Citrus Sinensis ID: 046918


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccEEEEEEccccccHHHHHHHHHccHHHHHcccccEEEEEcccccHHHHHHHHc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccccccccccHHHHHHHHcccccccHEEEEEEEcccccccEEEEEEccccccHHHHHHHHHccHHHHHHccEEEEEEEcccccHHHHHHHHc
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKrssrdtnasqpvrtvrpsfiipsywfspgqlvrrHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMsgsesstvstggssqvptqlpIIISItgmggigkTTLARLIFNDNVVSAHFDKKIWVcvsepfddIRIAKAIL
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVedaekrqmkeNAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQmkrssrdtnasqpvrtvrpsfiipsywfspgqlvRRHDIATkiknvdkkvdniVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMSGSESstvstggssqvptQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIwvcvsepfdDIRIAKAIL
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMsgsesstvstggssQVPTQLPiiisitgmggigkttLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
***VIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRK*****************TVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLL******************TQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIA****
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIR*********************PSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDN****************************KVAN****************SQVPTQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQM************VRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMS**************VPTQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYGTTSFLDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q7XA39 988 Putative disease resistan N/A no 0.848 0.215 0.314 1e-28
Q7XA40 992 Putative disease resistan N/A no 0.852 0.215 0.291 9e-27
Q7XBQ9 970 Disease resistance protei N/A no 0.844 0.218 0.293 9e-27
Q7XA42 979 Putative disease resistan N/A no 0.848 0.217 0.283 1e-25
Q8W4J9 908 Disease resistance protei yes no 0.912 0.252 0.281 4e-22
P59584 910 Disease resistance protei no no 0.900 0.248 0.278 4e-22
Q9FJK8 908 Probable disease resistan no no 0.872 0.241 0.277 5e-22
P0C8S1 906 Probable disease resistan no no 0.872 0.241 0.275 2e-19
Q9FJB5 901 Disease resistance RPP8-l no no 0.912 0.254 0.272 2e-19
Q8W3K0 1138 Probable disease resistan no no 0.860 0.189 0.281 7e-19
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function desciption
 Score =  127 bits (318), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 136/267 (50%), Gaps = 54/267 (20%)

Query: 1   MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKEN 60
           MAE  +  +LE L S + ++      LI G E+E E L   F  I+AV++DA+++Q+K+ 
Sbjct: 1   MAEAFLQVLLENLTSFIGDKLV----LIFGFEKECEKLSSVFSTIQAVLQDAQEKQLKDK 56

Query: 61  AVRVWLDDLKHASYDMEDVLDEW-NTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWF 119
           A+  WL  L  A+Y+++D+L E  N AIR  Q +                        ++
Sbjct: 57  AIENWLQKLNSAAYEVDDILGECKNEAIRFEQSRLG----------------------FY 94

Query: 120 SPGQLVRRHDIATKIKNVDKKVDNIVRDINAYG---------------TTSFLDESYEVR 164
            PG +  RH I  ++K + +K+D I  +   +                 T F+    +V 
Sbjct: 95  HPGIINFRHKIGRRMKEIMEKLDAISEERRKFHFLEKITERQAAAATRETGFVLTEPKVY 154

Query: 165 GREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNV 224
           GR+  + ++  +L++           +  V  +LP+   I GMGG+GKTTLA++IFND  
Sbjct: 155 GRDKEEDEIVKILIN-----------NVNVAEELPVF-PIIGMGGLGKTTLAQMIFNDER 202

Query: 225 VSAHFDKKIWVCVSEPFDDIRIAKAIL 251
           V+ HF+ KIWVCVS+ FD+ R+ K I+
Sbjct: 203 VTKHFNPKIWVCVSDDFDEKRLIKTII 229




Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system which restricts the pathogen growth.
Solanum bulbocastanum (taxid: 147425)
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q8W4J9|RPP8_ARATH Disease resistance protein RPP8 OS=Arabidopsis thaliana GN=RPP8 PE=1 SV=2 Back     alignment and function description
>sp|P59584|RP8HA_ARATH Disease resistance protein RPH8A OS=Arabidopsis thaliana GN=RPH8A PE=3 SV=1 Back     alignment and function description
>sp|Q9FJK8|RP8L4_ARATH Probable disease resistance RPP8-like protein 4 OS=Arabidopsis thaliana GN=RPP8L4 PE=2 SV=1 Back     alignment and function description
>sp|P0C8S1|RP8L2_ARATH Probable disease resistance RPP8-like protein 2 OS=Arabidopsis thaliana GN=RPP8L2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FJB5|RP8L3_ARATH Disease resistance RPP8-like protein 3 OS=Arabidopsis thaliana GN=RPP8L3 PE=2 SV=1 Back     alignment and function description
>sp|Q8W3K0|DRL9_ARATH Probable disease resistance protein At1g58602 OS=Arabidopsis thaliana GN=At1g58602 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
224122712 945 cc-nbs-lrr resistance protein [Populus t 0.932 0.247 0.458 8e-53
224122696 906 cc-nbs-lrr resistance protein [Populus t 0.900 0.249 0.442 3e-49
224114848 571 cc-nbs resistance protein [Populus trich 0.932 0.409 0.424 2e-47
224115620 963 cc-nbs-lrr resistance protein [Populus t 0.928 0.241 0.439 2e-47
224101679 788 nbs-lrr resistance protein [Populus tric 0.900 0.286 0.439 5e-47
224115686 938 cc-nbs-lrr resistance protein [Populus t 0.916 0.245 0.429 5e-47
224110232 486 cc-nbs resistance protein [Populus trich 0.932 0.481 0.437 6e-47
224122720 746 cc-nbs-lrr resistance protein [Populus t 0.936 0.315 0.445 9e-47
224114836 477 cc-nbs resistance protein [Populus trich 0.900 0.473 0.422 2e-46
224114840 566 cc-nbs resistance protein [Populus trich 0.936 0.415 0.438 2e-46
>gi|224122712|ref|XP_002318907.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859580|gb|EEE97127.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 122/266 (45%), Positives = 173/266 (65%), Gaps = 32/266 (12%)

Query: 1   MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKEN 60
           MAE ++S ILEQL +I+ +Q   EV L+ G +++V+ L      I++V+EDA+++Q+K+ 
Sbjct: 1   MAEALLSPILEQLTTIVAQQVQEEVNLVVGVKKQVDKLKSNLLDIQSVLEDADRKQVKDK 60

Query: 61  AVRVWLDDLKHASYDMEDVLDEWNTAIRKLQMKRSSRDTNASQPVRTVRPSFI-IPSYWF 119
           AVR W+D LK A YDM+DVLDEW+TAI + +M+ +  +T++ Q +R    SF+  P + F
Sbjct: 61  AVRDWVDKLKDACYDMDDVLDEWSTAILRWKMEEAEENTHSRQKIRC---SFLGSPCFCF 117

Query: 120 SPGQLVRRHDIATKIKNVDKKVDNIVRDINAYG--------------TTSFLDESYEVRG 165
           +  Q+VRR DIA KIK V +KVD+I ++   YG              TTSF+DES  V G
Sbjct: 118 N--QVVRRRDIALKIKEVSEKVDDIAKERAKYGFDLYKGTDELQRLTTTSFVDES-SVIG 174

Query: 166 REHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNVV 225
           R+  +  V + L++ S                   +IS+ G+GGIGKTTLA+L FND+ V
Sbjct: 175 RDGEKRNVVSKLLAESSHEARDVD-----------VISLVGLGGIGKTTLAQLAFNDSEV 223

Query: 226 SAHFDKKIWVCVSEPFDDIRIAKAIL 251
           +AHF+KKIWVCVSEPFD+IRIAKAIL
Sbjct: 224 TAHFEKKIWVCVSEPFDEIRIAKAIL 249




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224122696|ref|XP_002318903.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859576|gb|EEE97123.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114848|ref|XP_002332297.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832459|gb|EEE70936.1| cc-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115620|ref|XP_002332101.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874921|gb|EEF12052.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224101679|ref|XP_002334255.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222870330|gb|EEF07461.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115686|ref|XP_002332117.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222874937|gb|EEF12068.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224110232|ref|XP_002333124.1| cc-nbs resistance protein [Populus trichocarpa] gi|222834935|gb|EEE73384.1| cc-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224122720|ref|XP_002318909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859582|gb|EEE97129.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114836|ref|XP_002332294.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832456|gb|EEE70933.1| cc-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224114840|ref|XP_002332295.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832457|gb|EEE70934.1| cc-nbs resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2152536 908 AT5G48620 [Arabidopsis thalian 0.338 0.093 0.285 4.1e-10
TAIR|locus:2176486 908 RPP8 "RECOGNITION OF PERONOSPO 0.346 0.095 0.279 4.8e-10
TAIR|locus:2169523 901 AT5G35450 [Arabidopsis thalian 0.338 0.094 0.285 1.1e-08
TAIR|locus:504956186 1138 AT1G58602 [Arabidopsis thalian 0.354 0.078 0.291 3.5e-08
TAIR|locus:2011982 857 AT1G50180 [Arabidopsis thalian 0.370 0.108 0.32 4.4e-07
TAIR|locus:2091672 1054 AT3G14470 [Arabidopsis thalian 0.673 0.160 0.248 8.8e-07
TAIR|locus:2078012 852 ZAR1 "HOPZ-ACTIVATED RESISTANC 0.302 0.089 0.262 4.4e-06
TAIR|locus:2025916 906 AT1G59780 "AT1G59780" [Arabido 0.306 0.084 0.271 5.7e-06
TAIR|locus:2037639 907 AT1G58390 "AT1G58390" [Arabido 0.358 0.099 0.257 1.4e-05
TAIR|locus:2037623 899 AT1G58410 [Arabidopsis thalian 0.306 0.085 0.269 2.6e-05
TAIR|locus:2152536 AT5G48620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 4.1e-10, Sum P(3) = 4.1e-10
 Identities = 26/91 (28%), Positives = 55/91 (60%)

Query:     1 MAEVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKEN 60
             MAE  VS  LE+L  +L    + E   + G +E+++ L R+   ++++++DA+ ++   +
Sbjct:     1 MAEGFVSFGLEKLWDLL----SRESERLQGIDEQLDGLKRQLRSLQSLLKDADAKKHGSD 56

Query:    61 AVRVWLDDLKHASYDMEDVLDEWNTAIRKLQ 91
              VR +L+D+K   +D ED+++ +   + KL+
Sbjct:    57 RVRNFLEDVKDLVFDAEDIIESY--VLNKLR 85


GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
TAIR|locus:2176486 RPP8 "RECOGNITION OF PERONOSPORA PARASITICA 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169523 AT5G35450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956186 AT1G58602 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011982 AT1G50180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078012 ZAR1 "HOPZ-ACTIVATED RESISTANCE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025916 AT1G59780 "AT1G59780" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037639 AT1G58390 "AT1G58390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037623 AT1G58410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XII001317
cc-nbs-lrr resistance protein (945 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
pfam00931 285 pfam00931, NB-ARC, NB-ARC domain 9e-14
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 68.9 bits (169), Expect = 9e-14
 Identities = 26/53 (49%), Positives = 36/53 (67%)

Query: 199 PIIISITGMGGIGKTTLARLIFNDNVVSAHFDKKIWVCVSEPFDDIRIAKAIL 251
             ++ I GMGG+GKTTLA+ I+ND+ V  HFD   WV VS+ + + R+ K IL
Sbjct: 19  LGVVGIVGMGGVGKTTLAKQIYNDDSVGGHFDSVAWVVVSKTYTEFRLQKDIL 71


Length = 285

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 99.94
PF00931 287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.5
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.04
cd01128 249 rho_factor Transcription termination factor rho is 98.74
PRK09376 416 rho transcription termination factor Rho; Provisio 98.73
TIGR00767 415 rho transcription termination factor Rho. Members 98.31
PF13191 185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.24
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.13
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.01
PTZ00202 550 tuzin; Provisional 98.01
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.0
PF01637 234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.89
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.59
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.56
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 97.54
PRK06696 223 uridine kinase; Validated 97.52
KOG2028 554 consensus ATPase related to the helicase subunit o 97.5
TIGR03015 269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.48
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 97.46
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.43
PRK07667 193 uridine kinase; Provisional 97.31
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.29
PRK13342 413 recombination factor protein RarA; Reviewed 97.28
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 97.26
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 97.21
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 97.2
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 97.18
COG2256 436 MGS1 ATPase related to the helicase subunit of the 97.16
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.11
PF13173128 AAA_14: AAA domain 97.09
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.06
cd01123 235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.98
PRK06547 172 hypothetical protein; Provisional 96.94
TIGR02237 209 recomb_radB DNA repair and recombination protein R 96.92
CHL00095 821 clpC Clp protease ATP binding subunit 96.92
PRK12402 337 replication factor C small subunit 2; Reviewed 96.91
PRK15455 644 PrkA family serine protein kinase; Provisional 96.91
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 96.91
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 96.83
COG0572 218 Udk Uridine kinase [Nucleotide transport and metab 96.82
PRK13341 725 recombination factor protein RarA/unknown domain f 96.8
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 96.8
PRK04195 482 replication factor C large subunit; Provisional 96.79
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 96.78
smart00382148 AAA ATPases associated with a variety of cellular 96.77
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.76
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.72
PRK10751 173 molybdopterin-guanine dinucleotide biosynthesis pr 96.71
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.7
PRK05541 176 adenylylsulfate kinase; Provisional 96.7
PRK10865 857 protein disaggregation chaperone; Provisional 96.69
cd01133 274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.69
PHA00729 226 NTP-binding motif containing protein 96.68
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.66
PRK00440 319 rfc replication factor C small subunit; Reviewed 96.66
PRK06893 229 DNA replication initiation factor; Validated 96.65
PHA02544 316 44 clamp loader, small subunit; Provisional 96.62
PRK09270 229 nucleoside triphosphate hydrolase domain-containin 96.61
PLN03025 319 replication factor C subunit; Provisional 96.61
TIGR00554 290 panK_bact pantothenate kinase, bacterial type. Sho 96.61
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.6
PRK03992 389 proteasome-activating nucleotidase; Provisional 96.58
PRK14738 206 gmk guanylate kinase; Provisional 96.56
cd01393 226 recA_like RecA is a bacterial enzyme which has rol 96.56
PRK05564 313 DNA polymerase III subunit delta'; Validated 96.56
PRK09361 225 radB DNA repair and recombination protein RadB; Pr 96.54
PF01583 156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 96.54
PF00004132 AAA: ATPase family associated with various cellula 96.53
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 96.53
PRK05439 311 pantothenate kinase; Provisional 96.5
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 96.49
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.48
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 96.48
PRK03846 198 adenylylsulfate kinase; Provisional 96.48
PF00005137 ABC_tran: ABC transporter This structure is on hol 96.47
cd01878 204 HflX HflX subfamily. A distinct conserved domain w 96.45
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 96.44
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 96.43
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 96.41
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.4
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 96.39
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 96.36
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 96.35
PRK08727 233 hypothetical protein; Validated 96.35
PRK08903 227 DnaA regulatory inactivator Hda; Validated 96.35
PLN02318 656 phosphoribulokinase/uridine kinase 96.34
PF04665 241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 96.34
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 96.34
PRK13531 498 regulatory ATPase RavA; Provisional 96.33
PF12061402 DUF3542: Protein of unknown function (DUF3542); In 96.32
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 96.31
TIGR00073 207 hypB hydrogenase accessory protein HypB. HypB is i 96.3
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 96.3
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.28
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 96.26
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 96.25
cd03225 211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 96.25
COG1763 161 MobB Molybdopterin-guanine dinucleotide biosynthes 96.25
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 96.25
KOG1532 366 consensus GTPase XAB1, interacts with DNA repair p 96.24
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 96.23
PRK08084 235 DNA replication initiation factor; Provisional 96.23
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 96.23
PRK09087 226 hypothetical protein; Validated 96.22
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signa 96.21
cd01394 218 radB RadB. The archaeal protein radB shares simila 96.21
TIGR01166 190 cbiO cobalt transport protein ATP-binding subunit. 96.2
cd03238 176 ABC_UvrA The excision repair protein UvrA; Nucleot 96.2
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 96.19
PRK04841 903 transcriptional regulator MalT; Provisional 96.15
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 96.15
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.15
COG1126 240 GlnQ ABC-type polar amino acid transport system, A 96.12
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 96.12
cd03263 220 ABC_subfamily_A The ABCA subfamily mediates the tr 96.11
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 96.11
cd03261 235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 96.11
PRK10865 857 protein disaggregation chaperone; Provisional 96.09
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 96.09
PRK10536 262 hypothetical protein; Provisional 96.09
TIGR02673 214 FtsE cell division ATP-binding protein FtsE. This 96.09
cd03265 220 ABC_DrrA DrrA is the ATP-binding protein component 96.08
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 96.08
cd03297 214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 96.08
cd03269 210 ABC_putative_ATPase This subfamily is involved in 96.07
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 96.07
PLN02796 347 D-glycerate 3-kinase 96.06
cd03259 213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 96.06
TIGR02315 243 ABC_phnC phosphonate ABC transporter, ATP-binding 96.05
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.05
cd04155 173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.04
TIGR02236 310 recomb_radA DNA repair and recombination protein R 96.04
cd03235 213 ABC_Metallic_Cations ABC component of the metal-ty 96.04
PRK12608 380 transcription termination factor Rho; Provisional 96.04
cd03256 241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 96.03
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 96.02
cd03226 205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 96.02
PRK06620 214 hypothetical protein; Validated 96.02
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 96.01
PTZ00112 1164 origin recognition complex 1 protein; Provisional 96.0
cd03264 211 ABC_drug_resistance_like ABC-type multidrug transp 96.0
cd03260 227 ABC_PstB_phosphate_transporter Phosphate uptake is 96.0
cd03296 239 ABC_CysA_sulfate_importer Part of the ABC transpor 96.0
PRK12377248 putative replication protein; Provisional 95.99
cd03292 214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 95.99
CHL00181 287 cbbX CbbX; Provisional 95.99
cd03116 159 MobB Molybdenum is an essential trace element in t 95.97
TIGR03864 236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 95.97
PRK15177 213 Vi polysaccharide export ATP-binding protein VexC; 95.96
PRK11889 436 flhF flagellar biosynthesis regulator FlhF; Provis 95.96
PLN02348 395 phosphoribulokinase 95.95
PRK13541 195 cytochrome c biogenesis protein CcmA; Provisional 95.95
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 95.95
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 95.95
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 95.95
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 95.94
cd03224 222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 95.92
cd03237 246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 95.92
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 95.91
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 95.91
PRK13538 204 cytochrome c biogenesis protein CcmA; Provisional 95.9
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 95.9
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 95.9
PRK11248 255 tauB taurine transporter ATP-binding subunit; Prov 95.89
TIGR03608 206 L_ocin_972_ABC putative bacteriocin export ABC tra 95.89
TIGR01184 230 ntrCD nitrate transport ATP-binding subunits C and 95.88
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.88
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.88
cd03301 213 ABC_MalK_N The N-terminal ATPase domain of the mal 95.87
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 95.87
TIGR02770 230 nickel_nikD nickel import ATP-binding protein NikD 95.87
cd03219 236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 95.87
PRK04301 317 radA DNA repair and recombination protein RadA; Va 95.86
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 95.86
PRK10416 318 signal recognition particle-docking protein FtsY; 95.85
PF03308 266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.84
cd03218 232 ABC_YhbG The ABC transporters belonging to the Yhb 95.83
PRK11124 242 artP arginine transporter ATP-binding subunit; Pro 95.82
PRK05642 234 DNA replication initiation factor; Validated 95.81
PF05621 302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.81
PF02562 205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 95.81
TIGR01978 243 sufC FeS assembly ATPase SufC. SufC is part of the 95.81
TIGR00750 300 lao LAO/AO transport system ATPase. Mutations have 95.8
cd03295 242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 95.8
PRK10908 222 cell division protein FtsE; Provisional 95.79
PRK13540 200 cytochrome c biogenesis protein CcmA; Provisional 95.79
TIGR01189 198 ccmA heme ABC exporter, ATP-binding protein CcmA. 95.77
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 95.77
cd03278 197 ABC_SMC_barmotin Barmotin is a tight junction-asso 95.76
cd03114148 ArgK-like The function of this protein family is u 95.76
cd03262 213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 95.76
cd00879 190 Sar1 Sar1 subfamily. Sar1 is an essential componen 95.76
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.75
cd03268 208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 95.75
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.74
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 95.73
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 95.73
PRK13539 207 cytochrome c biogenesis protein CcmA; Provisional 95.73
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 95.73
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 95.73
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 95.72
cd03246173 ABCC_Protease_Secretion This family represents the 95.72
PF07726131 AAA_3: ATPase family associated with various cellu 95.72
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.71
PRK09435 332 membrane ATPase/protein kinase; Provisional 95.71
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 95.71
TIGR00972 247 3a0107s01c2 phosphate ABC transporter, ATP-binding 95.71
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 95.7
PRK14245 250 phosphate ABC transporter ATP-binding protein; Pro 95.7
PRK10463 290 hydrogenase nickel incorporation protein HypB; Pro 95.7
TIGR00064 272 ftsY signal recognition particle-docking protein F 95.69
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 95.69
cd03214 180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 95.69
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.68
cd03252 237 ABCC_Hemolysin The ABC-transporter hemolysin B is 95.68
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 95.68
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 95.67
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 95.67
cd01130 186 VirB11-like_ATPase Type IV secretory pathway compo 95.67
COG3899 849 Predicted ATPase [General function prediction only 95.67
COG0410 237 LivF ABC-type branched-chain amino acid transport 95.66
cd03216163 ABC_Carb_Monos_I This family represents the domain 95.66
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.66
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 95.65
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 95.65
PRK08116 268 hypothetical protein; Validated 95.64
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 95.64
PLN02200 234 adenylate kinase family protein 95.64
TIGR01277 213 thiQ thiamine ABC transporter, ATP-binding protein 95.64
cd03215 182 ABC_Carb_Monos_II This family represents domain II 95.64
PRK13946 184 shikimate kinase; Provisional 95.64
TIGR01188 302 drrA daunorubicin resistance ABC transporter ATP-b 95.64
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 95.63
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 95.63
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 95.63
PRK09493 240 glnQ glutamine ABC transporter ATP-binding protein 95.62
COG0529 197 CysC Adenylylsulfate kinase and related kinases [I 95.62
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 95.62
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 95.62
PLN03046 460 D-glycerate 3-kinase; Provisional 95.62
cd03231 201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 95.61
PLN02924 220 thymidylate kinase 95.61
PLN03187 344 meiotic recombination protein DMC1 homolog; Provis 95.61
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 95.6
cd03298 211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 95.6
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 95.6
TIGR02238 313 recomb_DMC1 meiotic recombinase Dmc1. This model d 95.59
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 95.59
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 95.59
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 95.59
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 95.59
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 95.59
TIGR03410 230 urea_trans_UrtE urea ABC transporter, ATP-binding 95.58
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provi 95.58
COG3638 258 ABC-type phosphate/phosphonate transport system, A 95.58
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 95.58
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 95.58
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 95.58
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 95.57
cd03274 212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 95.57
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 95.56
PRK14722 374 flhF flagellar biosynthesis regulator FlhF; Provis 95.56
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 95.56
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 95.56
cd01864 165 Rab19 Rab19 subfamily. Rab19 proteins are associat 95.56
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 95.56
PRK08099 399 bifunctional DNA-binding transcriptional repressor 95.56
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 95.55
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 95.55
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 95.55
cd03234 226 ABCG_White The White subfamily represents ABC tran 95.55
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 95.55
TIGR03005 252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 95.54
cd03251 234 ABCC_MsbA MsbA is an essential ABC transporter, cl 95.54
PRK07429 327 phosphoribulokinase; Provisional 95.53
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 95.53
PRK13948 182 shikimate kinase; Provisional 95.52
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 95.52
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 95.51
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 95.5
cd03253 236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 95.5
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 95.49
cd03290 218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 95.49
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 95.49
TIGR00455 184 apsK adenylylsulfate kinase (apsK). Important resi 95.48
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 95.48
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 95.48
TIGR03873 256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 95.48
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 95.48
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 95.47
PRK11022 326 dppD dipeptide transporter ATP-binding subunit; Pr 95.47
TIGR02239 316 recomb_RAD51 DNA repair protein RAD51. This eukary 95.47
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.47
COG4559 259 ABC-type hemin transport system, ATPase component 95.46
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 95.46
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 95.46
PRK13548 258 hmuV hemin importer ATP-binding subunit; Provision 95.46
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 95.45
CHL00131 252 ycf16 sulfate ABC transporter protein; Validated 95.45
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 95.45
cd03273 251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 95.45
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 95.45
PLN03186 342 DNA repair protein RAD51 homolog; Provisional 95.45
cd03236 255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 95.44
PRK00454 196 engB GTP-binding protein YsxC; Reviewed 95.44
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 95.44
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 95.44
PRK11231 255 fecE iron-dicitrate transporter ATP-binding subuni 95.43
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 95.43
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 95.43
PF1324576 AAA_19: Part of AAA domain 95.43
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 95.43
PRK10771 232 thiQ thiamine transporter ATP-binding subunit; Pro 95.42
cd03279 213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 95.42
COG4608 268 AppF ABC-type oligopeptide transport system, ATPas 95.42
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 95.42
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 95.41
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 95.41
TIGR03740 223 galliderm_ABC gallidermin-class lantibiotic protec 95.41
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 95.41
PRK09580 248 sufC cysteine desulfurase ATPase component; Review 95.4
PRK14255 252 phosphate ABC transporter ATP-binding protein; Pro 95.39
PRK14269 246 phosphate ABC transporter ATP-binding protein; Pro 95.39
cd00983 325 recA RecA is a bacterial enzyme which has roles in 95.39
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 95.39
cd03283 199 ABC_MutS-like MutS-like homolog in eukaryotes. The 95.38
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 95.38
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 95.37
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 95.37
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 95.36
PRK13547 272 hmuV hemin importer ATP-binding subunit; Provision 95.36
cd03240 204 ABC_Rad50 The catalytic domains of Rad50 are simil 95.36
PLN02165 334 adenylate isopentenyltransferase 95.36
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 95.36
PRK15093 330 antimicrobial peptide ABC transporter ATP-binding 95.35
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 95.35
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 95.34
PRK09183 259 transposase/IS protein; Provisional 95.34
PRK14974 336 cell division protein FtsY; Provisional 95.34
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 95.33
PRK13546 264 teichoic acids export protein ATP-binding subunit; 95.33
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 95.32
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 95.32
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 95.32
COG4619 223 ABC-type uncharacterized transport system, ATPase 95.32
TIGR02012 321 tigrfam_recA protein RecA. This model describes or 95.32
COG0468 279 RecA RecA/RadA recombinase [DNA replication, recom 95.3
cd04153 174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 95.29
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 95.29
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 95.28
PRK14266 250 phosphate ABC transporter ATP-binding protein; Pro 95.28
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 95.28
PRK06995 484 flhF flagellar biosynthesis regulator FlhF; Valida 95.27
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provi 95.26
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.26
TIGR03411 242 urea_trans_UrtD urea ABC transporter, ATP-binding 95.26
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 95.26
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 95.25
PF1355562 AAA_29: P-loop containing region of AAA domain 95.25
TIGR03598 179 GTPase_YsxC ribosome biogenesis GTP-binding protei 95.25
PF13604 196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 95.25
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 95.25
TIGR00968 237 3a0106s01 sulfate ABC transporter, ATP-binding pro 95.24
cd03272 243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 95.24
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.24
PRK12724 432 flagellar biosynthesis regulator FlhF; Provisional 95.24
PRK14275 286 phosphate ABC transporter ATP-binding protein; Pro 95.23
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 95.23
PRK08181 269 transposase; Validated 95.23
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 95.23
PF08423 256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.23
PRK03695 248 vitamin B12-transporter ATPase; Provisional 95.22
COG1127 263 Ttg2A ABC-type transport system involved in resist 95.22
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 95.22
PRK14721 420 flhF flagellar biosynthesis regulator FlhF; Provis 95.22
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provi 95.22
PRK07952244 DNA replication protein DnaC; Validated 95.21
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 95.21
PRK09984 262 phosphonate/organophosphate ester transporter subu 95.21
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 95.21
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 95.21
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 95.21
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 95.21
cd03369 207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 95.2
CHL00095 821 clpC Clp protease ATP binding subunit 95.2
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.2
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 95.2
PRK14236 272 phosphate transporter ATP-binding protein; Provisi 95.19
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Pr 95.19
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 95.19
COG4107 258 PhnK ABC-type phosphonate transport system, ATPase 95.19
PRK11144 352 modC molybdate transporter ATP-binding protein; Pr 95.18
PRK14244 251 phosphate ABC transporter ATP-binding protein; Pro 95.18
COG1703 323 ArgK Putative periplasmic protein kinase ArgK and 95.17
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 95.16
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 95.15
COG1123 539 ATPase components of various ABC-type transport sy 95.15
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.14
PRK09473 330 oppD oligopeptide transporter ATP-binding componen 95.14
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.14
TIGR02142 354 modC_ABC molybdenum ABC transporter, ATP-binding p 95.13
PRK10867 433 signal recognition particle protein; Provisional 95.13
PRK14489 366 putative bifunctional molybdopterin-guanine dinucl 95.13
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 95.11
PRK10419 268 nikE nickel transporter ATP-binding protein NikE; 95.11
COG1125 309 OpuBA ABC-type proline/glycine betaine transport s 95.11
cd03291 282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 95.11
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 95.1
cd03217 200 ABC_FeS_Assembly ABC-type transport system involve 95.1
PRK00149 450 dnaA chromosomal replication initiation protein; R 95.1
TIGR03877 237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.09
PRK14258 261 phosphate ABC transporter ATP-binding protein; Pro 95.09
KOG3347 176 consensus Predicted nucleotide kinase/nuclear prot 95.09
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 95.08
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 95.07
PRK05703 424 flhF flagellar biosynthesis regulator FlhF; Valida 95.07
PRK12727 559 flagellar biosynthesis regulator FlhF; Provisional 95.06
PRK06067 234 flagellar accessory protein FlaH; Validated 95.06
PTZ00035 337 Rad51 protein; Provisional 95.06
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 95.05
PRK06526 254 transposase; Provisional 95.05
cd01868 165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 95.04
PF08298 358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 95.03
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 95.02
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 95.02
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 95.02
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 95.02
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 95.02
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC trans 95.02
COG2884 223 FtsE Predicted ATPase involved in cell division [C 95.01
PRK06835329 DNA replication protein DnaC; Validated 95.01
PRK13537 306 nodulation ABC transporter NodI; Provisional 95.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.0
cd01866 168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 95.0
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.99
PRK15079 331 oligopeptide ABC transporter ATP-binding protein O 94.99
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 94.99
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 94.98
PRK14254 285 phosphate ABC transporter ATP-binding protein; Pro 94.96
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.95
cd02034116 CooC The accessory protein CooC, which contains a 94.95
PRK06921266 hypothetical protein; Provisional 94.94
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 94.93
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 94.93
PRK14264 305 phosphate ABC transporter ATP-binding protein; Pro 94.92
PRK00771 437 signal recognition particle protein Srp54; Provisi 94.92
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 94.92
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 94.91
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 94.9
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 94.9
TIGR01420 343 pilT_fam pilus retraction protein PilT. This model 94.89
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 94.88
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 94.88
PRK15467 158 ethanolamine utilization protein EutP; Provisional 94.87
cd03300 232 ABC_PotA_N PotA is an ABC-type transporter and the 94.87
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 94.86
PTZ00132 215 GTP-binding nuclear protein Ran; Provisional 94.86
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 94.85
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 94.85
PF07693 325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 94.84
cd04114 169 Rab30 Rab30 subfamily. Rab30 appears to be associa 94.83
PLN02840 421 tRNA dimethylallyltransferase 94.83
PRK14263 261 phosphate ABC transporter ATP-binding protein; Pro 94.83
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 94.83
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 94.83
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 94.82
PRK09354 349 recA recombinase A; Provisional 94.82
cd01129 264 PulE-GspE PulE/GspE The type II secretory pathway 94.82
PRK10851 353 sulfate/thiosulfate transporter subunit; Provision 94.82
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 94.8
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provi 94.8
PRK13536 340 nodulation factor exporter subunit NodI; Provision 94.8
TIGR02868 529 CydC thiol reductant ABC exporter, CydC subunit. T 94.79
cd04154 173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 94.79
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 94.78
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 94.77
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 94.76
PRK14088 440 dnaA chromosomal replication initiation protein; P 94.74
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 94.73
TIGR01618 220 phage_P_loop phage nucleotide-binding protein. Thi 94.73
cd04116 170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 94.73
PRK10070 400 glycine betaine transporter ATP-binding subunit; P 94.73
PTZ00133 182 ADP-ribosylation factor; Provisional 94.73
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 94.72
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 94.72
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 94.71
cd03299 235 ABC_ModC_like Archeal protein closely related to M 94.71
PRK15064 530 ABC transporter ATP-binding protein; Provisional 94.71
cd03270 226 ABC_UvrA_I The excision repair protein UvrA domain 94.71
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 94.7
COG1135 339 AbcC ABC-type metal ion transport system, ATPase c 94.69
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.69
PRK12726 407 flagellar biosynthesis regulator FlhF; Provisional 94.69
COG1875 436 NYN ribonuclease and ATPase of PhoH family domains 94.69
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 94.68
cd03288 257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 94.67
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 94.67
PRK10938 490 putative molybdenum transport ATP-binding protein 94.67
smart00178 184 SAR Sar1p-like members of the Ras-family of small 94.67
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=99.94  E-value=1.8e-26  Score=219.77  Aligned_cols=217  Identities=26%  Similarity=0.354  Sum_probs=158.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHhhchhhHHHh
Q 046918            3 EVIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKRQMKENAVRVWLDDLKHASYDMEDVLDE   82 (251)
Q Consensus         3 ~~~vs~~~~kl~~~l~~~~~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~a~~~~~~~~~~~~Wl~~l~~~a~d~eD~ld~   82 (251)
                      ++.++..++++.+.    +.+++..+.+.+..+..|+++|..++.++++++..+.....+..|...+++++|++||+++.
T Consensus         2 ~~~~s~~~~~~~~~----l~~~~~~~~~~~~~i~~Lk~~L~~l~~~l~d~~a~~~~~~~~~~~~e~~~~~~~~~e~~~~~   77 (889)
T KOG4658|consen    2 GACVSFGVEKLDQL----LNRESECLDGKDNYILELKENLKALQSALEDLDAKRDDLERRVNWEEDVGDLVYLAEDIIWL   77 (889)
T ss_pred             CeEEEEehhhHHHH----HHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44566667777776    57778889999999999999999999999999999887899999999999999999999999


Q ss_pred             hhHHHHHHHHhhhcCCCCCCCCccccccccccCCCccCCCcccchhhHHHHHHHHHHHHHHHHHhhhhcC----------
Q 046918           83 WNTAIRKLQMKRSSRDTNASQPVRTVRPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYG----------  152 (251)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~i~~~~~~l~~i~~~~~~~~----------  152 (251)
                      |..+....+..+....  ........+      .+.++.......+.+++++-++.+.++.+.... .+.          
T Consensus        78 ~~v~~~~~~~~~~l~~--~~~~~~~~c------~~~~~~~~~~~~~~~~~rv~~~l~~ve~l~~~~-~~~~~~~~~~~~~  148 (889)
T KOG4658|consen   78 FLVEEIERKANDLLST--RSVERQRLC------LCGFCSKNVSDSYKYGKRVSKVLREVESLGSKG-VFEVVGESLDPRE  148 (889)
T ss_pred             HHHHHHHHHHhHHhhh--hHHHHHHHh------hhhhHhHhhhhhHhHHHHHHHHHHHHHHhcccc-ceecccccccchh
Confidence            9977665433322000  000000111      001122223333444455554444444443211 010          


Q ss_pred             ---CCcccCCCcceeccchhHHHHHHHhcCCCCCCCccCCCCCCCCCCCCEEEEEEcCCCCcHHHHHHHHhcCcc-cccC
Q 046918          153 ---TTSFLDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNV-VSAH  228 (251)
Q Consensus       153 ---~~~~~~~~~~~~G~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~~vi~I~G~gGvGKTTLa~~v~~d~~-v~~~  228 (251)
                         +.+..+.. . +|.+..++++++.|.+++                 ..++||+||||+||||||+.|||+.. ++.+
T Consensus       149 ~~e~~~~~~~~-~-VG~e~~~~kl~~~L~~d~-----------------~~iv~i~GMGGvGKTTL~~qi~N~~~~v~~~  209 (889)
T KOG4658|consen  149 KVETRPIQSES-D-VGLETMLEKLWNRLMEDD-----------------VGIVGIYGMGGVGKTTLARQIFNKFDEVGNH  209 (889)
T ss_pred             hcccCCCCccc-c-ccHHHHHHHHHHHhccCC-----------------CCEEEEECCCcccHHHHHHHHhcccchhccc
Confidence               11222222 3 999999999999999877                 49999999999999999999999987 9999


Q ss_pred             CCceEEEEeCCCCCHHHHHHHhC
Q 046918          229 FDKKIWVCVSEPFDDIRIAKAIL  251 (251)
Q Consensus       229 Fd~~~wV~Vs~~~~~~~i~~~Il  251 (251)
                      ||.+|||+||++|+..+|+++|+
T Consensus       210 Fd~~iWV~VSk~f~~~~iq~~Il  232 (889)
T KOG4658|consen  210 FDGVIWVVVSKEFTTRKIQQTIL  232 (889)
T ss_pred             CceEEEEEEcccccHHhHHHHHH
Confidence            99999999999999999999985



>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF12061 DUF3542: Protein of unknown function (DUF3542); InterPro: IPR021929 R1 is a gene for resistance to late blight, the most destructive disease in potato cultivation worldwide Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02239 recomb_RAD51 DNA repair protein RAD51 Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PLN03186 DNA repair protein RAD51 homolog; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 2e-22
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 3e-22
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 2e-13
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
 Score = 94.9 bits (236), Expect = 2e-22
 Identities = 25/219 (11%), Positives = 57/219 (26%), Gaps = 43/219 (19%)

Query: 51  DAEKRQMKENAVRVWLDDLKHASYDMEDVLDEWNT--AIRKLQMKRSSRDTNASQPVRTV 108
           DA+ R            D+         ++D   +   +   + ++   +    Q    +
Sbjct: 2   DAKARNCLLQHREALEKDI-----KTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAML 56

Query: 109 RPSFIIPSYWFSPGQLVRRHDIATKIKNVDKKVDNIVRDINAYG---------------- 152
               +I               +    K++   + + +  +++                  
Sbjct: 57  IK--MILKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVL 114

Query: 153 -TTSFLDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIG 211
                         R+ L   +   L                        ++I GM G G
Sbjct: 115 CEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGW---------------VTIHGMAGCG 159

Query: 212 KTTLARLIFND-NVVSAHFDKKI-WVCVSEPFDDIRIAK 248
           K+ LA     D +++   F   + WV V +      + K
Sbjct: 160 KSVLAAEAVRDHSLLEGCFPGGVHWVSVGKQDKSGLLMK 198


>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3qfl_A115 MLA10; coiled-coil, (CC) domain, NLRS, nucleotide- 99.72
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.63
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.35
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.28
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 99.2
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.29
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.18
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.1
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.07
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.02
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.02
2fna_A 357 Conserved hypothetical protein; structural genomic 97.93
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 97.93
2chg_A 226 Replication factor C small subunit; DNA-binding pr 97.87
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 97.82
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 97.65
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 97.49
1rz3_A 201 Hypothetical protein rbstp0775; MCSG, structural g 97.35
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.28
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 97.28
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 97.25
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 97.21
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.16
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.15
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 97.15
3bos_A 242 Putative DNA replication factor; P-loop containing 97.14
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 97.12
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 97.09
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 97.06
3co5_A143 Putative two-component system transcriptional RES 96.98
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.98
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 96.97
2chq_A 319 Replication factor C small subunit; DNA-binding pr 96.93
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.92
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 96.92
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 96.91
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 96.89
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.88
4gp7_A 171 Metallophosphoesterase; polynucleotide kinase phos 96.88
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 96.86
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.86
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 96.84
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 96.82
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 96.82
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.81
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.81
3pvs_A 447 Replication-associated recombination protein A; ma 96.79
3uie_A 200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.78
1uj2_A 252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.75
3vaa_A 199 Shikimate kinase, SK; structural genomics, center 96.75
2cvh_A 220 DNA repair and recombination protein RADB; filamen 96.74
1knq_A 175 Gluconate kinase; ALFA/beta structure, transferase 96.72
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 96.7
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.69
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 96.69
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 96.69
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.68
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.67
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 96.67
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.67
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 96.67
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 96.66
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 96.65
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.64
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 96.63
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 96.63
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.61
1zuh_A 168 Shikimate kinase; alpha-beta protein, transferase; 96.61
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 96.61
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 96.6
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 96.6
1uf9_A 203 TT1252 protein; P-loop, nucleotide binding domain, 96.59
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.56
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.56
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 96.55
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.55
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.54
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.53
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.52
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 96.47
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 96.47
2qor_A 204 Guanylate kinase; phosphotransferase, purine metab 96.47
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.46
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 96.45
2yvu_A 186 Probable adenylyl-sulfate kinase; transferase, str 96.45
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 96.45
1s96_A 219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 96.44
3iij_A 180 Coilin-interacting nuclear ATPase protein; alpha a 96.44
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.43
3ney_A 197 55 kDa erythrocyte membrane protein; structural ge 96.42
2hf9_A 226 Probable hydrogenase nickel incorporation protein 96.39
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.38
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 96.37
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.37
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 96.36
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.36
1ji0_A 240 ABC transporter; ATP binding protein, structural g 96.35
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 96.35
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 96.34
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.34
4a74_A 231 DNA repair and recombination protein RADA; hydrola 96.33
1g6h_A 257 High-affinity branched-chain amino acid transport 96.32
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.32
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.32
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 96.32
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 96.32
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.32
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 96.31
1y63_A 184 LMAJ004144AAA protein; structural genomics, protei 96.3
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.3
3b85_A 208 Phosphate starvation-inducible protein; PHOH2, ATP 96.3
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.3
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 96.3
1sgw_A 214 Putative ABC transporter; structural genomics, P p 96.29
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 96.28
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.28
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 96.28
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 96.26
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.26
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 96.25
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.25
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.25
3fwy_A 314 Light-independent protochlorophyllide reductase I 96.24
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.24
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 96.24
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.23
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.23
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.22
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.22
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 96.22
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 96.21
2ghi_A 260 Transport protein; multidrug resistance protein, M 96.21
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 96.2
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.2
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.2
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.19
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.17
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.17
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 96.16
2og2_A 359 Putative signal recognition particle receptor; nuc 96.15
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.13
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 96.11
1np6_A 174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.1
2r44_A 331 Uncharacterized protein; putative ATPase, structur 96.08
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.08
2vp4_A 230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 96.07
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.07
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 96.07
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.06
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.04
1yrb_A 262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.03
2qgz_A 308 Helicase loader, putative primosome component; str 96.02
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.01
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 96.0
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 95.99
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 95.99
2eyu_A 261 Twitching motility protein PILT; pilus retraction 95.98
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.98
2xxa_A 433 Signal recognition particle protein; protein trans 95.96
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.94
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 95.93
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 95.91
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 95.89
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 95.88
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.88
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 95.87
4eaq_A 229 DTMP kinase, thymidylate kinase; structural genomi 95.86
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.84
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 95.83
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 95.82
2wji_A 165 Ferrous iron transport protein B homolog; membrane 95.81
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 95.81
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 95.8
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 95.79
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 95.79
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.77
2z43_A 324 DNA repair and recombination protein RADA; archaea 95.77
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 95.77
2ged_A193 SR-beta, signal recognition particle receptor beta 95.77
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 95.74
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 95.74
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 95.71
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.71
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.7
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 95.7
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 95.65
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 95.61
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 95.58
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 95.57
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 95.56
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 95.55
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 95.55
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 95.54
1z2a_A 168 RAS-related protein RAB-23; RAB GTPase, vesicular 95.53
3kta_A 182 Chromosome segregation protein SMC; structural mai 95.5
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 95.5
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.5
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 95.5
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.49
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 95.48
2a9k_A 187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 95.46
1fzq_A 181 ADP-ribosylation factor-like protein 3; protein-GD 95.45
1p5z_B 263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.44
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 95.43
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 95.42
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 95.42
1u8z_A 168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 95.42
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 95.42
3con_A 190 GTPase NRAS; structural genomics consortium, SGC, 95.41
3t1o_A 198 Gliding protein MGLA; G domain containing protein, 95.4
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 95.4
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.39
1p9r_A 418 General secretion pathway protein E; bacterial typ 95.39
1svi_A 195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 95.37
3end_A 307 Light-independent protochlorophyllide reductase ir 95.36
2lkc_A 178 Translation initiation factor IF-2; NMR {Geobacill 95.36
3pqc_A 195 Probable GTP-binding protein ENGB; rossmann fold, 95.36
2qnr_A 301 Septin-2, protein NEDD5; structural genomics conso 95.35
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 95.34
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 95.34
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.33
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 95.32
1pui_A 210 ENGB, probable GTP-binding protein ENGB; structura 95.31
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 95.3
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 95.3
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 95.29
1z08_A 170 RAS-related protein RAB-21; RAB GTPase, vesicular 95.29
3tw8_B 181 RAS-related protein RAB-35; longin domain, RAB GTP 95.28
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 95.26
1z0j_A 170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 95.26
4bas_A 199 ADP-ribosylation factor, putative (small GTPase, p 95.26
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.25
1ky3_A 182 GTP-binding protein YPT7P; vesicular traffic, GTP 95.24
1f6b_A 198 SAR1; gtpases, N-terminal helix, Mg-containing com 95.24
2gf9_A 189 RAS-related protein RAB-3D; G-protein, structural 95.24
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 95.18
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 95.17
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 95.16
1nrj_B 218 SR-beta, signal recognition particle receptor beta 95.16
2fn4_A 181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 95.15
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 95.15
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 95.15
2a5j_A 191 RAS-related protein RAB-2B; GTPase, signal transdu 95.13
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 95.12
2ewv_A 372 Twitching motility protein PILT; pilus retraction 95.11
1wms_A 177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 95.11
3c5c_A 187 RAS-like protein 12; GDP, GTPase, structural genom 95.1
1z0f_A 179 RAB14, member RAS oncogene family; RAB GTPase, ves 95.1
1r2q_A 170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 95.1
3ihw_A 184 Centg3; RAS, centaurin, GTPase, structural genomic 95.09
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 95.09
1upt_A 171 ARL1, ADP-ribosylation factor-like protein 1; hydr 95.08
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 95.07
3llu_A 196 RAS-related GTP-binding protein C; structural geno 95.07
1m2o_B 190 GTP-binding protein SAR1, GTP binding protein; zin 95.05
2bme_A 186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 95.03
2h57_A 190 ADP-ribosylation factor-like protein 6; GTP, GTPas 95.03
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 95.02
1moz_A 183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.01
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 95.01
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 95.0
2g6b_A 180 RAS-related protein RAB-26; G-protein, GTP analogu 94.99
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 94.99
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 94.99
3kkq_A 183 RAS-related protein M-RAS; GTP-binding, GTPase, si 94.98
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 94.98
2oil_A 193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 94.97
2y8e_A 179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 94.95
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 94.94
3cbq_A 195 GTP-binding protein REM 2; FLJ38964A, structural g 94.93
3bwd_D 182 RAC-like GTP-binding protein ARAC6; G domain, cyto 94.91
2bov_A 206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 94.91
3bc1_A 195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.9
2efe_B 181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 94.9
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 94.88
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 94.88
3ld9_A 223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 94.86
1ksh_A 186 ARF-like protein 2; small GTPase, small GTP-bindin 94.86
1vg8_A 207 RAS-related protein RAB-7; GTP-binding protein, pr 94.85
1zj6_A 187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 94.85
2fg5_A 192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 94.84
1zbd_A 203 Rabphilin-3A; G protein, effector, RABCDR, synapti 94.84
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 94.83
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 94.83
1ega_A 301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.82
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 94.81
2atv_A 196 RERG, RAS-like estrogen-regulated growth inhibitor 94.8
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 94.8
1u94_A 356 RECA protein, recombinase A; homologous recombinat 94.79
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 94.77
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 94.77
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 94.77
2q3h_A 201 RAS homolog gene family, member U; GTPase, structu 94.76
3tkl_A 196 RAS-related protein RAB-1A; vesicle trafficking, p 94.75
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 94.75
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.74
3lv8_A 236 DTMP kinase, thymidylate kinase; structural genomi 94.74
2o52_A 200 RAS-related protein RAB-4B; G-protein, GDP, struct 94.74
3oes_A 201 GTPase rhebl1; small GTPase, structural genomics, 94.73
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 94.73
1gwn_A 205 RHO-related GTP-binding protein RHOE; GTPase, inac 94.73
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.72
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 94.71
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 94.71
2il1_A 192 RAB12; G-protein, GDP, GTPase, predicted, structur 94.7
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 94.69
3reg_A 194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 94.69
1zd9_A 188 ADP-ribosylation factor-like 10B; transport protei 94.68
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 94.66
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 94.65
2ew1_A 201 RAS-related protein RAB-30; G-protein, GTP analogu 94.65
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 94.62
3iev_A 308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 94.61
1z06_A 189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 94.6
1x3s_A 195 RAS-related protein RAB-18; GTPase, GNP, structura 94.6
2p5s_A 199 RAS and EF-hand domain containing; G-protein, RAB, 94.58
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 94.57
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 94.56
2h17_A 181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 94.55
2gf0_A 199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 94.55
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 94.54
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 94.54
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.54
3dz8_A 191 RAS-related protein RAB-3B; GDP, GTPase, structura 94.53
2bcg_Y 206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 94.53
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 94.52
2fv8_A 207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 94.48
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 94.46
2atx_A 194 Small GTP binding protein TC10; GTPase, P-loop, al 94.39
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 94.39
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 94.39
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 94.38
2f7s_A 217 C25KG, RAS-related protein RAB-27B; G-protein, str 94.34
2gco_A 201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 94.34
3cph_A 213 RAS-related protein SEC4; RAB GTPase, prenylation, 94.33
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 94.28
2x77_A 189 ADP-ribosylation factor; GTP-binding protein, smal 94.28
1tue_A 212 Replication protein E1; helicase, replication, E1E 94.28
2j0v_A 212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 94.25
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 94.25
2fu5_C 183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 94.24
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 94.23
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 94.22
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 94.2
2xtp_A 260 GTPase IMAP family member 2; immune system, G prot 94.2
3q3j_B 214 RHO-related GTP-binding protein RHO6; RAS-binding 94.17
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 94.16
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 94.14
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 94.12
3gmt_A 230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 94.1
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 94.09
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 94.0
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 93.99
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 93.92
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 93.88
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 93.84
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 93.82
1xp8_A 366 RECA protein, recombinase A; recombination, radior 93.81
3lxw_A 247 GTPase IMAP family member 1; immunity, structural 93.79
3ch4_B 202 Pmkase, phosphomevalonate kinase; parallel beta-sh 93.79
3t5d_A 274 Septin-7; GTP-binding protein, cytoskeleton, signa 93.77
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.77
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 93.73
3cpj_B 223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 93.71
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 93.68
4dkx_A 216 RAS-related protein RAB-6A; GTP binding fold, memb 93.67
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.63
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 93.61
2r6a_A 454 DNAB helicase, replicative helicase; replication, 93.61
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 93.6
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 93.54
3v9p_A 227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 93.53
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 93.49
2o5v_A 359 DNA replication and repair protein RECF; ABC ATPas 93.41
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 93.4
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 93.4
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 93.39
2aka_B 299 Dynamin-1; fusion protein, GTPase domain, myosin, 93.38
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 93.36
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 93.34
2yc2_C 208 IFT27, small RAB-related GTPase; transport protein 93.34
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 93.33
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 93.32
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 93.3
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 93.26
3qks_A 203 DNA double-strand break repair RAD50 ATPase; RECA- 93.25
4djt_A 218 GTP-binding nuclear protein GSP1; structural genom 93.24
3ice_A 422 Transcription termination factor RHO; transcriptio 93.08
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 93.05
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 93.05
3io5_A 333 Recombination and repair protein; storage dimer, i 93.05
3qkt_A 339 DNA double-strand break repair RAD50 ATPase; RECA- 93.01
1ni3_A 392 YCHF GTPase, YCHF GTP-binding protein; structural 92.99
1jwy_B 315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 92.92
3k9g_A 267 PF-32 protein; ssgcid, SBRI, decode biostructures, 92.89
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 92.01
3gj0_A 221 GTP-binding nuclear protein RAN; G protein, GDP, a 92.79
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 92.79
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 92.75
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 92.74
1qhl_A 227 Protein (cell division protein MUKB); SMC, chromos 92.68
3qf7_A 365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 92.66
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 92.66
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 92.59
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 92.56
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 92.39
1e69_A 322 Chromosome segregation SMC protein; structural mai 92.29
3ez2_A 398 Plasmid partition protein A; type IA, DNA binding, 92.25
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 92.14
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 92.14
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 92.06
4i1u_A 210 Dephospho-COA kinase; structural genomics, niaid, 92.04
3hdt_A 223 Putative kinase; structura genomics, PSI-2, protei 91.97
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 91.91
3io3_A 348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 91.87
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 91.75
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 91.7
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 91.69
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 91.67
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 91.55
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 91.55
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 91.34
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 91.32
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 91.31
2ph1_A 262 Nucleotide-binding protein; alpha-beta protein, st 91.31
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 91.3
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.27
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 91.17
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 91.13
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 91.13
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 91.1
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.09
3c5h_A 255 Glucocorticoid receptor DNA-binding factor 1; RAS, 91.09
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 91.04
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 90.99
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 90.77
3tqf_A 181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 90.7
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 90.67
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 90.63
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 90.61
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 90.57
3l0o_A 427 Transcription termination factor RHO; helicase, RH 90.55
3bfv_A 271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 90.52
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 90.5
3iqw_A 334 Tail-anchored protein targeting factor GET3; ATPas 90.44
3cio_A 299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 90.28
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 90.24
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 90.13
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 90.06
3ez9_A 403 Para; DNA binding, winged-HTH, partition, biosynth 90.0
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 89.97
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 89.91
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 89.79
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 89.66
3zq6_A 324 Putative arsenical pump-driving ATPase; tail-ancho 89.64
3ug7_A 349 Arsenical pump-driving ATPase; tail-anchored, memb 89.62
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 89.62
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 89.59
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 89.52
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 89.51
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 89.39
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.33
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 89.31
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 89.21
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 89.09
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 88.96
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 88.81
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 88.79
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 88.79
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 88.7
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 88.69
2xtz_A 354 Guanine nucleotide-binding protein alpha-1 subuni; 88.65
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 88.51
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 88.38
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 88.28
3auy_A 371 DNA double-strand break repair RAD50 ATPase; DNA r 88.28
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 88.24
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 88.18
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 88.14
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 88.13
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 88.12
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 88.12
2woo_A 329 ATPase GET3; tail-anchored, membrane protein, targ 87.99
3la6_A 286 Tyrosine-protein kinase WZC; P-loop protein, nucle 87.89
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 87.86
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 87.76
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 87.48
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 87.45
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 87.17
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 87.03
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 86.91
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 86.89
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 86.66
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 86.6
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 86.4
2woj_A 354 ATPase GET3; tail-anchored, membrane protein, targ 86.39
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 86.39
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 86.14
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 86.12
1osn_A 341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 86.08
>3qfl_A MLA10; coiled-coil, (CC) domain, NLRS, nucleotide-binding domain, L rich repeat containing receptors, protein binding; 2.00A {Hordeum vulgare} Back     alignment and structure
Probab=99.72  E-value=9.2e-18  Score=122.33  Aligned_cols=80  Identities=20%  Similarity=0.480  Sum_probs=72.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHhc--ccccHHHHHHHHHHHHHhhchhhHHH
Q 046918            4 VIVSTILEQLASILVEQTAAEVRLISGAEEEVENLHRRFHLIKAVVEDAEKR--QMKENAVRVWLDDLKHASYDMEDVLD   81 (251)
Q Consensus         4 ~~vs~~~~kl~~~l~~~~~~~~~~~~~~~~~~~~L~~~l~~i~~~l~~a~~~--~~~~~~~~~Wl~~l~~~a~d~eD~ld   81 (251)
                      |+++++++||.++    +.+|+.++.+++++++.|+++|..|+++|.+++.+  +..++.++.|+++||+++||+||+||
T Consensus         1 a~v~~ll~KL~~l----l~~E~~l~~gv~~~i~~Lk~eL~~m~a~L~da~~~~~~~~d~~vk~W~~~vrdlaYD~ED~iD   76 (115)
T 3qfl_A            1 AAISNLIPKLGEL----LTEEFKLHKGVKKNIEDLGKELESMNAALIKIGEVPREQLDSQDKLWADEVRELSYVIEDVVD   76 (115)
T ss_dssp             CTTCSHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CcHHHHHHHHHHH----HHHHHHHHhchHHHHHHHHHHHHHHHHHHHHHHHhccccCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            3567788888887    67899999999999999999999999999999987  55789999999999999999999999


Q ss_pred             hhhHHH
Q 046918           82 EWNTAI   87 (251)
Q Consensus        82 ~~~~~~   87 (251)
                      +|.++.
T Consensus        77 ~f~~~~   82 (115)
T 3qfl_A           77 KFLVQV   82 (115)
T ss_dssp             HHHHHH
T ss_pred             HHHHHh
Confidence            999765



>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3ez2_A Plasmid partition protein A; type IA, DNA binding, winged-HTH, DNA bindin; HET: ADP EPE; 2.05A {Escherichia coli} PDB: 3ez6_A* 3ez7_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>3ez9_A Para; DNA binding, winged-HTH, partition, biosynthetic protein; 2.80A {Salmonella enterica subsp} PDB: 3ezf_A Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d2a5yb3 277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 3e-11
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 59.8 bits (144), Expect = 3e-11
 Identities = 12/91 (13%), Positives = 28/91 (30%), Gaps = 16/91 (17%)

Query: 163 VRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFND 222
              RE+   +V   L    +  +                + + G  G GK+ +A    + 
Sbjct: 22  CYIREYHVDRVIKKLDEMCDLDS--------------FFLFLHGRAGSGKSVIASQALSK 67

Query: 223 N--VVSAHFDKKIWVCVSEPFDDIRIAKAIL 251
           +  ++  ++D  +W+  S             
Sbjct: 68  SDQLIGINYDSIVWLKDSGTAPKSTFDLFTD 98


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.71
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.31
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.97
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 97.77
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 97.74
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 97.59
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 97.58
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 97.58
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 97.55
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 97.54
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 97.54
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 97.53
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.52
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 97.49
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.49
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.39
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 97.38
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.23
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.18
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.16
d1knqa_ 171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.14
d1yj5a2 172 5' polynucleotide kinase-3' phosphatase, C-termina 96.89
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.62
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.62
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 96.61
d1sgwa_ 200 Putative ABC transporter PF0895 {Pyrococcus furios 96.6
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.57
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 96.57
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 96.57
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.54
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.5
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 96.47
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.41
d1g2912 240 Maltose transport protein MalK, N-terminal domain 96.41
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 96.41
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.38
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.36
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 96.34
d1svia_ 195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 96.33
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.3
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 96.3
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.29
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 96.28
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.28
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 96.28
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 96.25
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 96.25
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.25
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.24
d1upta_ 169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.18
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 96.14
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 96.11
d1f6ba_ 186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 96.07
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.05
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.99
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 95.99
d1ls1a2 207 GTPase domain of the signal sequence recognition p 95.93
d1moza_ 182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.88
d1ihua2 279 Arsenite-translocating ATPase ArsA {Escherichia co 95.85
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.85
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.83
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 95.77
d1j8yf2 211 GTPase domain of the signal sequence recognition p 95.75
d1vmaa2 213 GTPase domain of the signal recognition particle r 95.74
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 95.73
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 95.72
d2qy9a2 211 GTPase domain of the signal recognition particle r 95.72
d1zj6a1 177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.71
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 95.69
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 95.65
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 95.65
d1fzqa_ 176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.62
d1e0sa_ 173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.6
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 95.54
d3raba_ 169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 95.45
d2ew1a1 171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 95.44
d1z0ja1 167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.44
d1z0fa1 166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.43
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 95.4
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 95.27
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 95.23
d1xtqa1 167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.19
d2fn4a1 173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.14
d1r2qa_ 170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.14
d2erya1 171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.13
d1puia_ 188 Probable GTPase EngB {Escherichia coli [TaxId: 562 94.89
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.89
d1u8za_ 168 Ras-related protein RalA {Cotton-top tamarin (Sagu 94.82
d1x3sa1 177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 94.8
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.74
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 94.72
d2g6ba1 170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 94.67
d1wmsa_ 174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 94.56
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.53
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 94.45
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 94.42
d1a5ta2 207 delta prime subunit of DNA polymerase III, N-domai 94.26
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 94.1
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 93.97
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 93.89
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.88
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 93.87
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 93.82
d2fu5c1 173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 93.8
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.55
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.48
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.4
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.68
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.46
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 92.11
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 92.08
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.06
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 92.03
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 91.9
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 91.88
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 91.86
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 91.64
d1xpua3 289 Transcription termination factor Rho, ATPase domai 91.5
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.94
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.72
d1kkma_ 176 HPr kinase HprK C-terminal domain {Lactobacillus c 90.2
d1knxa2 177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 89.97
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 89.87
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 89.77
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 88.89
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 88.78
d1ko7a2 169 HPr kinase HprK C-terminal domain {Staphylococcus 88.76
d1n0ua2 341 Elongation factor 2 (eEF-2), N-terminal (G) domain 88.59
d1ni3a1 296 YchF GTP-binding protein N-terminal domain {Fissio 88.29
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.07
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 87.64
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 87.45
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 86.24
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 85.95
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 85.62
d1tuea_205 Replication protein E1 helicase domain {Human papi 85.29
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 84.39
d2qn6a3 205 Initiation factor eIF2 gamma subunit, N-terminal ( 83.21
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.77
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.62
d1zunb3 222 Sulfate adenylate transferase subunit cysN/C, EF-T 80.55
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 80.4
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 80.28
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
Probab=99.71  E-value=5.3e-18  Score=140.58  Aligned_cols=79  Identities=15%  Similarity=0.151  Sum_probs=66.9

Q ss_pred             cCCCcceeccchhHHHHHHHhcCCCCCCCccCCCCCCCCCCCCEEEEEEcCCCCcHHHHHHHHhcCcc--cccCCCceEE
Q 046918          157 LDESYEVRGREHLQIKVANLLMSGSESSTVSTGGSSQVPTQLPIIISITGMGGIGKTTLARLIFNDNV--VSAHFDKKIW  234 (251)
Q Consensus       157 ~~~~~~~~G~~~~~~~l~~~L~~~~~~~~~~~~~~~~~~~~~~~vi~I~G~gGvGKTTLa~~v~~d~~--v~~~Fd~~~w  234 (251)
                      +.++ .++||+.++++|+++|....              +....+|+|+||||+||||||+.+|++..  +..+|++++|
T Consensus        17 p~~~-~~~gR~~~~~~i~~~L~~~~--------------~~~~~~v~I~GmgGiGKTtLA~~v~~~~~~~~~~~f~~~~W   81 (277)
T d2a5yb3          17 PKQM-TCYIREYHVDRVIKKLDEMC--------------DLDSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVW   81 (277)
T ss_dssp             BCCC-CSCCCHHHHHHHHHHHHHHT--------------TSSSEEEEEECSTTSSHHHHHHHHHHHCSSTBTTTBSEEEE
T ss_pred             CCCC-ceeCcHHHHHHHHHHHHhcc--------------CCCceEEEEECCCCCCHHHHHHHHHHhhhhhhhhcCceEEE
Confidence            3455 78999999999999997644              24588999999999999999999998643  6778999999


Q ss_pred             EEeCCCCCHHHHHHHh
Q 046918          235 VCVSEPFDDIRIAKAI  250 (251)
Q Consensus       235 V~Vs~~~~~~~i~~~I  250 (251)
                      |++|+.++...+...+
T Consensus        82 v~vs~~~~~~~l~~~~   97 (277)
T d2a5yb3          82 LKDSGTAPKSTFDLFT   97 (277)
T ss_dssp             EECCCCSTTHHHHHHH
T ss_pred             EEecCCCCHHHHHHHH
Confidence            9999999988776543



>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure