PTPYYPGFDRDL+WRTG++IVPIHC SSN FQIT  ALE AY+
Sbjct: 122 NETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQ 181
Query: 193 EAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYXXXXXXXXXX 252
           EAE +++RV+GVL+TNPSNPLG T+ R+ L  LL F   K IHL+SDEIY          
Sbjct: 182 EAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSF 241
Query: 253 XXXXXXLEARQYKDS----ERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFT 308
                 L+ R   ++    +RVH+VYSLSKDLGLPGFRVG IYS +D VV  A +MSSF 
Sbjct: 242 ISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFG 301
Query: 309 LISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWM 368
           L+SSQTQ+LL++MLS+KK T+NYI  N +RL++R + ++ GL+ +GI CL GNAGLFCW+
Sbjct: 302 LVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWV 361
Query: 369 NLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALK 428
           ++  LL   T E E+ LW  +++EV LNISPGSSCHC+EPGWFRVCFAN+ E+TL++A++
Sbjct: 362 DMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAMQ 421
Query: 429 RIHNFM 434
           R+  F+
Sbjct: 422 RLKAFV 427
>pdb|1M7Y|A Chain A, Crystal Structure Of Apple Acc Synthase In Complex With L- Aminoethoxyvinylglycine Length = 435 Back     alignment and structure
>pdb|1YNU|A Chain A, Crystal Structure Of Apple Acc Synthase In Complex With L-Vinylglycine Length = 473 Back     alignment and structure
>pdb|1IAX|A Chain A, Crystal Structure Of Acc Synthase Complexed With Plp Length = 428 Back     alignment and structure
>pdb|1B5O|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Single Mutant 1 Length = 385 Back     alignment and structure
>pdb|1BKG|A Chain A, Aspartate Aminotransferase From Thermus Thermophilus With Maleate Length = 385 Back     alignment and structure
>pdb|1GCK|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Double Mutant 1 Complexed With Aspartate Length = 385 Back     alignment and structure
>pdb|5BJ3|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Tetra Mutant 1 Length = 385 Back     alignment and structure
>pdb|1GC3|A Chain A, Thermus Thermophilus Aspartate Aminotransferase Tetra Mutant 2 Complexed With Tryptophan Length = 385 Back     alignment and structure
>pdb|1O4S|A Chain A, Crystal Structure Of Aspartate Aminotransferase (Tm1255) From Thermotoga Maritima At 1.90 A Resolution Length = 389 Back     alignment and structure
>pdb|1BJW|A Chain A, Aspartate Aminotransferase From Thermus Thermophilus Length = 382 Back     alignment and structure
>pdb|2GB3|A Chain A, Crystal Structure Of Aspartate Aminotransferase (Tm1698) From Thermotoga Maritima At 2.50 A Resolution Length = 409 Back     alignment and structure
>pdb|2Z61|A Chain A, Crystal Structure Of Mj0684 From Methanococcus Jannaschii Reveals Its Similarity In The Active Site To Kynurenine Aminotransferases Length = 370 Back     alignment and structure
>pdb|1DJU|A Chain A, Crystal Structure Of Aromatic Aminotransferase From Pyrococcus Horikoshii Ot3 Length = 388 Back     alignment and structure
>pdb|1GDE|A Chain A, Crystal Structure Of Pyrococcus Protein A-1 E-form Length = 389 Back     alignment and structure
>pdb|1XI9|A Chain A, Alanine Aminotransferase From Pyrococcus Furiosus Pfu-1397077-001 Length = 406 Back     alignment and structure
>pdb|1V2D|A Chain A, Crystal Structure Of T.Th Hb8 Glutamine Aminotransferase Length = 381 Back     alignment and structure
>pdb|3ELE|A Chain A, Crystal Structure Of Amino Transferase (rer070207001803) From Eubacterium Rectale At 2.10 A Resolution Length = 398 Back     alignment and structure
>pdb|2ZC0|A Chain A, Crystal Structure Of An Archaeal Alanine:glyoxylate Aminotransferase Length = 407 Back     alignment and structure
>pdb|3TCM|A Chain A, Crystal Structure Of Alanine Aminotransferase From Hordeum Vulgare Length = 500 Back     alignment and structure
>pdb|3H14|A Chain A, Crystal Structure Of A Putative Aminotransferase From Silicibacter Pomeroyi Length = 391 Back     alignment and structure
>pdb|3PDX|A Chain A, Crystal Structural Of Mouse Tyrosine Aminotransferase Length = 402 Back     alignment and structure
>pdb|1U08|A Chain A, Crystal Structure And Reactivity Of Ybdl From Escherichia Coli Identify A Methionine Aminotransferase Function. Length = 386 Back     alignment and structure
>pdb|2X5D|A Chain A, Crystal Structure Of A Probable Aminotransferase From Pseudomonas Aeruginosa Length = 412 Back     alignment and structure
>pdb|2O1B|A Chain A, Structure Of Aminotransferase From Staphylococcus Aureus Length = 404 Back     alignment and structure
>pdb|3DYD|A Chain A, Human Tyrosine Aminotransferase Length = 427 Back     alignment and structure
>pdb|3OP7|A Chain A, Crystal Structure Of A Plp-Dependent Aminotransferase (Zp_03625122.1) From Streptococcus Suis 89-1591 At 1.70 A Resolution Length = 375 Back     alignment and structure
>pdb|3IHJ|A Chain A, Human Alanine Aminotransferase 2 In Complex With Plp Length = 498 Back     alignment and structure
>pdb|3B1C|A Chain A, Crystal Structure Of Betac-S Lyase From Streptococcus Anginosus: Internal Aldimine Form Length = 392 Back     alignment and structure
>pdb|1J32|A Chain A, Aspartate Aminotransferase From Phormidium Lapideum Length = 388 Back     alignment and structure
>pdb|3AOV|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Kynurenine Aminotransferase In Complex With Plp Length = 448 Back     alignment and structure
>pdb|1BW0|A Chain A, Crystal Structure Of Tyrosine Aminotransferase From Trypanosoma Cruzi Length = 416 Back     alignment and structure
>pdb|3E2Z|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii In Complex With Kynurenine Length = 410 Back     alignment and structure
>pdb|3E2F|A Chain A, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii, Plp-Bound Form Length = 410 Back     alignment and structure
>pdb|1X0M|A Chain A, A Human Kynurenine Aminotransferase Ii Homologue From Pyrococcus Horikoshii Ot3 Length = 403 Back     alignment and structure
>pdb|1W7N|A Chain A, Crystal Structure Of Human Kynurenine Aminotransferase I In Pmp Form Length = 422 Back     alignment and structure
>pdb|1YIZ|A Chain A, Aedes Aegypti Kynurenine Aminotrasferase Length = 429 Back     alignment and structure
>pdb|1YIY|A Chain A, Aedes Aegypti Kynurenine Aminotransferase Length = 429 Back     alignment and structure
>pdb|2DOU|A Chain A, Probable N-Succinyldiaminopimelate Aminotransferase (Ttha0342) From Thermus Thermophilus Hb8 Length = 376 Back     alignment and structure
>pdb|4DGT|A Chain A, Crystal Structure Of Plp-Bound Putative Aminotransferase From Clostridium Difficile 630 Crystallized With Magnesium Formate Length = 391 Back     alignment and structure
>pdb|1W7L|A Chain A, Crystal Structure Of Human Kynurenine Aminotransferase I Length = 422 Back     alignment and structure
>pdb|3FVS|A Chain A, Human Kynurenine Aminotransferase I In Complex With Glycerol Length = 422 Back     alignment and structure
>pdb|3ASA|A Chain A, Crystal Structure Of Apo-Ll-Diaminopimelate Aminotransferase From Chlamydia Trachomatis Length = 400 Back     alignment and structure
>pdb|1VP4|A Chain A, Crystal Structure Of A Putative Aminotransferase (Tm1131) From Thermotoga Maritima Msb8 At 1.82 A Resolution Length = 425 Back     alignment and structure
>pdb|1WST|A Chain A, Crystal Structure Of Multiple Substrate Aminotransferase (Msat) From Thermococcus Profundus Length = 417 Back     alignment and structure
>pdb|1LKC|A Chain A, Crystal Structure Of L-Threonine-O-3-Phosphate Decarboxylase From Salmonella Enterica Length = 364 Back     alignment and structure
>pdb|1C7N|A Chain A, Crystal Structure Of Cystalysin From Treponema Denticola Contains A Pyridoxal 5'-Phosphate Cofactor Length = 399 Back     alignment and structure
>pdb|2O0R|A Chain A, The Three-Dimensional Structure Of N-Succinyldiaminopimelate Aminotransferase From Mycobacterium Tuberculosis Length = 411 Back     alignment and structure
>pdb|2ZY2|A Chain A, Dodecameric L-Aspartate Beta-Decarboxylase Length = 544 Back     alignment and structure
>pdb|3L8A|A Chain A, Crystal Structure Of Metc From Streptococcus Mutans Length = 421 Back     alignment and structure
>pdb|3P1T|A Chain A, Crystal Structure Of A Putative Aminotransferase (Bpsl1724) From Burkholderia Pseudomallei K96243 At 2.60 A Resolution Length = 337 Back     alignment and structure
>pdb|3FDB|A Chain A, Crystal Structure Of A Putative Plp-Dependent Beta-Cystathionase (Aecd, Dip1736) From Corynebacterium Diphtheriae At 1.99 A Resolution Length = 377 Back     alignment and structure
>pdb|3FKD|A Chain A, The Crystal Structure Of L-Threonine-O-3-Phosphate Decarboxylase From Porphyromonas Gingivalis Length = 350 Back     alignment and structure
>pdb|3B46|A Chain A, Crystal Structure Of Bna3p, A Putative Kynurenine Aminotransferase From Saccharomyces Cerevisiae Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query442
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 0.0
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 0.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 3e-52
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 2e-50
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 4e-50
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 6e-46
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 2e-45
1xi9_A406 Putative transaminase; alanine aminotransferase, s 2e-44
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 6e-44
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 2e-43
3ele_A398 Amino transferase; RER070207001803, structural gen 5e-43
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 1e-41
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 6e-41
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 8e-41
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 8e-41
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 8e-41
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 5e-40
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 6e-40
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 4e-39
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 8e-39
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 1e-38
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 1e-38
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 2e-38
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 2e-38
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 4e-38
3nra_A407 Aspartate aminotransferase; structural genomics, j 3e-37
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 4e-37
2z61_A370 Probable aspartate aminotransferase 2; amino acid 8e-36
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 2e-35
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 1e-34
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 2e-33
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 3e-33
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 2e-32
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 3e-32
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 4e-32
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 1e-31
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 3e-31
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 4e-31
1vp4_A425 Aminotransferase, putative; structural genomics, j 3e-30
3aow_A448 Putative uncharacterized protein PH0207; protein-P 1e-29
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 2e-27
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 1e-25
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 2e-25
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 9e-25
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 1e-24
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 1e-24
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 4e-21
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 4e-19
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 6e-19
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 1e-18
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 1e-18
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 2e-18
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 5e-18
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 5e-18
3ftb_A361 Histidinol-phosphate aminotransferase; structural 1e-17
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 2e-17
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 2e-17
3l8a_A421 METC, putative aminotransferase, probable beta-cys 5e-17
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 3e-14
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 5e-13
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 6e-13
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 5e-12
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 4e-11
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 2e-10
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 3e-10
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 3e-10
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 1e-09
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 1e-06
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 5e-05
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 8e-04
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Length = 428 Back     alignment and structure
 Score =  650 bits (1680), Expect = 0.0
 Identities = 241/426 (56%), Positives = 328/426 (76%), Gaps = 2/426 (0%)

Query: 14  LSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQP 73
           LSK+A +E HGE+SPYF GWKAYD +P+    NP+GVIQMGLAENQ+  DL+E+++++ P
Sbjct: 2   LSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRNP 61

Query: 74  EASTWGKGAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAAN 133
           + S   +G   F+  A FQDYHGL  FR+A+A FME+ RGGR +FD  R+V+  GAT AN
Sbjct: 62  KGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGAN 121

Query: 134 ELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYKE 193
           E + F LADPGDA LVP+PYYP F+RDLRWRTG++++PIHC+SSNNF+IT +A++ AY+ 
Sbjct: 122 ETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKAVKEAYEN 181

Query: 194 AESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEFV 253
           A+  +++V+G+++TNPSNPLG T+ +  L+ +L F  + NIHLV DEIY+ + F + +FV
Sbjct: 182 AQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV 241

Query: 254 SIAEILEARQ--YKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLIS 311
           SIAEIL+ ++  Y + + VHIVYSLSKD+GLPGFRVG IYS+ND VV  AR+MSSF L+S
Sbjct: 242 SIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVS 301

Query: 312 SQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLS 371
           +QTQY LA+MLS++KF +N+++ +  RL KR++    GL   GI+CLK NAGLFCWM+L 
Sbjct: 302 TQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLR 361

Query: 372 PLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALKRIH 431
           PLL E T + E++LW  ++++VKLN+SPGSS  C EPGWFRVCFANM + T+++AL RI 
Sbjct: 362 PLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGTVDIALARIR 421

Query: 432 NFMQKR 437
            F+   
Sbjct: 422 RFVGVE 427
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Length = 435 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Length = 427 Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Length = 416 Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Length = 375 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Length = 412 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Length = 500 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Length = 406 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Length = 391 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Length = 437 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Length = 398 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Length = 389 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Length = 386 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Length = 409 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Length = 404 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Length = 411 Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Length = 498 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} PDB: 2zjg_A* 3e2f_A* 3e2z_A* Length = 410 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Length = 381 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Length = 429 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Length = 447 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Length = 422 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Length = 376 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Length = 400 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Length = 407 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Length = 449 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Length = 370 Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Length = 385 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Length = 432 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Length = 388 Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Length = 427 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Length = 389 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Length = 444 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Length = 407 Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Length = 417 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Length = 533 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Length = 546 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Length = 425 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Length = 448 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} Length = 376 Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Length = 423 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Length = 391 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Length = 396 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Length = 397 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Length = 425 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Length = 427 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Length = 422 Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Length = 364 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Length = 391 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Length = 390 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Length = 392 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Length = 399 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} Length = 361 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} Length = 391 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Length = 377 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Length = 421 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Length = 350 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Length = 354 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} Length = 363 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Length = 365 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Length = 369 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} Length = 367 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Length = 337 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Length = 356 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Length = 360 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Length = 335 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Length = 371 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Length = 755 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query442
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 100.0
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 100.0
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 100.0
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 100.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 100.0
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 100.0
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 100.0
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 100.0
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 100.0
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 100.0
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 100.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 100.0
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 100.0
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 100.0
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 100.0
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 100.0
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 100.0
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 100.0
3ele_A398 Amino transferase; RER070207001803, structural gen 100.0
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 100.0
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 100.0
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 100.0
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 100.0
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 100.0
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 100.0
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 100.0
1vp4_A425 Aminotransferase, putative; structural genomics, j 100.0
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 100.0
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 100.0
1xi9_A406 Putative transaminase; alanine aminotransferase, s 100.0
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 100.0
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 100.0
3nra_A407 Aspartate aminotransferase; structural genomics, j 100.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 100.0
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 100.0
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 100.0
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 100.0
3rq1_A418 Aminotransferase class I and II; structural genomi 100.0
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 100.0
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 100.0
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 100.0
2z61_A370 Probable aspartate aminotransferase 2; amino acid 100.0
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 100.0
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 100.0
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 100.0
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 100.0
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 100.0
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 100.0
3l8a_A421 METC, putative aminotransferase, probable beta-cys 100.0
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 100.0
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 100.0
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 100.0
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 100.0
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 100.0
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 100.0
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 100.0
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 100.0
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 100.0
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 100.0
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 100.0
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 100.0
3ftb_A361 Histidinol-phosphate aminotransferase; structural 100.0
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 100.0
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 100.0
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 100.0
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 100.0
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 100.0
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 100.0
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 100.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 100.0
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 100.0
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 100.0
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 100.0
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 100.0
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 100.0
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 100.0
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 100.0
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 100.0
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 100.0
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 100.0
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 100.0
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 100.0
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 100.0
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 100.0
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 100.0
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 100.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 100.0
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 100.0
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 100.0
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 100.0
1svv_A359 Threonine aldolase; structural genomics, structura 100.0
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 100.0
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 100.0
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 100.0
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 100.0
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 100.0
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 100.0
1iug_A352 Putative aspartate aminotransferase; wild type, py 100.0
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 100.0
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 100.0
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 100.0
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 100.0
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 100.0
2yrr_A353 Aminotransferase, class V; structural genomics, NP 100.0
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 100.0
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 100.0
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 100.0
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 100.0
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 100.0
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 100.0
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 100.0
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 100.0
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 99.98
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.97
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.97
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.97
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.97
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.97
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.97
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 99.97
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.97
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.97
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.97
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.97
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 99.97
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.97
3pj0_A359 LMO0305 protein; structural genomics, joint center 99.97
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.97
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.97
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 99.97
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.97
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 99.97
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.97
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.97
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.97
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 99.97
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.97
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.97
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.97
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.97
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.97
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.97
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 99.96
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.96
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.96
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 99.96
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.96
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.96
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.96
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.96
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.96
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.96
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 99.96
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.96
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.96
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.96
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.96
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.96
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.96
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.96
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.96
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.96
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.96
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.96
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.96
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.95
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.95
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.95
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.95
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.95
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.95
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.95
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.95
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 99.95
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.95
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.95
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.95
3hmu_A472 Aminotransferase, class III; structural genomics, 99.95
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.95
2fnu_A375 Aminotransferase; protein-product complex, structu 99.95
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 99.95
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.95
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.95
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.95
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.94
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.94
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.94
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.94
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.94
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 99.94
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.94
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.94
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.94
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.94
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.93
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.93
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.93
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.93
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.93
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.93
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.92
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 99.92
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.92
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.92
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.91
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.91
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.91
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.91
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.91
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.9
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.9
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.9
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 99.9
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 99.89
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 99.89
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.82
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.88
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 99.88
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 99.86
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 99.8
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.76
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.75
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.74
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.73
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.71
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 99.63
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 99.62
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.58
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 99.57
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.51
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 83.12
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
Probab=100.00  E-value=6.8e-59  Score=463.90  Aligned_cols=425  Identities=60%  Similarity=1.059  Sum_probs=355.4

Q ss_pred             cchhhhhcccCCCCcchhhhhhhhcCCCCCCCCCCceeeeecccccccHHHHHHHHHhCCCCcccC-CCCCCCCcccccC
Q 046900           14 LSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWG-KGAPGFRENALFQ   92 (442)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~n~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~Y~   92 (442)
                      +|+|+.+..++++++++.+|+.+.+++|+++.||.++|+|++++|+++.+.+.+++.+......+. +|....+....|+
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~p~~~i~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~y~   83 (435)
T 3piu_A            4 LSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNPEAAAFKKNGESIFAELALFQ   83 (435)
T ss_dssp             --------------CTTHHHHHHHHSBCBTTTBTTSBEECSSCCCCSSHHHHHHHHHHCTTGGGTEETTEECHHHHHHCC
T ss_pred             cchhhhhcccccCcchhhHHHHhhcCCCCcccCCCCeEEeccccccccHHHHHHHHHhCccccccccccccccccccccC
Confidence            689999999999999999999999999999999999999999999999999999998876432211 1222223446799


Q ss_pred             CCcchHHHHHHHHHHHHHHhCCCCccCCCcEEEecChHHHHHHHHHhhcCCCCeEEEcCCCCcChHHhHhhhcCcEEEEE
Q 046900           93 DYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPI  172 (442)
Q Consensus        93 ~~~g~~~lr~~ia~~l~~~~~~~~~~~~~~i~~t~G~~~ai~~~~~~l~~~gd~Vl~~~p~y~~~~~~~~~~~G~~v~~v  172 (442)
                      +..|..+||+++|+++++.++.++++++++|++|+|+++++..++.+++++||.|+++.|+|..+...+....|++++.+
T Consensus        84 ~~~g~~~l~~~la~~~~~~~~~~~~~~~~~v~~~~gg~~a~~~~~~~l~~~gd~vl~~~p~~~~~~~~~~~~~g~~~~~~  163 (435)
T 3piu_A           84 DYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPI  163 (435)
T ss_dssp             CTTCCHHHHHHHHHHHHHHTTTSSCCCGGGEEEEEHHHHHHHHHHHHHCCTTCEEEEEESCCTTHHHHTTTTTCCEEEEE
T ss_pred             CCCCcHHHHHHHHHHHHHhhCCCCCCCHHHEEEcCChHHHHHHHHHHhcCCCCeEEECCCccccHHHHHHHhcCCEEEEe
Confidence            99999999999999999877766778899999999999999999999999999999999999999887762389999999


Q ss_pred             ecCCCCCCcCCHHHHHHHHHHHHhcCCceeEEEEeCCCCCCCcCCCHHHHHHHHHHHHhcCcEEEEeccCCcCCCCCCCc
Q 046900          173 HCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEF  252 (442)
Q Consensus       173 ~~~~~~~~~~d~~~l~~~l~~~~~~~~~~~~v~l~~P~NPtG~~~~~~~l~~l~~~~~~~~~~vi~De~y~~~~~~~~~~  252 (442)
                      +++++++|.+|++.|++++++....+.++++|++++|+||||.+++.+++++|+++|++||+++|+||+|+.+.|++..+
T Consensus       164 ~~~~~~~~~~d~~~l~~~l~~~~~~~~~~~~v~i~~p~nptG~~~~~~~l~~l~~~~~~~~~~li~Dea~~~~~~~~~~~  243 (435)
T 3piu_A          164 HCTSSNGFQITETALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSF  243 (435)
T ss_dssp             ECCGGGTSCCCHHHHHHHHHHHHHTTCCEEEEEEESSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEECTTGGGCCSSSCC
T ss_pred             eCCCccCCcCCHHHHHHHHHHHHhcCCCeEEEEEcCCCCCCCCCCCHHHHHHHHHHHHHcCCEEEEeccccccccCCCCC
Confidence            99887789999999999998866666688999999999999999999999999999999999999999999998888777


Q ss_pred             ccHHHHHhhhcCC----CCCcEEEEecCcccCCCCCceeEEEeecCHHHHHHHHHccccCCCcHHHHHHHHHHhcCchhH
Q 046900          253 VSIAEILEARQYK----DSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFT  328 (442)
Q Consensus       253 ~s~~~~~~~~~~~----~~~~vi~~~S~SK~~g~~G~RiG~i~~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~~~~~  328 (442)
                      .++..+..+.+.+    ..+++++++||||.||++|+|+||++++++.+.+.+++...++..+++.|.++.+++.+.+++
T Consensus       244 ~~~~~~~~~~~~d~~~~~~~~~i~i~s~sK~~g~~G~r~G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~  323 (435)
T 3piu_A          244 ISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLT  323 (435)
T ss_dssp             CCHHHHHHC-------CGGGGEEEEEESSSSSCCGGGCEEEEEESCHHHHHHHHHHGGGSCCCHHHHHHHHHHHHCHHHH
T ss_pred             cCHHHhccccccccccCCCCCEEEEEeeecccCCCceeEEEEEeCCHHHHHHHHHHhhcCCCCHHHHHHHHHHhcChHHH
Confidence            7887776521000    037889999999999999999999999778888888877777778999999999999988877


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhCCCeeecCCceEEEEEecCCcccccChhhHHHHHHHHHHcCcEEEeCCCCCCCCCC
Q 046900          329 ENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEP  408 (442)
Q Consensus       329 ~~~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~gi~v~pg~~f~~~~~  408 (442)
                      +++++++++.++++++.+.+.|++.|+++..+.+|+|+|++++.........+..++++.|++++||.+.||+.|+...+
T Consensus       324 ~~~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~g~~~~~~l~~~~~~~~~~~~~~~~~~l~~~~gi~v~~g~~~~~~~~  403 (435)
T 3piu_A          324 KNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEP  403 (435)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTTCEECCCCSSSEEEEECGGGSSSSSHHHHHHHHHHHHHTSCEECEEGGGGTCSST
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcCCcccCCCeeEEEEEEcccccccCCchhHHHHHHHHHHHCCEEEeCCcccCCCCC
Confidence            77888999999999999999999999999999999999999986543333334678889998888999999999987778


Q ss_pred             CEEEEEeecCCHHHHHHHHHHHHHHHHHHH
Q 046900          409 GWFRVCFANMSEQTLEVALKRIHNFMQKRE  438 (442)
Q Consensus       409 ~~iRls~~~~~~e~i~~~l~~l~~~l~~~~  438 (442)
                      +++||+++..+++++++++++|++++++.+
T Consensus       404 ~~iRi~~~~~~~e~i~~~l~~l~~~l~~~~  433 (435)
T 3piu_A          404 GWFRVCFANLPERTLDLAMQRLKAFVGEYY  433 (435)
T ss_dssp             TEEEEECSSSCHHHHHHHHHHHHHHHHHHC
T ss_pred             CEEEEEeeCCCHHHHHHHHHHHHHHHHHHh
Confidence            999999986689999999999999998764
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 442
d1m7ya_431 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 1e-110
d1iaya_428 c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate sy 1e-107
d1j32a_388 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pho 3e-57
d1gdea_388 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 6e-57
d1b5pa_382 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 1e-55
d1xi9a_395 c.67.1.1 (A:) Putative alanine aminotransferase {P 4e-38
d2hoxa1425 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativ 6e-37
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 4e-34
d1o4sa_375 c.67.1.1 (A:) Aspartate aminotransferase, AAT {The 3e-31
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 3e-30
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 5e-28
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 4e-27
d1w7la_418 c.67.1.1 (A:) Kynurenine--oxoglutarate transaminas 1e-26
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 1e-25
d1wsta1403 c.67.1.1 (A:13-415) Multiple substrate aminotransf 2e-24
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 4e-22
d2r5ea1418 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate trans 5e-22
d1v2da_368 c.67.1.1 (A:) Glutamine aminotransferase {Thermus 7e-22
d1bw0a_412 c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Try 2e-19
d1u08a_382 c.67.1.1 (A:) Putative methionine aminotransferase 9e-15
d1vp4a_420 c.67.1.1 (A:) Putative aminotransferase TM1131 {Th 3e-13
d1c7na_394 c.67.1.3 (A:) Cystalysin {Treponema denticola [Tax 2e-12
d1d2fa_361 c.67.1.3 (A:) Modulator in mal gene expression, Ma 9e-10
d1fg7a_354 c.67.1.1 (A:) Histidinol-phosphate aminotransferas 1e-04
d1lc5a_355 c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxyl 2e-04
d1ax4a_465 c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanas 4e-04
d1c7ga_456 c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbi 6e-04
d2e7ja1364 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase ( 7e-04
d2aeua1366 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Ar 0.001
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Length = 431 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: 1-aminocyclopropane-1-carboxylate synthase (ACC synthase)
species: Apple (Malus domestica) [TaxId: 3750]

 Score =  330 bits (846), Expect = e-110
 Identities = 255/428 (59%), Positives = 332/428 (77%), Gaps = 5/428 (1%)

Query: 14  LSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQP 73
           LS+ A   +HG+DS YF GW+ Y++NPY E  N +G+IQMGLAENQ+ FDLLE +L + P
Sbjct: 2   LSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAKNP 61

Query: 74  EASTWGK-GAPGFRENALFQDYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAA 132
           EA+ + K G   F E ALFQDYHGL +F++AM  FM +IRG +  FD N +V+TAGAT+A
Sbjct: 62  EAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSA 121

Query: 133 NELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPIHCDSSNNFQITPQALEAAYK 192
           NE   F LADPG+A+L+PTPYYPGFDRDL+WRTG++IVPIHC SSN FQIT  ALE AY+
Sbjct: 122 NETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQ 181

Query: 193 EAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEF 252
           EAE +++RV+GVL+TNPSNPLG T+ R+ L  LL F   K IHL+SDEIYSG+AFSS  F
Sbjct: 182 EAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSF 241

Query: 253 VSIAEILEAR----QYKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFT 308
           +S+ E+L+ R      +  +RVH+VYSLSKDLGLPGFRVG IYS +D VV  A +MSSF 
Sbjct: 242 ISVMEVLKDRNCDENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFG 301

Query: 309 LISSQTQYLLASMLSNKKFTENYIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWM 368
           L+SSQTQ+LL++MLS+KK T+NYI  N +RL++R + ++ GL+ +GI CL GNAGLFCW+
Sbjct: 302 LVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWV 361

Query: 369 NLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGWFRVCFANMSEQTLEVALK 428
           ++  LL   T E E+ LW  +++EV LNISPGSSCHC+EPGWFRVCFAN+ E+TL++A++
Sbjct: 362 DMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAMQ 421

Query: 429 RIHNFMQK 436
           R+  F+ +
Sbjct: 422 RLKAFVGE 429
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 428 Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Length = 388 Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 388 Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Length = 382 Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Length = 395 Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Length = 425 Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Length = 375 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Length = 418 Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Length = 403 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 418 Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 368 Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Length = 412 Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Length = 382 Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Length = 420 Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Length = 394 Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Length = 361 Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Length = 354 Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Length = 355 Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Length = 465 Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Length = 456 Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 364 Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query442
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 100.0
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 100.0
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 100.0
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 100.0
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 100.0
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 100.0
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 100.0
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 100.0
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 100.0
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 100.0
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 100.0
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 100.0
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 100.0
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 100.0
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 100.0
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 100.0
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 100.0
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 99.96
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.96
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 99.93
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 99.93
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 99.93
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.93
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.92
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 99.91
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.87
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.85
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.85
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 99.84
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.84
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 99.84
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.82
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.81
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 99.8
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.8
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 99.78
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 99.78
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.78
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 99.76
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 99.75
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 99.75
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.75
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 99.74
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.74
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.73
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.71
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 99.71
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.7
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.7
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.69
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 99.69
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.69
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 99.69
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.69
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 99.69
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 99.68
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 99.68
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.66
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 99.63
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 99.63
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.63
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 99.62
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.62
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.61
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.6
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.58
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.57
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.53
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 99.52
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 99.47
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.4
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 99.22
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 99.06
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 99.04
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.98
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 98.88
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 80.93
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: 1-aminocyclopropane-1-carboxylate synthase (ACC synthase)
species: Tomato (Lycopersicon esculentum) [TaxId: 4081]

Probab=100.00  E-value=1.5e-70  Score=543.92  Aligned_cols=425  Identities=57%  Similarity=1.063  Sum_probs=376.9

Q ss_pred             ccchhhhhcccCCCCcchhhhhhhhcCCCCCCCCCCceeeeecccccccHHHHHHHHHhCCCCcccCCCCCCCCcccccC
Q 046900           13 GLSKVAVSETHGEDSPYFAGWKAYDENPYEESTNPSGVIQMGLAENQVSFDLLEEYLEQQPEASTWGKGAPGFRENALFQ   92 (442)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~   92 (442)
                      ++||++.+..||++|+++.+|+.+..++|++..||.|+|+|+++||.++++.+.+++.+.+......++...+....+|+
T Consensus         1 ~~~~~~~~~~~~~~s~y~~g~~~~~~~~~~~~~np~G~i~l~~aen~l~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~Y~   80 (428)
T d1iaya_           1 ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLCLDLIEDWIKRNPKGSICSEGIKSFKAIANFQ   80 (428)
T ss_dssp             CCCTTGGGC-----CCTTHHHHHHHHSBCCSSSSTTSBEECSSCCCCSSHHHHHHHHHHCTTSSTTC----CHHHHHHCC
T ss_pred             CcccccccCCCCCCChhhHhHHHhccCCCCCcCCCCceEEeecccCccchHHHHHHHHhCCchhhhHhHhhhCHHhccCc
Confidence            58999999999999999999999999999999999999999999999999999999998876554433444445567899


Q ss_pred             CCcchHHHHHHHHHHHHHHhCCCCccCCCcEEEecChHHHHHHHHHhhcCCCCeEEEcCCCCcChHHhHhhhcCcEEEEE
Q 046900           93 DYHGLKSFRQAMASFMEQIRGGRAKFDLNRIVVTAGATAANELLTFILADPGDALLVPTPYYPGFDRDLRWRTGIKIVPI  172 (442)
Q Consensus        93 ~~~g~~~lr~~ia~~l~~~~~~~~~~~~~~i~~t~G~~~ai~~~~~~l~~~gd~Vl~~~p~y~~~~~~~~~~~G~~v~~v  172 (442)
                      ++.|.++||++||+|++++++..+.+++++|++|+|+++++..++.+++++||.|++++|+|+.+...+....|++++++
T Consensus        81 ~~~G~~~LR~aiA~~l~~~~~~~~~~~~e~Ivit~G~~~al~~~~~~l~~~Gd~Vlv~~P~y~~~~~~~~~~~g~~~v~v  160 (428)
T d1iaya_          81 DYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPI  160 (428)
T ss_dssp             CTTCCHHHHHHHHHHHHHHTTTCSCCCTTSCEEEEHHHHHHHHHHHHHCCTTCEEEEESSCCTTHHHHTTTTTCCEEEEE
T ss_pred             CCcchHHHHHHHHHHHHHHhCCCCCCChhhEEEcCCHHHHHHHHHHHhCCCCCEEEEccCCchHHHHHHHHhcCCeEEEe
Confidence            99999999999999999999877778999999999999999999999999999999999999999887765469999999


Q ss_pred             ecCCCCCCcCCHHHHHHHHHHHHhcCCceeEEEEeCCCCCCCcCCCHHHHHHHHHHHHhcCcEEEEeccCCcCCCCCCCc
Q 046900          173 HCDSSNNFQITPQALEAAYKEAESKDMRVRGVLITNPSNPLGATIQRSVLEELLDFATRKNIHLVSDEIYSGSAFSSSEF  252 (442)
Q Consensus       173 ~~~~~~~~~~d~~~l~~~l~~~~~~~~~~~~v~l~~P~NPtG~~~~~~~l~~l~~~~~~~~~~vi~De~y~~~~~~~~~~  252 (442)
                      +++.+++|.+|++.++.++......+.++++++++|||||||.+++.+++++|+++|++|+++||+||+|+++.|++..+
T Consensus       161 ~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~l~nP~NPtG~~~s~~~~~~i~~~a~~~~~~vI~De~Y~~~~~~~~~~  240 (428)
T d1iaya_         161 HCESSNNFKITSKAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQF  240 (428)
T ss_dssp             CCCTTTTTCCCHHHHHHHHHHHHHTTCCEEEEEEESSCTTTCCCCCHHHHHHHHHHHHTTTCEEEEECTTGGGCCSSSCC
T ss_pred             ecccccccccccccccchhhhhhccCCCceEEEEccCCCcccccccccccchhheeeccCcEEEEecccccccccCcccc
Confidence            99988899999999999888777777889999999999999999999999999999999999999999999999998888


Q ss_pred             ccHHHHHhhhc--CCCCCcEEEEecCcccCCCCCceeEEEeecCHHHHHHHHHccccCCCcHHHHHHHHHHhcCchhHHH
Q 046900          253 VSIAEILEARQ--YKDSERVHIVYSLSKDLGLPGFRVGTIYSYNDKVVTTARRMSSFTLISSQTQYLLASMLSNKKFTEN  330 (442)
Q Consensus       253 ~s~~~~~~~~~--~~~~~~vi~~~S~SK~~g~~G~RiG~i~~~~~~~~~~~~~~~~~~~~s~~~q~~~~~~l~~~~~~~~  330 (442)
                      .++.++.....  ....+++++++||||.|+++|+|+||++++++.+.+.++....+..++.+.|.++++.+.+..+.++
T Consensus       241 ~s~~~~~~~~~~~~~~~~~vi~~~s~SK~~~~~GlRiG~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~a~l~~~~~~~~  320 (428)
T d1iaya_         241 VSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKFVDN  320 (428)
T ss_dssp             CCHHHHHTSGGGTTSCTTSEEEEEESTTTSSCGGGCEEEEEESCHHHHHHHHHHHTTSCCCHHHHHHHHHHTTCHHHHHH
T ss_pred             cccccccchhhccccccceEEEEecCCCcccCCCcccccccccccchhhhhhhhhcccccccccccchhhhhhhhccccc
Confidence            88888765321  2345789999999999999999999999988888888888777777888999999999988888888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCeeecCCceEEEEEecCCcccccChhhHHHHHHHHHHcCcEEEeCCCCCCCCCCCE
Q 046900          331 YIKTNRERLQKRYQMIIEGLRSAGIECLKGNAGLFCWMNLSPLLEEQTREGELALWDSMLHEVKLNISPGSSCHCSEPGW  410 (442)
Q Consensus       331 ~~~~~~~~~~~~~~~l~~~L~~~g~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~gi~v~pg~~f~~~~~~~  410 (442)
                      ++++.++.++++++.+.+.|+..|+++.+|+||||+|++++........+++.++++.|++++||.+.||+.|+..+++|
T Consensus       321 ~~~~~~~~l~~r~~~~~~~L~~~gi~~~~p~gg~f~w~~l~~~~~~~~~~~~~~l~~~Ll~~~gV~v~PG~~F~~~~~g~  400 (428)
T d1iaya_         321 FLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGW  400 (428)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCCBCCCSSSSEEEEECGGGCSSSSHHHHHHHHHHHHHTSCEECEEGGGGTCSSSSE
T ss_pred             cccccccccchhHHHHHHHHHhCCCEEecCCcceEEEEECccccccCCCCCHHHHHHHHHHhCCEEEEcchhcCCCCCCE
Confidence            99999999999999999999999999999999999999998876666666788999999998999999999999888899


Q ss_pred             EEEEeecCCHHHHHHHHHHHHHHHHHH
Q 046900          411 FRVCFANMSEQTLEVALKRIHNFMQKR  437 (442)
Q Consensus       411 iRls~~~~~~e~i~~~l~~l~~~l~~~  437 (442)
                      |||||+..++++++++++||++++..+
T Consensus       401 ~Ris~a~~~~~~l~~al~Rl~~~l~~~  427 (428)
T d1iaya_         401 FRVCFANMDDGTVDIALARIRRFVGVE  427 (428)
T ss_dssp             EEEECSSSCHHHHHHHHHHHHHHHHTT
T ss_pred             EEEEeCCCCHHHHHHHHHHHHHHHhhc
Confidence            999998757888999999999998653
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure