Citrus Sinensis ID: 046954
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| 225445992 | 268 | PREDICTED: ABC transporter I family memb | 0.993 | 0.541 | 0.882 | 3e-68 | |
| 147791112 | 251 | hypothetical protein VITISV_010974 [Viti | 0.993 | 0.577 | 0.889 | 8e-68 | |
| 224144230 | 272 | predicted protein [Populus trichocarpa] | 0.993 | 0.533 | 0.889 | 2e-67 | |
| 255562070 | 276 | phosphate abc transporter, putative [Ric | 0.993 | 0.525 | 0.862 | 2e-65 | |
| 449466057 | 269 | PREDICTED: ABC transporter I family memb | 0.993 | 0.539 | 0.848 | 2e-65 | |
| 297841533 | 262 | ATNAP3 [Arabidopsis lyrata subsp. lyrata | 0.993 | 0.553 | 0.813 | 1e-62 | |
| 15220604 | 263 | ABC transporter I family member 17 [Arab | 0.993 | 0.551 | 0.813 | 1e-62 | |
| 356524710 | 260 | PREDICTED: ABC transporter I family memb | 0.993 | 0.557 | 0.786 | 2e-60 | |
| 255642389 | 157 | unknown [Glycine max] | 0.993 | 0.923 | 0.779 | 4e-60 | |
| 357521679 | 255 | ABC transporter I family member [Medicag | 0.993 | 0.568 | 0.780 | 2e-58 |
| >gi|225445992|ref|XP_002266816.1| PREDICTED: ABC transporter I family member 17 [Vitis vinifera] gi|297735429|emb|CBI17869.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 262 bits (670), Expect = 3e-68, Method: Compositional matrix adjust.
Identities = 128/145 (88%), Positives = 138/145 (95%)
Query: 1 TVADNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANE 60
TVADNIRYGPQLRGKKLT+NEV KLL+LADLDSSF+ KTG E+SVGQAQRVALARTLANE
Sbjct: 123 TVADNIRYGPQLRGKKLTDNEVLKLLTLADLDSSFMKKTGGELSVGQAQRVALARTLANE 182
Query: 61 PEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGE 120
PEVLLLDEPTSALDPISTQNIEDV+VKLKK GMT+VMVSHSIKQIQRIAD VCLLV+GE
Sbjct: 183 PEVLLLDEPTSALDPISTQNIEDVIVKLKKSRGMTVVMVSHSIKQIQRIADRVCLLVDGE 242
Query: 121 IVEVLKPDLLSEAKHPMALRFLQLS 145
I+EVL+PD LSEA+HPMALRFLQLS
Sbjct: 243 IIEVLEPDKLSEARHPMALRFLQLS 267
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147791112|emb|CAN70271.1| hypothetical protein VITISV_010974 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224144230|ref|XP_002325227.1| predicted protein [Populus trichocarpa] gi|222866661|gb|EEF03792.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255562070|ref|XP_002522043.1| phosphate abc transporter, putative [Ricinus communis] gi|223538642|gb|EEF40243.1| phosphate abc transporter, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449466057|ref|XP_004150743.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus] gi|449506635|ref|XP_004162805.1| PREDICTED: ABC transporter I family member 17-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297841533|ref|XP_002888648.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata] gi|297334489|gb|EFH64907.1| ATNAP3 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15220604|ref|NP_176961.1| ABC transporter I family member 17 [Arabidopsis thaliana] gi|75333593|sp|Q9C9W0.1|AB17I_ARATH RecName: Full=ABC transporter I family member 17; Short=ABC transporter ABCI.17; Short=AtABCI17; AltName: Full=MRP-related protein 1; AltName: Full=Non-intrinsic ABC protein 3 gi|12324076|gb|AAG52004.1|AC012563_14 putative ABC transporter; 66585-65723 [Arabidopsis thaliana] gi|21554406|gb|AAM63511.1| putative ABC transporter [Arabidopsis thaliana] gi|26450485|dbj|BAC42356.1| putative ABC transporter [Arabidopsis thaliana] gi|28827588|gb|AAO50638.1| putative ABC transporter protein [Arabidopsis thaliana] gi|298286464|dbj|BAJ09459.1| sensitive to aluminum rhizotoxicity 1 [Arabidopsis thaliana] gi|332196603|gb|AEE34724.1| ABC transporter I family member 17 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356524710|ref|XP_003530971.1| PREDICTED: ABC transporter I family member 17-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255642389|gb|ACU21458.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357521679|ref|XP_003631128.1| ABC transporter I family member [Medicago truncatula] gi|217072754|gb|ACJ84737.1| unknown [Medicago truncatula] gi|355525150|gb|AET05604.1| ABC transporter I family member [Medicago truncatula] gi|388494374|gb|AFK35253.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| TAIR|locus:2200226 | 263 | ABCI17 "ATP-binding cassette I | 0.993 | 0.551 | 0.744 | 2.1e-52 | |
| UNIPROTKB|Q0D9V6 | 346 | STAR1 "Protein STAR1" [Oryza s | 0.993 | 0.419 | 0.717 | 3.2e-49 | |
| TIGR_CMR|CHY_2116 | 253 | CHY_2116 "phosphate ABC transp | 0.876 | 0.505 | 0.404 | 4.9e-21 | |
| TIGR_CMR|NSE_0808 | 255 | NSE_0808 "putative phosphate A | 0.828 | 0.474 | 0.407 | 6.5e-19 | |
| UNIPROTKB|P30750 | 343 | metN [Escherichia coli K-12 (t | 0.705 | 0.300 | 0.423 | 9e-19 | |
| TIGR_CMR|BA_0174 | 346 | BA_0174 "ABC transporter, ATP- | 0.691 | 0.291 | 0.451 | 1.3e-18 | |
| TIGR_CMR|BA_4493 | 271 | BA_4493 "phosphate ABC transpo | 0.828 | 0.446 | 0.387 | 2.2e-18 | |
| UNIPROTKB|P14175 | 400 | proV "glycine betaine / prolin | 0.876 | 0.32 | 0.403 | 2.3e-18 | |
| UNIPROTKB|Q9KN92 | 251 | pstB2 "Phosphate import ATP-bi | 0.828 | 0.482 | 0.387 | 5.8e-18 | |
| TIGR_CMR|GSU_1096 | 259 | GSU_1096 "phosphate ABC transp | 0.828 | 0.467 | 0.364 | 5.8e-18 |
| TAIR|locus:2200226 ABCI17 "ATP-binding cassette I17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 543 (196.2 bits), Expect = 2.1e-52, P = 2.1e-52
Identities = 108/145 (74%), Positives = 123/145 (84%)
Query: 1 TVADNIRYGPQLRGKKLTENEVYKXXXXXXXXXXXXXKTGAEISVGQAQRVALARTLANE 60
TVADN+RYGP LRG+KL++ EVYK KTGAE+SVGQAQRVALARTLANE
Sbjct: 118 TVADNVRYGPNLRGEKLSDEEVYKLLSLADLDASFAKKTGAELSVGQAQRVALARTLANE 177
Query: 61 PEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGE 120
PEVLLLDEPTSALDPIST+NIEDV+VKLKK+ G+T V+VSHSIKQIQ++AD+VCL+V+GE
Sbjct: 178 PEVLLLDEPTSALDPISTENIEDVIVKLKKQRGITTVIVSHSIKQIQKVADIVCLVVDGE 237
Query: 121 IVEVLKPDLLSEAKHPMALRFLQLS 145
IVEVLKP LS A HPMA RFLQLS
Sbjct: 238 IVEVLKPSELSHATHPMAQRFLQLS 262
|
|
| UNIPROTKB|Q0D9V6 STAR1 "Protein STAR1" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_2116 CHY_2116 "phosphate ABC transporter, ATP-binding protein PstB" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|NSE_0808 NSE_0808 "putative phosphate ABC transporter, ATP-binding protein" [Neorickettsia sennetsu str. Miyayama (taxid:222891)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P30750 metN [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_0174 BA_0174 "ABC transporter, ATP-binding protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4493 BA_4493 "phosphate ABC transporter, ATP-binding protein" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P14175 proV "glycine betaine / proline ABC transporter - ATP binding subunit" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KN92 pstB2 "Phosphate import ATP-binding protein PstB 2" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1096 GSU_1096 "phosphate ABC transporter, ATP-binding protein" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00031325001 | SubName- Full=Chromosome chr11 scaffold_56, whole genome shotgun sequence; (157 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00023093001 | • | • | 0.554 | ||||||||
| GSVIVG00033530001 | • | • | 0.514 | ||||||||
| GSVIVG00038133001 | • | 0.416 | |||||||||
| GSVIVG00037795001 | • | 0.413 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| cd03260 | 227 | cd03260, ABC_PstB_phosphate_transporter, ATP-bindi | 5e-54 | |
| PRK14250 | 241 | PRK14250, PRK14250, phosphate ABC transporter ATP- | 8e-41 | |
| COG1117 | 253 | COG1117, PstB, ABC-type phosphate transport system | 1e-37 | |
| TIGR00972 | 247 | TIGR00972, 3a0107s01c2, phosphate ABC transporter, | 9e-37 | |
| COG1135 | 339 | COG1135, AbcC, ABC-type metal ion transport system | 3e-36 | |
| PRK14240 | 250 | PRK14240, PRK14240, phosphate transporter ATP-bind | 7e-35 | |
| COG1125 | 309 | COG1125, OpuBA, ABC-type proline/glycine betaine t | 1e-33 | |
| cd03259 | 213 | cd03259, ABC_Carb_Solutes_like, ATP-binding casset | 1e-32 | |
| cd03258 | 233 | cd03258, ABC_MetN_methionine_transporter, ATP-bind | 3e-32 | |
| cd03295 | 242 | cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas | 2e-31 | |
| COG1124 | 252 | COG1124, DppF, ABC-type dipeptide/oligopeptide/nic | 3e-31 | |
| PRK14262 | 250 | PRK14262, PRK14262, phosphate ABC transporter ATP- | 3e-31 | |
| COG1131 | 293 | COG1131, CcmA, ABC-type multidrug transport system | 7e-31 | |
| cd03229 | 178 | cd03229, ABC_Class3, ATP-binding cassette domain o | 9e-31 | |
| cd03293 | 220 | cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c | 1e-30 | |
| COG1126 | 240 | COG1126, GlnQ, ABC-type polar amino acid transport | 6e-30 | |
| cd03257 | 228 | cd03257, ABC_NikE_OppD_transporters, ATP-binding c | 6e-30 | |
| cd03255 | 218 | cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse | 6e-30 | |
| cd03261 | 235 | cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca | 9e-30 | |
| PRK11153 | 343 | PRK11153, metN, DL-methionine transporter ATP-bind | 6e-29 | |
| PRK14238 | 271 | PRK14238, PRK14238, phosphate transporter ATP-bind | 7e-29 | |
| COG1116 | 248 | COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon | 8e-29 | |
| COG1127 | 263 | COG1127, Ttg2A, ABC-type transport system involved | 8e-29 | |
| PRK14274 | 259 | PRK14274, PRK14274, phosphate ABC transporter ATP- | 2e-28 | |
| TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transpo | 2e-28 | |
| COG1136 | 226 | COG1136, SalX, ABC-type antimicrobial peptide tran | 2e-28 | |
| COG3839 | 338 | COG3839, MalK, ABC-type sugar transport systems, A | 3e-28 | |
| PRK14270 | 251 | PRK14270, PRK14270, phosphate ABC transporter ATP- | 4e-28 | |
| PRK14242 | 253 | PRK14242, PRK14242, phosphate transporter ATP-bind | 3e-27 | |
| PRK14275 | 286 | PRK14275, PRK14275, phosphate ABC transporter ATP- | 3e-27 | |
| COG4608 | 268 | COG4608, AppF, ABC-type oligopeptide transport sys | 3e-27 | |
| COG1118 | 345 | COG1118, CysA, ABC-type sulfate/molybdate transpor | 4e-27 | |
| PRK14268 | 258 | PRK14268, PRK14268, phosphate ABC transporter ATP- | 4e-27 | |
| PRK14266 | 250 | PRK14266, PRK14266, phosphate ABC transporter ATP- | 7e-27 | |
| PRK10744 | 260 | PRK10744, pstB, phosphate transporter ATP-binding | 8e-27 | |
| PRK14236 | 272 | PRK14236, PRK14236, phosphate transporter ATP-bind | 8e-27 | |
| PRK14239 | 252 | PRK14239, PRK14239, phosphate transporter ATP-bind | 2e-26 | |
| cd03294 | 269 | cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette | 2e-26 | |
| PRK14244 | 251 | PRK14244, PRK14244, phosphate ABC transporter ATP- | 2e-26 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 3e-26 | |
| PRK14257 | 329 | PRK14257, PRK14257, phosphate ABC transporter ATP- | 3e-26 | |
| PRK14253 | 249 | PRK14253, PRK14253, phosphate ABC transporter ATP- | 4e-26 | |
| COG4175 | 386 | COG4175, ProV, ABC-type proline/glycine betaine tr | 4e-26 | |
| PRK14273 | 254 | PRK14273, PRK14273, phosphate ABC transporter ATP- | 5e-26 | |
| PRK14261 | 253 | PRK14261, PRK14261, phosphate ABC transporter ATP- | 5e-26 | |
| COG1123 | 539 | COG1123, COG1123, ATPase components of various ABC | 1e-25 | |
| COG0444 | 316 | COG0444, DppD, ABC-type dipeptide/oligopeptide/nic | 1e-25 | |
| PRK14251 | 251 | PRK14251, PRK14251, phosphate ABC transporter ATP- | 1e-25 | |
| COG1122 | 235 | COG1122, CbiO, ABC-type cobalt transport system, A | 1e-25 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 1e-25 | |
| cd03230 | 173 | cd03230, ABC_DR_subfamily_A, ATP-binding cassette | 2e-25 | |
| COG3842 | 352 | COG3842, PotA, ABC-type spermidine/putrescine tran | 4e-25 | |
| PRK13634 | 290 | PRK13634, cbiO, cobalt transporter ATP-binding sub | 4e-25 | |
| PRK14237 | 267 | PRK14237, PRK14237, phosphate transporter ATP-bind | 5e-25 | |
| PRK14255 | 252 | PRK14255, PRK14255, phosphate ABC transporter ATP- | 6e-25 | |
| COG4619 | 223 | COG4619, COG4619, ABC-type uncharacterized transpo | 8e-25 | |
| PRK14243 | 264 | PRK14243, PRK14243, phosphate transporter ATP-bind | 1e-24 | |
| cd03225 | 211 | cd03225, ABC_cobalt_CbiO_domain1, First domain of | 1e-24 | |
| cd03300 | 232 | cd03300, ABC_PotA_N, ATP-binding cassette domain o | 3e-24 | |
| COG3840 | 231 | COG3840, ThiQ, ABC-type thiamine transport system, | 6e-24 | |
| COG1120 | 258 | COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore | 1e-23 | |
| cd03228 | 171 | cd03228, ABCC_MRP_Like, ATP-binding cassette domai | 1e-23 | |
| COG1121 | 254 | COG1121, ZnuC, ABC-type Mn/Zn transport systems, A | 2e-23 | |
| cd03262 | 213 | cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai | 2e-23 | |
| PRK13637 | 287 | PRK13637, cbiO, cobalt transporter ATP-binding sub | 2e-23 | |
| COG0410 | 237 | COG0410, LivF, ABC-type branched-chain amino acid | 3e-23 | |
| PRK14254 | 285 | PRK14254, PRK14254, phosphate ABC transporter ATP- | 3e-23 | |
| PRK14252 | 265 | PRK14252, PRK14252, phosphate ABC transporter ATP- | 3e-23 | |
| PRK14235 | 267 | PRK14235, PRK14235, phosphate transporter ATP-bind | 3e-23 | |
| PRK14241 | 258 | PRK14241, PRK14241, phosphate transporter ATP-bind | 3e-23 | |
| TIGR02314 | 343 | TIGR02314, ABC_MetN, D-methionine ABC transporter, | 4e-23 | |
| PRK14249 | 251 | PRK14249, PRK14249, phosphate ABC transporter ATP- | 4e-23 | |
| PRK14245 | 250 | PRK14245, PRK14245, phosphate ABC transporter ATP- | 5e-23 | |
| PRK14272 | 252 | PRK14272, PRK14272, phosphate ABC transporter ATP- | 6e-23 | |
| PRK14248 | 268 | PRK14248, PRK14248, phosphate ABC transporter ATP- | 7e-23 | |
| PRK14267 | 253 | PRK14267, PRK14267, phosphate ABC transporter ATP- | 8e-23 | |
| PRK14259 | 269 | PRK14259, PRK14259, phosphate ABC transporter ATP- | 8e-23 | |
| cd03214 | 180 | cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind | 9e-23 | |
| PRK14256 | 252 | PRK14256, PRK14256, phosphate ABC transporter ATP- | 1e-22 | |
| PRK14265 | 274 | PRK14265, PRK14265, phosphate ABC transporter ATP- | 2e-22 | |
| PRK14263 | 261 | PRK14263, PRK14263, phosphate ABC transporter ATP- | 2e-22 | |
| PRK14247 | 250 | PRK14247, PRK14247, phosphate ABC transporter ATP- | 3e-22 | |
| cd03269 | 210 | cd03269, ABC_putative_ATPase, ATP-binding cassette | 4e-22 | |
| cd03216 | 163 | cd03216, ABC_Carb_Monos_I, First domain of the ATP | 4e-22 | |
| PRK10070 | 400 | PRK10070, PRK10070, glycine betaine transporter AT | 6e-22 | |
| TIGR03265 | 353 | TIGR03265, PhnT2, putative 2-aminoethylphosphonate | 8e-22 | |
| PRK14264 | 305 | PRK14264, PRK14264, phosphate ABC transporter ATP- | 9e-22 | |
| PRK14246 | 257 | PRK14246, PRK14246, phosphate ABC transporter ATP- | 9e-22 | |
| TIGR00968 | 237 | TIGR00968, 3a0106s01, sulfate ABC transporter, ATP | 1e-21 | |
| COG4988 | 559 | COG4988, CydD, ABC-type transport system involved | 1e-21 | |
| cd03249 | 238 | cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett | 2e-21 | |
| cd03298 | 211 | cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin | 2e-21 | |
| COG3638 | 258 | COG3638, COG3638, ABC-type phosphate/phosphonate t | 3e-21 | |
| TIGR03005 | 252 | TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB | 3e-21 | |
| PRK14269 | 246 | PRK14269, PRK14269, phosphate ABC transporter ATP- | 3e-21 | |
| cd03224 | 222 | cd03224, ABC_TM1139_LivF_branched, ATP-binding cas | 4e-21 | |
| cd03297 | 214 | cd03297, ABC_ModC_molybdenum_transporter, ATP-bind | 5e-21 | |
| cd03235 | 213 | cd03235, ABC_Metallic_Cations, ATP-binding cassett | 6e-21 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 7e-21 | |
| cd03299 | 235 | cd03299, ABC_ModC_like, ATP-binding cassette domai | 7e-21 | |
| COG4172 | 534 | COG4172, COG4172, ABC-type uncharacterized transpo | 1e-20 | |
| cd03256 | 241 | cd03256, ABC_PhnC_transporter, ATP-binding cassett | 1e-20 | |
| cd03296 | 239 | cd03296, ABC_CysA_sulfate_importer, ATP-binding ca | 1e-20 | |
| PRK13649 | 280 | PRK13649, cbiO, cobalt transporter ATP-binding sub | 1e-20 | |
| PRK13631 | 320 | PRK13631, cbiO, cobalt transporter ATP-binding sub | 1e-20 | |
| PRK14271 | 276 | PRK14271, PRK14271, phosphate ABC transporter ATP- | 2e-20 | |
| cd03301 | 213 | cd03301, ABC_MalK_N, The N-terminal ATPase domain | 2e-20 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 4e-20 | |
| COG1132 | 567 | COG1132, MdlB, ABC-type multidrug transport system | 4e-20 | |
| PRK13651 | 305 | PRK13651, PRK13651, cobalt transporter ATP-binding | 5e-20 | |
| TIGR01187 | 325 | TIGR01187, potA, spermidine/putrescine ABC transpo | 5e-20 | |
| COG4525 | 259 | COG4525, TauB, ABC-type taurine transport system, | 1e-19 | |
| cd03266 | 218 | cd03266, ABC_NatA_sodium_exporter, ATP-binding cas | 2e-19 | |
| PRK10771 | 232 | PRK10771, thiQ, thiamine transporter ATP-binding s | 2e-19 | |
| PRK11174 | 588 | PRK11174, PRK11174, cysteine/glutathione ABC trans | 2e-19 | |
| PRK14258 | 261 | PRK14258, PRK14258, phosphate ABC transporter ATP- | 3e-19 | |
| cd03226 | 205 | cd03226, ABC_cobalt_CbiO_domain2, Second domain of | 4e-19 | |
| COG4555 | 245 | COG4555, NatA, ABC-type Na+ transport system, ATPa | 5e-19 | |
| TIGR02769 | 265 | TIGR02769, nickel_nikE, nickel import ATP-binding | 6e-19 | |
| PRK13645 | 289 | PRK13645, cbiO, cobalt transporter ATP-binding sub | 6e-19 | |
| TIGR01184 | 230 | TIGR01184, ntrCD, nitrate transport ATP-binding su | 1e-18 | |
| PRK13652 | 277 | PRK13652, cbiO, cobalt transporter ATP-binding sub | 1e-18 | |
| cd03253 | 236 | cd03253, ABCC_ATM1_transporter, ATP-binding casset | 2e-18 | |
| TIGR03410 | 230 | TIGR03410, urea_trans_UrtE, urea ABC transporter, | 2e-18 | |
| TIGR02315 | 243 | TIGR02315, ABC_phnC, phosphonate ABC transporter, | 2e-18 | |
| PRK10247 | 225 | PRK10247, PRK10247, putative ABC transporter ATP-b | 3e-18 | |
| PRK09493 | 240 | PRK09493, glnQ, glutamine ABC transporter ATP-bind | 4e-18 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 4e-18 | |
| TIGR02673 | 214 | TIGR02673, FtsE, cell division ATP-binding protein | 4e-18 | |
| TIGR03415 | 382 | TIGR03415, ABC_choXWV_ATP, choline ABC transporter | 5e-18 | |
| cd03219 | 236 | cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas | 5e-18 | |
| PRK13641 | 287 | PRK13641, cbiO, cobalt transporter ATP-binding sub | 5e-18 | |
| PRK13639 | 275 | PRK13639, cbiO, cobalt transporter ATP-binding sub | 6e-18 | |
| PRK14260 | 259 | PRK14260, PRK14260, phosphate ABC transporter ATP- | 7e-18 | |
| PRK13646 | 286 | PRK13646, cbiO, cobalt transporter ATP-binding sub | 7e-18 | |
| TIGR01277 | 213 | TIGR01277, thiQ, thiamine ABC transporter, ATP-bin | 8e-18 | |
| cd03268 | 208 | cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c | 2e-17 | |
| TIGR03740 | 223 | TIGR03740, galliderm_ABC, gallidermin-class lantib | 2e-17 | |
| COG4161 | 242 | COG4161, ArtP, ABC-type arginine transport system, | 2e-17 | |
| TIGR02142 | 354 | TIGR02142, modC_ABC, molybdenum ABC transporter, A | 3e-17 | |
| PRK11000 | 369 | PRK11000, PRK11000, maltose/maltodextrin transport | 3e-17 | |
| PRK10851 | 353 | PRK10851, PRK10851, sulfate/thiosulfate transporte | 3e-17 | |
| cd03254 | 229 | cd03254, ABCC_Glucan_exporter_like, ATP-binding ca | 3e-17 | |
| TIGR02857 | 529 | TIGR02857, CydD, thiol reductant ABC exporter, Cyd | 4e-17 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 4e-17 | |
| PRK11124 | 242 | PRK11124, artP, arginine transporter ATP-binding s | 5e-17 | |
| TIGR03771 | 223 | TIGR03771, anch_rpt_ABC, anchored repeat-type ABC | 5e-17 | |
| COG2274 | 709 | COG2274, SunT, ABC-type bacteriocin/lantibiotic ex | 5e-17 | |
| cd03265 | 220 | cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist | 8e-17 | |
| COG0411 | 250 | COG0411, LivG, ABC-type branched-chain amino acid | 8e-17 | |
| PRK13643 | 288 | PRK13643, cbiO, cobalt transporter ATP-binding sub | 8e-17 | |
| PRK11247 | 257 | PRK11247, ssuB, aliphatic sulfonates transport ATP | 8e-17 | |
| PRK10419 | 268 | PRK10419, nikE, nickel transporter ATP-binding pro | 1e-16 | |
| cd03251 | 234 | cd03251, ABCC_MsbA, ATP-binding cassette domain of | 1e-16 | |
| COG2884 | 223 | COG2884, FtsE, Predicted ATPase involved in cell d | 1e-16 | |
| PRK10619 | 257 | PRK10619, PRK10619, histidine/lysine/arginine/orni | 1e-16 | |
| COG4598 | 256 | COG4598, HisP, ABC-type histidine transport system | 1e-16 | |
| TIGR02982 | 220 | TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi | 2e-16 | |
| PRK11607 | 377 | PRK11607, potG, putrescine transporter ATP-binding | 2e-16 | |
| COG4170 | 330 | COG4170, SapD, ABC-type antimicrobial peptide tran | 2e-16 | |
| PRK13636 | 283 | PRK13636, cbiO, cobalt transporter ATP-binding sub | 3e-16 | |
| COG4152 | 300 | COG4152, COG4152, ABC-type uncharacterized transpo | 3e-16 | |
| TIGR03269 | 520 | TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc | 4e-16 | |
| TIGR03608 | 206 | TIGR03608, L_ocin_972_ABC, putative bacteriocin ex | 5e-16 | |
| PRK13640 | 282 | PRK13640, cbiO, cobalt transporter ATP-binding sub | 5e-16 | |
| COG4148 | 352 | COG4148, ModC, ABC-type molybdate transport system | 6e-16 | |
| COG4181 | 228 | COG4181, COG4181, Predicted ABC-type transport sys | 8e-16 | |
| TIGR03796 | 710 | TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin syste | 1e-15 | |
| TIGR01193 | 708 | TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t | 1e-15 | |
| PRK15093 | 330 | PRK15093, PRK15093, antimicrobial peptide ABC tran | 1e-15 | |
| PRK13635 | 279 | PRK13635, cbiO, cobalt transporter ATP-binding sub | 2e-15 | |
| PRK09452 | 375 | PRK09452, potA, putrescine/spermidine ABC transpor | 2e-15 | |
| cd03263 | 220 | cd03263, ABC_subfamily_A, ATP-binding cassette dom | 2e-15 | |
| PRK11248 | 255 | PRK11248, tauB, taurine transporter ATP-binding su | 3e-15 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 4e-15 | |
| cd03218 | 232 | cd03218, ABC_YhbG, ATP-binding cassette component | 5e-15 | |
| cd03247 | 178 | cd03247, ABCC_cytochrome_bd, ATP-binding cassette | 5e-15 | |
| TIGR02770 | 230 | TIGR02770, nickel_nikD, nickel import ATP-binding | 5e-15 | |
| pfam00005 | 119 | pfam00005, ABC_tran, ABC transporter | 7e-15 | |
| TIGR00958 | 711 | TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) | 1e-14 | |
| cd03234 | 226 | cd03234, ABCG_White, White pigment protein homolog | 1e-14 | |
| PRK13632 | 271 | PRK13632, cbiO, cobalt transporter ATP-binding sub | 1e-14 | |
| cd03292 | 214 | cd03292, ABC_FtsE_transporter, ATP-binding cassett | 1e-14 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 2e-14 | |
| PRK11264 | 250 | PRK11264, PRK11264, putative amino-acid ABC transp | 2e-14 | |
| PRK11144 | 352 | PRK11144, modC, molybdate transporter ATP-binding | 3e-14 | |
| PRK13548 | 258 | PRK13548, hmuV, hemin importer ATP-binding subunit | 3e-14 | |
| TIGR02211 | 221 | TIGR02211, LolD_lipo_ex, lipoprotein releasing sys | 3e-14 | |
| cd03267 | 236 | cd03267, ABC_NatA_like, ATP-binding cassette domai | 3e-14 | |
| PRK11432 | 351 | PRK11432, fbpC, ferric transporter ATP-binding sub | 3e-14 | |
| cd03248 | 226 | cd03248, ABCC_TAP, ATP-binding cassette domain of | 6e-14 | |
| cd03246 | 173 | cd03246, ABCC_Protease_Secretion, ATP-binding cass | 7e-14 | |
| COG4987 | 573 | COG4987, CydC, ABC-type transport system involved | 9e-14 | |
| COG5265 | 497 | COG5265, ATM1, ABC-type transport system involved | 9e-14 | |
| COG4604 | 252 | COG4604, CeuD, ABC-type enterochelin transport sys | 1e-13 | |
| PRK11176 | 582 | PRK11176, PRK11176, lipid transporter ATP-binding/ | 1e-13 | |
| PRK13633 | 280 | PRK13633, PRK13633, cobalt transporter ATP-binding | 1e-13 | |
| PRK13537 | 306 | PRK13537, PRK13537, nodulation ABC transporter Nod | 1e-13 | |
| PRK13650 | 279 | PRK13650, cbiO, cobalt transporter ATP-binding sub | 2e-13 | |
| TIGR03258 | 362 | TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans | 2e-13 | |
| TIGR02204 | 576 | TIGR02204, MsbA_rel, ABC transporter, permease/ATP | 2e-13 | |
| cd03213 | 194 | cd03213, ABCG_EPDR, Eye pigment and drug resistanc | 2e-13 | |
| TIGR02203 | 571 | TIGR02203, MsbA_lipidA, lipid A export permease/AT | 2e-13 | |
| COG4167 | 267 | COG4167, SapF, ABC-type antimicrobial peptide tran | 2e-13 | |
| PRK13647 | 274 | PRK13647, cbiO, cobalt transporter ATP-binding sub | 3e-13 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 3e-13 | |
| PRK13536 | 340 | PRK13536, PRK13536, nodulation factor exporter sub | 3e-13 | |
| COG1137 | 243 | COG1137, YhbG, ABC-type (unclassified) transport s | 3e-13 | |
| COG1119 | 257 | COG1119, ModF, ABC-type molybdenum transport syste | 4e-13 | |
| PRK13642 | 277 | PRK13642, cbiO, cobalt transporter ATP-binding sub | 5e-13 | |
| TIGR01188 | 302 | TIGR01188, drrA, daunorubicin resistance ABC trans | 5e-13 | |
| TIGR03375 | 694 | TIGR03375, type_I_sec_LssB, type I secretion syste | 5e-13 | |
| COG4618 | 580 | COG4618, ArpD, ABC-type protease/lipase transport | 5e-13 | |
| cd03252 | 237 | cd03252, ABCC_Hemolysin, ATP-binding cassette doma | 7e-13 | |
| COG1101 | 263 | COG1101, PhnK, ABC-type uncharacterized transport | 8e-13 | |
| cd03245 | 220 | cd03245, ABCC_bacteriocin_exporters, ATP-binding c | 8e-13 | |
| TIGR01166 | 190 | TIGR01166, cbiO, cobalt transport protein ATP-bind | 9e-13 | |
| TIGR03873 | 256 | TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra | 1e-12 | |
| TIGR01288 | 303 | TIGR01288, nodI, ATP-binding ABC transporter famil | 1e-12 | |
| PRK11831 | 269 | PRK11831, PRK11831, putative ABC transporter ATP-b | 1e-12 | |
| PRK15134 | 529 | PRK15134, PRK15134, microcin C ABC transporter ATP | 2e-12 | |
| PRK11614 | 237 | PRK11614, livF, leucine/isoleucine/valine transpor | 2e-12 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 2e-12 | |
| TIGR01846 | 694 | TIGR01846, type_I_sec_HlyB, type I secretion syste | 3e-12 | |
| TIGR01842 | 544 | TIGR01842, type_I_sec_PrtD, type I secretion syste | 3e-12 | |
| TIGR03864 | 236 | TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi | 4e-12 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 5e-12 | |
| PRK11231 | 255 | PRK11231, fecE, iron-dicitrate transporter ATP-bin | 6e-12 | |
| PRK11308 | 327 | PRK11308, dppF, dipeptide transporter ATP-binding | 6e-12 | |
| PRK13648 | 269 | PRK13648, cbiO, cobalt transporter ATP-binding sub | 7e-12 | |
| PRK11022 | 326 | PRK11022, dppD, dipeptide transporter ATP-binding | 8e-12 | |
| cd03221 | 144 | cd03221, ABCF_EF-3, ATP-binding cassette domain of | 1e-11 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 1e-11 | |
| PRK03695 | 248 | PRK03695, PRK03695, vitamin B12-transporter ATPase | 1e-11 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 2e-11 | |
| TIGR03797 | 686 | TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste | 2e-11 | |
| PRK10790 | 592 | PRK10790, PRK10790, putative multidrug transporter | 3e-11 | |
| PRK10584 | 228 | PRK10584, PRK10584, putative ABC transporter ATP-b | 3e-11 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 3e-11 | |
| PRK15112 | 267 | PRK15112, PRK15112, antimicrobial peptide ABC syst | 3e-11 | |
| PRK13644 | 274 | PRK13644, cbiO, cobalt transporter ATP-binding sub | 4e-11 | |
| TIGR02868 | 530 | TIGR02868, CydC, thiol reductant ABC exporter, Cyd | 4e-11 | |
| PRK11160 | 574 | PRK11160, PRK11160, cysteine/glutathione ABC trans | 5e-11 | |
| PRK15079 | 331 | PRK15079, PRK15079, oligopeptide ABC transporter A | 5e-11 | |
| cd03250 | 204 | cd03250, ABCC_MRP_domain1, ATP-binding cassette do | 6e-11 | |
| PRK09536 | 402 | PRK09536, btuD, corrinoid ABC transporter ATPase; | 6e-11 | |
| COG1129 | 500 | COG1129, MglA, ABC-type sugar transport system, AT | 7e-11 | |
| COG4586 | 325 | COG4586, COG4586, ABC-type uncharacterized transpo | 7e-11 | |
| PRK11629 | 233 | PRK11629, lolD, lipoprotein transporter ATP-bindin | 8e-11 | |
| cd03223 | 166 | cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset | 8e-11 | |
| TIGR03522 | 301 | TIGR03522, GldA_ABC_ATP, gliding motility-associat | 1e-10 | |
| COG1134 | 249 | COG1134, TagH, ABC-type polysaccharide/polyol phos | 1e-10 | |
| TIGR00955 | 617 | TIGR00955, 3a01204, The Eye Pigment Precursor Tran | 1e-10 | |
| PRK10535 | 648 | PRK10535, PRK10535, macrolide transporter ATP-bind | 1e-10 | |
| cd03215 | 182 | cd03215, ABC_Carb_Monos_II, Second domain of the A | 1e-10 | |
| PRK11300 | 255 | PRK11300, livG, leucine/isoleucine/valine transpor | 2e-10 | |
| COG4559 | 259 | COG4559, COG4559, ABC-type hemin transport system, | 2e-10 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 3e-10 | |
| cd03264 | 211 | cd03264, ABC_drug_resistance_like, ABC-type multid | 3e-10 | |
| PRK10418 | 254 | PRK10418, nikD, nickel transporter ATP-binding pro | 3e-10 | |
| COG0488 | 530 | COG0488, Uup, ATPase components of ABC transporter | 4e-10 | |
| PRK10261 | 623 | PRK10261, PRK10261, glutathione transporter ATP-bi | 4e-10 | |
| PRK09984 | 262 | PRK09984, PRK09984, phosphonate/organophosphate es | 4e-10 | |
| cd03244 | 221 | cd03244, ABCC_MRP_domain2, ATP-binding cassette do | 4e-10 | |
| COG3845 | 501 | COG3845, COG3845, ABC-type uncharacterized transpo | 6e-10 | |
| PRK13657 | 588 | PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra | 6e-10 | |
| PRK09544 | 251 | PRK09544, znuC, high-affinity zinc transporter ATP | 8e-10 | |
| PRK10253 | 265 | PRK10253, PRK10253, iron-enterobactin transporter | 8e-10 | |
| PRK10575 | 265 | PRK10575, PRK10575, iron-hydroxamate transporter A | 8e-10 | |
| PTZ00265 | 1466 | PTZ00265, PTZ00265, multidrug resistance protein ( | 1e-09 | |
| COG4674 | 249 | COG4674, COG4674, Uncharacterized ABC-type transpo | 1e-09 | |
| cd03220 | 224 | cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon | 2e-09 | |
| PRK13638 | 271 | PRK13638, cbiO, cobalt transporter ATP-binding sub | 2e-09 | |
| PRK11650 | 356 | PRK11650, ugpC, glycerol-3-phosphate transporter A | 2e-09 | |
| TIGR02323 | 253 | TIGR02323, CP_lyasePhnK, phosphonate C-P lyase sys | 2e-09 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 3e-09 | |
| PRK11147 | 635 | PRK11147, PRK11147, ABC transporter ATPase compone | 3e-09 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 3e-09 | |
| PRK09700 | 510 | PRK09700, PRK09700, D-allose transporter ATP-bindi | 4e-09 | |
| TIGR01192 | 585 | TIGR01192, chvA, glucan exporter ATP-binding prote | 4e-09 | |
| COG4138 | 248 | COG4138, BtuD, ABC-type cobalamin transport system | 5e-09 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 6e-09 | |
| TIGR02324 | 224 | TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys | 1e-08 | |
| PRK09473 | 330 | PRK09473, oppD, oligopeptide transporter ATP-bindi | 1e-08 | |
| TIGR03411 | 242 | TIGR03411, urea_trans_UrtD, urea ABC transporter, | 1e-08 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 2e-08 | |
| PRK10895 | 241 | PRK10895, PRK10895, lipopolysaccharide ABC transpo | 2e-08 | |
| COG4178 | 604 | COG4178, COG4178, ABC-type uncharacterized transpo | 2e-08 | |
| COG4136 | 213 | COG4136, COG4136, ABC-type uncharacterized transpo | 2e-08 | |
| PRK10908 | 222 | PRK10908, PRK10908, cell division protein FtsE; Pr | 3e-08 | |
| cd03369 | 207 | cd03369, ABCC_NFT1, ATP-binding cassette domain 2 | 4e-08 | |
| PLN03073 | 718 | PLN03073, PLN03073, ABC transporter F family; Prov | 5e-08 | |
| cd03291 | 282 | cd03291, ABCC_CFTR1, ATP-binding cassette domain o | 7e-08 | |
| PRK13547 | 272 | PRK13547, hmuV, hemin importer ATP-binding subunit | 7e-08 | |
| COG0396 | 251 | COG0396, sufC, Cysteine desulfurase activator ATPa | 9e-08 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 1e-07 | |
| PRK10762 | 501 | PRK10762, PRK10762, D-ribose transporter ATP bindi | 2e-07 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 2e-07 | |
| cd03217 | 200 | cd03217, ABC_FeS_Assembly, ABC-type transport syst | 2e-07 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 2e-07 | |
| PRK11288 | 501 | PRK11288, araG, L-arabinose transporter ATP-bindin | 3e-07 | |
| PRK10982 | 491 | PRK10982, PRK10982, galactose/methyl galaxtoside t | 3e-07 | |
| COG4107 | 258 | COG4107, PhnK, ABC-type phosphonate transport syst | 3e-07 | |
| COG2401 | 593 | COG2401, COG2401, ABC-type ATPase fused to a predi | 4e-07 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 5e-07 | |
| COG4615 | 546 | COG4615, PvdE, ABC-type siderophore export system, | 5e-07 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 5e-07 | |
| PRK15064 | 530 | PRK15064, PRK15064, ABC transporter ATP-binding pr | 7e-07 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 7e-07 | |
| cd03270 | 226 | cd03270, ABC_UvrA_I, ATP-binding cassette domain I | 7e-07 | |
| PRK13539 | 207 | PRK13539, PRK13539, cytochrome c biogenesis protei | 8e-07 | |
| cd03290 | 218 | cd03290, ABCC_SUR1_N, ATP-binding cassette domain | 8e-07 | |
| PRK13549 | 506 | PRK13549, PRK13549, xylose transporter ATP-binding | 9e-07 | |
| cd03238 | 176 | cd03238, ABC_UvrA, ATP-binding cassette domain of | 1e-06 | |
| PTZ00243 | 1560 | PTZ00243, PTZ00243, ABC transporter; Provisional | 1e-06 | |
| cd03288 | 257 | cd03288, ABCC_SUR2, ATP-binding cassette domain 2 | 1e-06 | |
| TIGR00956 | 1394 | TIGR00956, 3a01205, Pleiotropic Drug Resistance (P | 1e-06 | |
| PRK15056 | 272 | PRK15056, PRK15056, manganese/iron transporter ATP | 1e-06 | |
| cd03231 | 201 | cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog | 1e-06 | |
| TIGR01978 | 243 | TIGR01978, sufC, FeS assembly ATPase SufC | 1e-06 | |
| PRK15439 | 510 | PRK15439, PRK15439, autoinducer 2 ABC transporter | 2e-06 | |
| TIGR00957 | 1522 | TIGR00957, MRP_assoc_pro, multi drug resistance-as | 2e-06 | |
| COG1245 | 591 | COG1245, COG1245, Predicted ATPase, RNase L inhibi | 2e-06 | |
| PRK11701 | 258 | PRK11701, phnK, phosphonate C-P lyase system prote | 2e-06 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 2e-06 | |
| cd03233 | 202 | cd03233, ABCG_PDR_domain1, First domain of the ple | 2e-06 | |
| TIGR00954 | 659 | TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Tra | 2e-06 | |
| COG4778 | 235 | COG4778, PhnL, ABC-type phosphonate transport syst | 2e-06 | |
| PLN03211 | 659 | PLN03211, PLN03211, ABC transporter G-25; Provisio | 2e-06 | |
| COG4133 | 209 | COG4133, CcmA, ABC-type transport system involved | 2e-06 | |
| TIGR01257 | 2272 | TIGR01257, rim_protein, retinal-specific rim ABC t | 3e-06 | |
| TIGR02633 | 500 | TIGR02633, xylG, D-xylose ABC transporter, ATP-bin | 5e-06 | |
| cd03237 | 246 | cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-bin | 5e-06 | |
| cd03289 | 275 | cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 | 6e-06 | |
| cd03222 | 177 | cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett | 7e-06 | |
| PRK00635 | 1809 | PRK00635, PRK00635, excinuclease ABC subunit A; Pr | 8e-06 | |
| TIGR01189 | 198 | TIGR01189, ccmA, heme ABC exporter, ATP-binding pr | 1e-05 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 2e-05 | |
| PRK13409 | 590 | PRK13409, PRK13409, putative ATPase RIL; Provision | 2e-05 | |
| cd03232 | 192 | cd03232, ABCG_PDR_domain2, Second domain of the pl | 2e-05 | |
| TIGR01271 | 1490 | TIGR01271, CFTR_protein, cystic fibrosis transmemb | 3e-05 | |
| cd03240 | 204 | cd03240, ABC_Rad50, ATP-binding cassette domain of | 3e-05 | |
| cd03236 | 255 | cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin | 3e-05 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 6e-05 | |
| PLN03232 | 1495 | PLN03232, PLN03232, ABC transporter C family membe | 7e-05 | |
| PRK10938 | 490 | PRK10938, PRK10938, putative molybdenum transport | 8e-05 | |
| PRK10789 | 569 | PRK10789, PRK10789, putative multidrug transporter | 1e-04 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 2e-04 | |
| pfam13304 | 256 | pfam13304, AAA_21, AAA domain | 2e-04 | |
| COG0178 | 935 | COG0178, UvrA, Excinuclease ATPase subunit [DNA re | 2e-04 | |
| TIGR01194 | 555 | TIGR01194, cyc_pep_trnsptr, cyclic peptide transpo | 2e-04 | |
| PLN03073 | 718 | PLN03073, PLN03073, ABC transporter F family; Prov | 3e-04 | |
| TIGR03719 | 552 | TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot | 3e-04 | |
| PRK13538 | 204 | PRK13538, PRK13538, cytochrome c biogenesis protei | 3e-04 | |
| PLN03130 | 1622 | PLN03130, PLN03130, ABC transporter C family membe | 4e-04 | |
| COG0178 | 935 | COG0178, UvrA, Excinuclease ATPase subunit [DNA re | 4e-04 | |
| PRK10522 | 547 | PRK10522, PRK10522, multidrug transporter membrane | 4e-04 | |
| PRK11819 | 556 | PRK11819, PRK11819, putative ABC transporter ATP-b | 6e-04 | |
| cd03271 | 261 | cd03271, ABC_UvrA_II, ATP-binding cassette domain | 9e-04 | |
| TIGR00630 | 925 | TIGR00630, uvra, excinuclease ABC, A subunit | 0.002 | |
| PRK13540 | 200 | PRK13540, PRK13540, cytochrome c biogenesis protei | 0.002 | |
| PRK13545 | 549 | PRK13545, tagH, teichoic acids export protein ATP- | 0.003 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 0.003 | |
| cd03227 | 162 | cd03227, ABC_Class2, ATP-binding cassette domain o | 0.003 | |
| PLN03140 | 1470 | PLN03140, PLN03140, ABC transporter G family membe | 0.004 |
| >gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system | Back alignment and domain information |
|---|
Score = 169 bits (430), Expect = 5e-54
Identities = 63/134 (47%), Positives = 86/134 (64%), Gaps = 6/134 (4%)
Query: 1 TVADNIRYGPQLRGKKLTEN---EVYKLLSLADLDSSFLSKTGA-EISVGQAQRVALART 56
++ DN+ YG +L G KL E V + L A L + A +S GQ QR+ LAR
Sbjct: 96 SIYDNVAYGLRLHGIKLKEELDERVEEALRKAALWDEVKDRLHALGLSGGQQQRLCLARA 155
Query: 57 LANEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLL 116
LANEPEVLLLDEPTSALDPIST IE+++ +LKK+ TIV+V+H+++Q R+AD L
Sbjct: 156 LANEPEVLLLDEPTSALDPISTAKIEELIAELKKE--YTIVIVTHNMQQAARVADRTAFL 213
Query: 117 VNGEIVEVLKPDLL 130
+NG +VE + +
Sbjct: 214 LNGRLVEFGPTEQI 227
|
Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient. The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes. The PstS protein is a phosphate-binding protein located in the periplasmic space. PstA and PstC are hydrophobic and they form the transmembrane portion of the Pst system. PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein. PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD). Length = 227 |
| >gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like | Back alignment and domain information |
|---|
| >gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter | Back alignment and domain information |
|---|
| >gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems | Back alignment and domain information |
|---|
| >gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters | Back alignment and domain information |
|---|
| >gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein | Back alignment and domain information |
|---|
| >gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents | Back alignment and domain information |
|---|
| >gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237652 PRK14275, PRK14275, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226967 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237651 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system | Back alignment and domain information |
|---|
| >gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters | Back alignment and domain information |
|---|
| >gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters | Back alignment and domain information |
|---|
| >gnl|CDD|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237649 PRK14254, PRK14254, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|172744 PRK14256, PRK14256, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237650 PRK14265, PRK14265, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172751 PRK14263, PRK14263, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|184594 PRK14264, PRK14264, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter | Back alignment and domain information |
|---|
| >gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter | Back alignment and domain information |
|---|
| >gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237451 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172759 PRK14271, PRK14271, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162242 TIGR01187, potA, spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter | Back alignment and domain information |
|---|
| >gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system | Back alignment and domain information |
|---|
| >gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >gnl|CDD|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system | Back alignment and domain information |
|---|
| >gnl|CDD|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter | Back alignment and domain information |
|---|
| >gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226635 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|182893 PRK11000, PRK11000, maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|163508 TIGR03796, NHLM_micro_ABC1, NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system | Back alignment and domain information |
|---|
| >gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >gnl|CDD|215650 pfam00005, ABC_tran, ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|233209 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA | Back alignment and domain information |
|---|
| >gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237453 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >gnl|CDD|226637 COG4167, SapF, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183231 PRK11614, livF, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236898 PRK11308, dppF, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|185067 PRK15112, PRK15112, antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185037 PRK15079, PRK15079, oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|236554 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D | Back alignment and domain information |
|---|
| >gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|236688 PRK10418, nikD, nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182336 PRK10253, PRK10253, iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240339 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system | Back alignment and domain information |
|---|
| >gnl|CDD|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188208 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236861 PRK11147, PRK11147, ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213269 cd03369, ABCC_NFT1, ATP-binding cassette domain 2 of NFT1, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213258 cd03291, ABCC_CFTR1, ATP-binding cassette domain of the cystic fibrosis transmembrane regulator, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226592 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225265 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226968 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213237 cd03270, ABC_UvrA_I, ATP-binding cassette domain I of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213257 cd03290, ABCC_SUR1_N, ATP-binding cassette domain of the sulfonylurea receptor, subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213205 cd03238, ABC_UvrA, ATP-binding cassette domain of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213255 cd03288, ABCC_SUR2, ATP-binding cassette domain 2 of the sulfonylurea receptor SUR | Back alignment and domain information |
|---|
| >gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein | Back alignment and domain information |
|---|
| >gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188098 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|233206 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|213204 cd03237, ABC_RNaseL_inhibitor_domain2, The ATP-binding cassette domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|213256 cd03289, ABCC_CFTR2, ATP-binding cassette domain 2 of CFTR,subfamily C | Back alignment and domain information |
|---|
| >gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|234806 PRK00635, PRK00635, excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters | Back alignment and domain information |
|---|
| >gnl|CDD|233335 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >gnl|CDD|213207 cd03240, ABC_Rad50, ATP-binding cassette domain of Rad50 | Back alignment and domain information |
|---|
| >gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|215640 PLN03232, PLN03232, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|222036 pfam13304, AAA_21, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter | Back alignment and domain information |
|---|
| >gnl|CDD|215558 PLN03073, PLN03073, ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215595 PLN03130, PLN03130, ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223256 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|236707 PRK10522, PRK10522, multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA | Back alignment and domain information |
|---|
| >gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184127 PRK13540, PRK13540, cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184130 PRK13545, tagH, teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 100.0 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 100.0 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 100.0 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 100.0 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 100.0 | |
| COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 100.0 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 100.0 | |
| COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 100.0 | |
| COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 100.0 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 100.0 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 100.0 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 100.0 | |
| COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 100.0 | |
| TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 100.0 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 100.0 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 100.0 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 100.0 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 100.0 | |
| COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 100.0 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 100.0 | |
| PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 100.0 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 100.0 | |
| TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 100.0 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 100.0 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 100.0 | |
| TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 100.0 | |
| PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 100.0 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 100.0 | |
| COG1123 | 539 | ATPase components of various ABC-type transport sy | 100.0 | |
| COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 100.0 | |
| PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 100.0 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 100.0 | |
| PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 100.0 | |
| PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 100.0 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 100.0 | |
| PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 100.0 | |
| PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 100.0 | |
| PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 100.0 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 100.0 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 100.0 | |
| PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 100.0 | |
| PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 100.0 | |
| COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 100.0 | |
| PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 100.0 | |
| COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 100.0 | |
| PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 100.0 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 100.0 | |
| PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 100.0 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 100.0 | |
| COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 100.0 | |
| PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 100.0 | |
| PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 100.0 | |
| TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 100.0 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 100.0 | |
| cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 100.0 | |
| PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 100.0 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 100.0 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 100.0 | |
| PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 100.0 | |
| COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 100.0 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 100.0 | |
| PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 100.0 | |
| PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 100.0 | |
| PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 100.0 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 100.0 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 100.0 | |
| COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 100.0 | |
| PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 100.0 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 100.0 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 100.0 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 100.0 | |
| PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 100.0 | |
| cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 100.0 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 100.0 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 100.0 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 100.0 | |
| TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 100.0 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 100.0 | |
| COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 100.0 | |
| cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 100.0 | |
| PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 100.0 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 100.0 | |
| PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 100.0 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 100.0 | |
| PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 100.0 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 100.0 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 100.0 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 100.0 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 100.0 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 100.0 | |
| PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 100.0 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 100.0 | |
| PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 100.0 | |
| TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 100.0 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 100.0 | |
| PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 100.0 | |
| PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 100.0 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 100.0 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 100.0 | |
| TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 100.0 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 100.0 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 100.0 | |
| TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 100.0 | |
| PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 100.0 | |
| COG4148 | 352 | ModC ABC-type molybdate transport system, ATPase c | 100.0 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 99.98 | |
| PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.98 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.98 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 99.98 | |
| PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 99.98 | |
| PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 99.98 | |
| PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 99.98 | |
| PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 99.98 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 99.98 | |
| PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.98 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 99.98 | |
| PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 99.98 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 99.98 | |
| TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 99.98 | |
| PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.98 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 99.98 | |
| PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 99.98 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 99.98 | |
| PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.98 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 99.98 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.98 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.98 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 99.98 | |
| PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 99.98 | |
| PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 99.98 | |
| cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 99.98 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 99.98 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 99.98 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.98 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 99.98 | |
| COG4181 | 228 | Predicted ABC-type transport system involved in ly | 99.97 | |
| cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 99.97 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 99.97 | |
| PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 99.97 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 99.97 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 99.97 | |
| PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.97 | |
| TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 99.97 | |
| PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 99.97 | |
| PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 99.97 | |
| PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.97 | |
| TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 99.97 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 99.97 | |
| PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 99.97 | |
| PRK10908 | 222 | cell division protein FtsE; Provisional | 99.97 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 99.97 | |
| PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 99.97 | |
| PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 99.97 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 99.97 | |
| PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.97 | |
| PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 99.97 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.97 | |
| TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 99.97 | |
| PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 99.97 | |
| PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.97 | |
| cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 99.97 | |
| PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 99.97 | |
| PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.97 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 99.97 | |
| PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 99.97 | |
| COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 99.97 | |
| PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.97 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 99.97 | |
| COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 99.97 | |
| PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 99.97 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.97 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.97 | |
| PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 99.97 | |
| PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 99.97 | |
| PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 99.97 | |
| PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.97 | |
| PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 99.97 | |
| PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 99.97 | |
| PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 99.97 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 99.97 | |
| PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 99.97 | |
| PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 99.97 | |
| cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 99.97 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 99.97 | |
| PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 99.97 | |
| COG4559 | 259 | ABC-type hemin transport system, ATPase component | 99.97 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 99.97 | |
| PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 99.97 | |
| PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 99.97 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.97 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 99.97 | |
| cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 99.96 | |
| PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 99.96 | |
| cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 99.96 | |
| CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 99.96 | |
| PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 99.96 | |
| cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 99.96 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 99.96 | |
| PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 99.96 | |
| cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 99.96 | |
| PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 99.96 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 99.96 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.96 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 99.96 | |
| cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 99.96 | |
| PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 99.96 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 99.96 | |
| PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 99.96 | |
| PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 99.96 | |
| PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 99.96 | |
| TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 99.96 | |
| cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 99.96 | |
| cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 99.96 | |
| TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 99.96 | |
| TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 99.96 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.96 | |
| KOG0055 | 1228 | consensus Multidrug/pheromone exporter, ABC superf | 99.96 | |
| cd03270 | 226 | ABC_UvrA_I The excision repair protein UvrA domain | 99.96 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 99.96 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.96 | |
| TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 99.96 | |
| TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 99.96 | |
| TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 99.96 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 99.96 | |
| cd03271 | 261 | ABC_UvrA_II The excision repair protein UvrA domai | 99.96 | |
| PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 99.96 | |
| cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 99.96 | |
| PLN03211 | 659 | ABC transporter G-25; Provisional | 99.96 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 99.96 | |
| PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 99.96 | |
| TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 99.96 | |
| TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 99.96 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.95 | |
| TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 99.95 | |
| cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 99.95 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.95 | |
| TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 99.95 | |
| PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 99.95 | |
| TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 99.95 | |
| PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 99.95 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 99.95 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 99.95 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.95 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.95 | |
| TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 99.95 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 99.95 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.95 | |
| TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 99.95 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.95 | |
| cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 99.95 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 99.95 | |
| cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 99.95 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 99.95 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 99.95 | |
| PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 99.95 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 99.95 | |
| cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 99.95 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 99.95 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 99.95 | |
| COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 99.95 | |
| PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 99.95 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 99.95 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 99.94 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.94 | |
| PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 99.94 | |
| COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 99.94 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.94 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.94 | |
| cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 99.94 | |
| cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 99.94 | |
| cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 99.94 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.94 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.94 | |
| cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 99.94 | |
| cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 99.94 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.94 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 99.94 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 99.94 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 99.94 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.94 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.94 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 99.94 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 99.94 | |
| PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 99.94 | |
| PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 99.94 | |
| PLN03232 | 1495 | ABC transporter C family member; Provisional | 99.94 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 99.94 | |
| TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 99.94 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.94 | |
| PRK13409 | 590 | putative ATPase RIL; Provisional | 99.94 | |
| PLN03130 | 1622 | ABC transporter C family member; Provisional | 99.93 | |
| PLN03073 | 718 | ABC transporter F family; Provisional | 99.93 | |
| TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 99.93 | |
| COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 99.93 | |
| PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 99.93 | |
| TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 99.93 | |
| PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 99.93 | |
| COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 99.93 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 99.93 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 99.93 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.93 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 99.93 | |
| TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 99.93 | |
| COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 99.92 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 99.92 | |
| TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 99.92 | |
| PLN03140 | 1470 | ABC transporter G family member; Provisional | 99.92 | |
| TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 99.92 | |
| KOG0061 | 613 | consensus Transporter, ABC superfamily (Breast can | 99.92 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 99.92 | |
| COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 99.92 | |
| KOG0059 | 885 | consensus Lipid exporter ABCA1 and related protein | 99.92 | |
| PRK00349 | 943 | uvrA excinuclease ABC subunit A; Reviewed | 99.92 | |
| TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 99.92 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.92 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.92 | |
| PTZ00243 | 1560 | ABC transporter; Provisional | 99.91 | |
| TIGR00630 | 924 | uvra excinuclease ABC, A subunit. This family is b | 99.91 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.91 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 99.91 | |
| COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 99.9 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 99.9 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 99.9 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 99.9 | |
| COG5265 | 497 | ATM1 ABC-type transport system involved in Fe-S cl | 99.9 | |
| PRK00635 | 1809 | excinuclease ABC subunit A; Provisional | 99.9 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.89 | |
| cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 99.89 | |
| KOG0056 | 790 | consensus Heavy metal exporter HMT1, ABC superfami | 99.88 | |
| cd03276 | 198 | ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein | 99.88 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 99.88 | |
| cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 99.87 | |
| cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 99.86 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 99.86 | |
| COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 99.86 | |
| cd03275 | 247 | ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein | 99.86 | |
| cd03240 | 204 | ABC_Rad50 The catalytic domains of Rad50 are simil | 99.86 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 99.86 | |
| COG4170 | 330 | SapD ABC-type antimicrobial peptide transport syst | 99.85 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 99.85 | |
| cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 99.85 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.84 | |
| COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 99.84 | |
| cd03277 | 213 | ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein | 99.83 | |
| COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 99.83 | |
| COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 99.83 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.81 | |
| cd03239 | 178 | ABC_SMC_head The structural maintenance of chromos | 99.8 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 99.8 | |
| KOG0062 | 582 | consensus ATPase component of ABC transporters wit | 99.79 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.78 | |
| cd03241 | 276 | ABC_RecN RecN ATPase involved in DNA repair; ABC ( | 99.78 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.78 | |
| KOG0927 | 614 | consensus Predicted transporter (ABC superfamily) | 99.78 | |
| TIGR00618 | 1042 | sbcc exonuclease SbcC. This family is based on the | 99.76 | |
| COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 99.75 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 99.75 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 99.74 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 99.73 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 99.72 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 99.72 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 99.69 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 99.68 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 99.68 | |
| COG0178 | 935 | UvrA Excinuclease ATPase subunit [DNA replication, | 99.65 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 99.65 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 99.63 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 99.63 | |
| cd03285 | 222 | ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS | 99.63 | |
| cd03242 | 270 | ABC_RecF RecF is a recombinational DNA repair ATPa | 99.6 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 99.59 | |
| KOG0066 | 807 | consensus eIF2-interacting protein ABC50 (ABC supe | 99.59 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 99.57 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 99.56 | |
| KOG2355 | 291 | consensus Predicted ABC-type transport, ATPase com | 99.54 | |
| KOG0065 | 1391 | consensus Pleiotropic drug resistance proteins (PD | 99.53 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 99.53 | |
| COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 99.53 | |
| PRK00064 | 361 | recF recombination protein F; Reviewed | 99.51 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 99.5 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 99.44 | |
| KOG0060 | 659 | consensus Long-chain acyl-CoA transporter, ABC sup | 99.42 | |
| COG2401 | 593 | ABC-type ATPase fused to a predicted acetyltransfe | 99.4 | |
| TIGR00611 | 365 | recf recF protein. All proteins in this family for | 99.32 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 99.31 | |
| PF02463 | 220 | SMC_N: RecF/RecN/SMC N terminal domain; InterPro: | 99.27 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 99.27 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 99.27 | |
| KOG0063 | 592 | consensus RNAse L inhibitor, ABC superfamily [RNA | 99.26 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 99.22 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 99.22 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 99.2 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 99.19 | |
| PRK14079 | 349 | recF recombination protein F; Provisional | 99.19 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 99.16 | |
| PF13304 | 303 | AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T | 99.12 | |
| KOG0064 | 728 | consensus Peroxisomal long-chain acyl-CoA transpor | 99.07 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 99.06 | |
| PRK13695 | 174 | putative NTPase; Provisional | 98.96 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 98.94 | |
| PF13558 | 90 | SbcCD_C: Putative exonuclease SbcCD, C subunit; PD | 98.9 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 98.81 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 98.8 | |
| PRK13830 | 818 | conjugal transfer protein TrbE; Provisional | 98.8 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 98.7 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 98.56 | |
| PF13175 | 415 | AAA_15: AAA ATPase domain | 98.49 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 98.44 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.44 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 98.41 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 98.38 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 98.37 | |
| PRK13891 | 852 | conjugal transfer protein TrbE; Provisional | 98.37 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 98.34 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 98.29 | |
| COG3910 | 233 | Predicted ATPase [General function prediction only | 98.26 | |
| COG4637 | 373 | Predicted ATPase [General function prediction only | 98.14 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 98.11 | |
| PF13166 | 712 | AAA_13: AAA domain | 98.1 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 98.01 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 97.96 | |
| COG0497 | 557 | RecN ATPase involved in DNA repair [DNA replicatio | 97.87 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.86 | |
| PRK13873 | 811 | conjugal transfer ATPase TrbE; Provisional | 97.81 | |
| KOG0962 | 1294 | consensus DNA repair protein RAD50, ABC-type ATPas | 97.78 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 97.71 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 97.67 | |
| PRK13898 | 800 | type IV secretion system ATPase VirB4; Provisional | 97.63 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.55 | |
| COG1195 | 363 | RecF Recombinational DNA repair ATPase (RecF pathw | 97.42 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 97.42 | |
| PF09818 | 448 | ABC_ATPase: Predicted ATPase of the ABC class; Int | 97.2 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.14 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 97.09 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 97.05 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 96.93 | |
| COG4694 | 758 | Uncharacterized protein conserved in bacteria [Fun | 96.88 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.7 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 96.68 | |
| PF13514 | 1111 | AAA_27: AAA domain | 96.62 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 96.44 | |
| COG3044 | 554 | Predicted ATPase of the ABC class [General functio | 96.42 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.29 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.28 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.2 | |
| PRK13764 | 602 | ATPase; Provisional | 96.11 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 95.98 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 95.93 | |
| COG4913 | 1104 | Uncharacterized protein conserved in bacteria [Fun | 95.79 | |
| TIGR01070 | 840 | mutS1 DNA mismatch repair protein MutS. | 95.77 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 95.69 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.65 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.42 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 95.37 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.26 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 95.18 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.1 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 95.03 |
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.2e-43 Score=266.33 Aligned_cols=142 Identities=38% Similarity=0.570 Sum_probs=130.0
Q ss_pred ChHHHhhcCccccCCCc--cHHHHHHHHHHcCCChhhhcCCcCCCChhHHHHHHHHHHHhcCCCEEEeeCCCCCCCHHHH
Q 046954 1 TVADNIRYGPQLRGKKL--TENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANEPEVLLLDEPTSALDPIST 78 (146)
Q Consensus 1 tv~eni~~~~~~~~~~~--~~~~~~~~l~~~~l~~~~~~~~~~~LSgG~~qrv~ia~al~~~p~llllDEPt~~LD~~~~ 78 (146)
||++|++|++...+.+. .+.++.++++.+||+ ++.++||.+|||||||||+|||||+.+|++||+|||||+|||.+.
T Consensus 99 TV~~NvA~PLeiag~~k~ei~~RV~elLelVgL~-dk~~~yP~qLSGGQKQRVaIARALa~~P~iLL~DEaTSALDP~TT 177 (339)
T COG1135 99 TVFENVAFPLELAGVPKAEIKQRVAELLELVGLS-DKADRYPAQLSGGQKQRVAIARALANNPKILLCDEATSALDPETT 177 (339)
T ss_pred hHHhhhhhhHhhcCCCHHHHHHHHHHHHHHcCCh-hhhccCchhcCcchhhHHHHHHHHhcCCCEEEecCccccCChHHH
Confidence 79999999988776432 356788999999997 689999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhcCCeEEEEecCHHHHHhhcCeEEEEECCEEEEeeCccccc-cCCCHHHHHHhh
Q 046954 79 QNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLS-EAKHPMALRFLQ 143 (146)
Q Consensus 79 ~~~~~~l~~l~~~~g~tvi~itH~~~~~~~~~d~v~~l~~G~i~~~g~~~~~~-~~~~~~~~~~~~ 143 (146)
+.++++|+++.++.|.||++|||.|+.+.++||||.+|++|++++.|+..+++ +++++.++.|+.
T Consensus 178 ~sIL~LL~~In~~lglTIvlITHEm~Vvk~ic~rVavm~~G~lvE~G~v~~vF~~Pk~~~t~~fi~ 243 (339)
T COG1135 178 QSILELLKDINRELGLTIVLITHEMEVVKRICDRVAVLDQGRLVEEGTVSEVFANPKHAITQEFIG 243 (339)
T ss_pred HHHHHHHHHHHHHcCCEEEEEechHHHHHHHhhhheEeeCCEEEEeccHHHhhcCcchHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999998875 456777777764
|
|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
|---|
| >COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
|---|
| >TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
|---|
| >PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
|---|
| >PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
|---|
| >PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
|---|
| >PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
|---|
| >PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
|---|
| >PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
|---|
| >PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
|---|
| >PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
|---|
| >PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
|---|
| >PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
|---|
| >COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
|---|
| >PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
|---|
| >CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
|---|
| >PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
|---|
| >cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
|---|
| >PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
|---|
| >PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
|---|
| >PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
|---|
| >cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
|---|
| >TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
|---|
| >TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
|---|
| >TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
|---|
| >PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
|---|
| >TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
|---|
| >cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
|---|
| >PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
|---|
| >TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
|---|
| >COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
|---|
| >cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
|---|
| >cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
|---|
| >PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
|---|
| >PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
|---|
| >TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
|---|
| >COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
|---|
| >TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
|---|
| >PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
|---|
| >COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
|---|
| >COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
|---|
| >PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
|---|
| >TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
|---|
| >KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK00349 uvrA excinuclease ABC subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00630 uvra excinuclease ABC, A subunit | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00635 excinuclease ABC subunit A; Provisional | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
|---|
| >KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
|---|
| >COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00618 sbcc exonuclease SbcC | Back alignment and domain information |
|---|
| >COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription] | Back alignment and domain information |
|---|
| >KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00064 recF recombination protein F; Reviewed | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >KOG0060 consensus Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis) [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00611 recf recF protein | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression [] | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0063 consensus RNAse L inhibitor, ABC superfamily [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK14079 recF recombination protein F; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A | Back alignment and domain information |
|---|
| >KOG0064 consensus Peroxisomal long-chain acyl-CoA transporter, ABC superfamily [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PRK13830 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PF13175 AAA_15: AAA ATPase domain | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK13891 conjugal transfer protein TrbE; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >COG3910 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4637 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >COG0497 RecN ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK13873 conjugal transfer ATPase TrbE; Provisional | Back alignment and domain information |
|---|
| >KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK13898 type IV secretion system ATPase VirB4; Provisional | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PF09818 ABC_ATPase: Predicted ATPase of the ABC class; InterPro: IPR019195 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4694 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >COG3044 Predicted ATPase of the ABC class [General function prediction only] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG4913 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01070 mutS1 DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 146 | ||||
| 3dhw_C | 343 | Crystal Structure Of Methionine Importer Metni Leng | 2e-19 | ||
| 3tui_C | 366 | Inward Facing Conformations Of The Metni Methionine | 5e-19 | ||
| 3tuj_C | 366 | Inward Facing Conformations Of The Metni Methionine | 7e-19 | ||
| 2olj_A | 263 | Abc Protein Artp In Complex With AdpMG2+ Length = 2 | 8e-16 | ||
| 3c41_J | 242 | Abc Protein Artp In Complex With Amp-PnpMG2+ Length | 9e-16 | ||
| 3d31_A | 348 | Modbc From Methanosarcina Acetivorans Length = 348 | 6e-15 | ||
| 1oxs_C | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 7e-14 | ||
| 2it1_A | 362 | Structure Of Ph0203 Protein From Pyrococcus Horikos | 9e-14 | ||
| 1f3o_A | 235 | Crystal Structure Of Mj0796 Atp-Binding Cassette Le | 2e-13 | ||
| 1oxx_K | 353 | Crystal Structure Of Glcv, The Abc-Atpase Of The Gl | 4e-13 | ||
| 1l2t_A | 235 | Dimeric Structure Of Mj0796, A Bacterial Abc Transp | 1e-12 | ||
| 3gfo_A | 275 | Structure Of Cbio1 From Clostridium Perfringens: Pa | 1e-12 | ||
| 3tif_A | 235 | Dimeric Structure Of A Post-Hydrolysis State Of The | 1e-12 | ||
| 1z47_A | 355 | Structure Of The Atpase Subunit Cysa Of The Putativ | 3e-12 | ||
| 1q12_A | 381 | Crystal Structure Of The Atp-bound E. Coli Malk Len | 5e-12 | ||
| 1q1b_A | 381 | Crystal Structure Of E. Coli Malk In The Nucleotide | 5e-12 | ||
| 3g5u_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 6e-12 | ||
| 1b0u_A | 262 | Atp-Binding Subunit Of The Histidine Permease From | 6e-12 | ||
| 3g60_A | 1284 | Structure Of P-Glycoprotein Reveals A Molecular Bas | 6e-12 | ||
| 4f4c_A | 1321 | The Crystal Structure Of The Multi-Drug Transporter | 9e-12 | ||
| 2r6g_A | 381 | The Crystal Structure Of The E. Coli Maltose Transp | 1e-11 | ||
| 2pcj_A | 224 | Crystal Structure Of Abc Transporter (Aq_297) From | 6e-11 | ||
| 2pmk_A | 243 | Crystal Structures Of An Isolated Abc-Atpase In Com | 7e-11 | ||
| 3b5j_A | 243 | Crystal Structures Of The S504a Mutant Of An Isolat | 8e-11 | ||
| 1mt0_A | 241 | Atp-Binding Domain Of Haemolysin B From Escherichia | 9e-11 | ||
| 2ff7_A | 247 | The Abc-Atpase Of The Abc-Transporter Hlyb In The A | 9e-11 | ||
| 2onk_A | 240 | Abc Transporter Modbc In Complex With Its Binding P | 1e-10 | ||
| 2ffb_A | 247 | The Crystal Structure Of The Hlyb-Nbd E631q Mutant | 2e-10 | ||
| 3b5x_A | 582 | Crystal Structure Of Msba From Vibrio Cholerae Leng | 3e-10 | ||
| 2yyz_A | 359 | Crystal Structure Of Sugar Abc Transporter, Atp-Bin | 6e-10 | ||
| 4ayw_A | 619 | Structure Of The Human Mitochondrial Abc Transporte | 1e-09 | ||
| 2hyd_A | 578 | Multidrug Abc Transporter Sav1866 Length = 578 | 1e-09 | ||
| 1g29_1 | 372 | Malk Length = 372 | 1e-09 | ||
| 1xef_A | 241 | Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DI | 1e-09 | ||
| 2ffa_A | 247 | Crystal Structure Of Abc-Atpase H662a Of The Abc-Tr | 1e-09 | ||
| 4ayt_A | 595 | Structure Of The Human Mitochondrial Abc Transporte | 2e-09 | ||
| 3qf4_B | 598 | Crystal Structure Of A Heterodimeric Abc Transporte | 3e-09 | ||
| 3nh6_A | 306 | Nucleotide Binding Domain Of Human Abcb6 (Apo Struc | 4e-09 | ||
| 2nq2_C | 253 | An Inward-Facing Conformation Of A Putative Metal-C | 5e-09 | ||
| 1vpl_A | 256 | Crystal Structure Of Abc Transporter Atp-binding Pr | 6e-09 | ||
| 1v43_A | 372 | Crystal Structure Of Atpase Subunit Of Abc Sugar Tr | 6e-09 | ||
| 1vci_A | 373 | Crystal Structure Of The Atp-binding Cassette Of Mu | 6e-09 | ||
| 2d62_A | 375 | Crystal Structure Of Multiple Sugar Binding Transpo | 9e-09 | ||
| 1mv5_A | 243 | Crystal Structure Of Lmra Atp-Binding Domain Length | 1e-08 | ||
| 1jj7_A | 260 | Crystal Structure Of The C-Terminal Atpase Domain O | 1e-08 | ||
| 3b5w_A | 582 | Crystal Structure Of Eschericia Coli Msba Length = | 3e-08 | ||
| 3b5y_A | 582 | Crystal Structure Of Msba From Salmonella Typhimuri | 3e-08 | ||
| 4hlu_D | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 3e-08 | ||
| 4g1u_C | 266 | X-Ray Structure Of The Bacterial Heme Transporter H | 4e-08 | ||
| 2ghi_A | 260 | Crystal Structure Of Plasmodium Yoelii Multidrug Re | 6e-08 | ||
| 4fwi_B | 334 | Crystal Structure Of The Nucleotide-binding Domain | 7e-08 | ||
| 2ixf_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 7e-08 | ||
| 3qf4_A | 587 | Crystal Structure Of A Heterodimeric Abc Transporte | 1e-07 | ||
| 2ixg_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 5e-07 | ||
| 1g6h_A | 257 | Crystal Structure Of The Adp Conformation Of Mj1267 | 8e-07 | ||
| 1g9x_A | 257 | Characterization Of The Twinning Structure Of Mj126 | 8e-07 | ||
| 2ixe_A | 271 | Crystal Structure Of The Atpase Domain Of Tap1 With | 1e-06 | ||
| 4hlu_A | 268 | Structure Of The Ecfa-a' Heterodimer Bound To Adp L | 1e-06 | ||
| 2yz2_A | 266 | Crystal Structure Of The Abc Transporter In The Cob | 1e-06 | ||
| 3fvq_A | 359 | Crystal Structure Of The Nucleotide Binding Domain | 1e-06 | ||
| 1gaj_A | 257 | Crystal Structure Of A Nucleotide-Free Atp-Binding | 2e-06 | ||
| 2cbz_A | 237 | Structure Of The Human Multidrug Resistance Protein | 2e-06 | ||
| 2ihy_A | 279 | Structure Of The Staphylococcus Aureus Putative Atp | 2e-06 | ||
| 4dbl_C | 249 | Crystal Structure Of E159q Mutant Of Btucdf Length | 2e-06 | ||
| 4fi3_C | 249 | Structure Of Vitamin B12 Transporter Btucd-F In A N | 3e-06 | ||
| 3bk7_A | 607 | Structure Of The Complete Abce1RNAASE-L Inhibitor P | 8e-06 | ||
| 3j15_B | 593 | Model Of Ribosome-Bound Archaeal Pelota And Abce1 L | 8e-06 | ||
| 1yqt_A | 538 | Rnase-L Inhibitor Length = 538 | 9e-06 | ||
| 3ux8_A | 670 | Crystal Structure Of Uvra Length = 670 | 3e-05 | ||
| 2qi9_C | 249 | Abc-Transporter Btucd In Complex With Its Periplasm | 3e-05 | ||
| 2r6f_A | 972 | Crystal Structure Of Bacillus Stearothermophilus Uv | 4e-05 | ||
| 3uwx_A | 972 | Crystal Structure Of Uvra-Uvrb Complex Length = 972 | 5e-05 | ||
| 1l7v_C | 249 | Bacterial Abc Transporter Involved In B12 Uptake Le | 9e-05 | ||
| 2vf7_A | 842 | Crystal Structure Of Uvra2 From Deinococcus Radiodu | 1e-04 | ||
| 3gd7_A | 390 | Crystal Structure Of Human Nbd2 Complexed With N6- | 3e-04 |
| >pdb|3DHW|C Chain C, Crystal Structure Of Methionine Importer Metni Length = 343 | Back alignment and structure |
|
| >pdb|3TUI|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Cy5 Native Crystal Form Length = 366 | Back alignment and structure |
| >pdb|3TUJ|C Chain C, Inward Facing Conformations Of The Metni Methionine Abc Transporter: Dm Crystal Form Length = 366 | Back alignment and structure |
| >pdb|2OLJ|A Chain A, Abc Protein Artp In Complex With AdpMG2+ Length = 263 | Back alignment and structure |
| >pdb|3C41|J Chain J, Abc Protein Artp In Complex With Amp-PnpMG2+ Length = 242 | Back alignment and structure |
| >pdb|3D31|A Chain A, Modbc From Methanosarcina Acetivorans Length = 348 | Back alignment and structure |
| >pdb|1OXS|C Chain C, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|2IT1|A Chain A, Structure Of Ph0203 Protein From Pyrococcus Horikoshii Length = 362 | Back alignment and structure |
| >pdb|1F3O|A Chain A, Crystal Structure Of Mj0796 Atp-Binding Cassette Length = 235 | Back alignment and structure |
| >pdb|1OXX|K Chain K, Crystal Structure Of Glcv, The Abc-Atpase Of The Glucose Abc Transporter From Sulfolobus Solfataricus Length = 353 | Back alignment and structure |
| >pdb|1L2T|A Chain A, Dimeric Structure Of Mj0796, A Bacterial Abc Transporter Cassette Length = 235 | Back alignment and structure |
| >pdb|3GFO|A Chain A, Structure Of Cbio1 From Clostridium Perfringens: Part Of The Abc Transporter Complex Cbionq Length = 275 | Back alignment and structure |
| >pdb|3TIF|A Chain A, Dimeric Structure Of A Post-Hydrolysis State Of The Atp-Binding Cassette Mj0796 Bound To Adp And Pi Length = 235 | Back alignment and structure |
| >pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 | Back alignment and structure |
| >pdb|1Q12|A Chain A, Crystal Structure Of The Atp-bound E. Coli Malk Length = 381 | Back alignment and structure |
| >pdb|1Q1B|A Chain A, Crystal Structure Of E. Coli Malk In The Nucleotide-Free Form Length = 381 | Back alignment and structure |
| >pdb|3G5U|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|1B0U|A Chain A, Atp-Binding Subunit Of The Histidine Permease From Salmonella Typhimurium Length = 262 | Back alignment and structure |
| >pdb|3G60|A Chain A, Structure Of P-Glycoprotein Reveals A Molecular Basis For Poly-Specific Drug Binding Length = 1284 | Back alignment and structure |
| >pdb|4F4C|A Chain A, The Crystal Structure Of The Multi-Drug Transporter Length = 1321 | Back alignment and structure |
| >pdb|2R6G|A Chain A, The Crystal Structure Of The E. Coli Maltose Transporter Length = 381 | Back alignment and structure |
| >pdb|2PCJ|A Chain A, Crystal Structure Of Abc Transporter (Aq_297) From Aquifex Aeolicus Vf5 Length = 224 | Back alignment and structure |
| >pdb|2PMK|A Chain A, Crystal Structures Of An Isolated Abc-Atpase In Complex With Tnp-Adp Length = 243 | Back alignment and structure |
| >pdb|3B5J|A Chain A, Crystal Structures Of The S504a Mutant Of An Isolated Abc-atpase In Complex With Tnp-adp Length = 243 | Back alignment and structure |
| >pdb|1MT0|A Chain A, Atp-Binding Domain Of Haemolysin B From Escherichia Coli Length = 241 | Back alignment and structure |
| >pdb|2FF7|A Chain A, The Abc-Atpase Of The Abc-Transporter Hlyb In The Adp Bound State Length = 247 | Back alignment and structure |
| >pdb|2ONK|A Chain A, Abc Transporter Modbc In Complex With Its Binding Protein Moda Length = 240 | Back alignment and structure |
| >pdb|2FFB|A Chain A, The Crystal Structure Of The Hlyb-Nbd E631q Mutant In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|3B5X|A Chain A, Crystal Structure Of Msba From Vibrio Cholerae Length = 582 | Back alignment and structure |
| >pdb|2YYZ|A Chain A, Crystal Structure Of Sugar Abc Transporter, Atp-Binding Protein Length = 359 | Back alignment and structure |
| >pdb|4AYW|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 (plate Form) Length = 619 | Back alignment and structure |
| >pdb|2HYD|A Chain A, Multidrug Abc Transporter Sav1866 Length = 578 | Back alignment and structure |
| >pdb|1G29|1 Chain 1, Malk Length = 372 | Back alignment and structure |
| >pdb|1XEF|A Chain A, Crystal Structure Of The AtpMG2+ BOUND COMPOSITE DIMER OF HLYB-Nbd Length = 241 | Back alignment and structure |
| >pdb|2FFA|A Chain A, Crystal Structure Of Abc-Atpase H662a Of The Abc-Transporter Hlyb In Complex With Adp Length = 247 | Back alignment and structure |
| >pdb|4AYT|A Chain A, Structure Of The Human Mitochondrial Abc Transporter, Abcb10 Length = 595 | Back alignment and structure |
| >pdb|3QF4|B Chain B, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 598 | Back alignment and structure |
| >pdb|3NH6|A Chain A, Nucleotide Binding Domain Of Human Abcb6 (Apo Structure) Length = 306 | Back alignment and structure |
| >pdb|2NQ2|C Chain C, An Inward-Facing Conformation Of A Putative Metal-Chelate Type Abc Transporter. Length = 253 | Back alignment and structure |
| >pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 | Back alignment and structure |
| >pdb|1V43|A Chain A, Crystal Structure Of Atpase Subunit Of Abc Sugar Transporter Length = 372 | Back alignment and structure |
| >pdb|1VCI|A Chain A, Crystal Structure Of The Atp-binding Cassette Of Multisugar Transporter From Pyrococcus Horikoshii Ot3 Complexed With Atp Length = 373 | Back alignment and structure |
| >pdb|2D62|A Chain A, Crystal Structure Of Multiple Sugar Binding Transport Atp- Binding Protein Length = 375 | Back alignment and structure |
| >pdb|1MV5|A Chain A, Crystal Structure Of Lmra Atp-Binding Domain Length = 243 | Back alignment and structure |
| >pdb|1JJ7|A Chain A, Crystal Structure Of The C-Terminal Atpase Domain Of Human Tap1 Length = 260 | Back alignment and structure |
| >pdb|3B5W|A Chain A, Crystal Structure Of Eschericia Coli Msba Length = 582 | Back alignment and structure |
| >pdb|3B5Y|A Chain A, Crystal Structure Of Msba From Salmonella Typhimurium With Amppnp Length = 582 | Back alignment and structure |
| >pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|4G1U|C Chain C, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv From Yersinia Pestis Length = 266 | Back alignment and structure |
| >pdb|2GHI|A Chain A, Crystal Structure Of Plasmodium Yoelii Multidrug Resistance Protein 2 Length = 260 | Back alignment and structure |
| >pdb|4FWI|B Chain B, Crystal Structure Of The Nucleotide-binding Domain Of A Dipeptide Abc Transporter Length = 334 | Back alignment and structure |
| >pdb|2IXF|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (D645q, Q678h Mutant) Length = 271 | Back alignment and structure |
| >pdb|3QF4|A Chain A, Crystal Structure Of A Heterodimeric Abc Transporter In Its Inward- Facing Conformation Length = 587 | Back alignment and structure |
| >pdb|2IXG|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (S621a, G622v, D645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|1G6H|A Chain A, Crystal Structure Of The Adp Conformation Of Mj1267, An Atp- Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|1G9X|A Chain A, Characterization Of The Twinning Structure Of Mj1267, An Atp-Binding Cassette Of An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|2IXE|A Chain A, Crystal Structure Of The Atpase Domain Of Tap1 With Atp (d645n Mutant) Length = 271 | Back alignment and structure |
| >pdb|4HLU|A Chain A, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 | Back alignment and structure |
| >pdb|2YZ2|A Chain A, Crystal Structure Of The Abc Transporter In The Cobalt Transport System Length = 266 | Back alignment and structure |
| >pdb|3FVQ|A Chain A, Crystal Structure Of The Nucleotide Binding Domain Fbpc Complexed With Atp Length = 359 | Back alignment and structure |
| >pdb|1GAJ|A Chain A, Crystal Structure Of A Nucleotide-Free Atp-Binding Cassette From An Abc Transporter Length = 257 | Back alignment and structure |
| >pdb|2CBZ|A Chain A, Structure Of The Human Multidrug Resistance Protein 1 Nucleotide Binding Domain 1 Length = 237 | Back alignment and structure |
| >pdb|2IHY|A Chain A, Structure Of The Staphylococcus Aureus Putative Atpase Subunit Of An Atp-Binding Cassette (Abc) Transporter Length = 279 | Back alignment and structure |
| >pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 | Back alignment and structure |
| >pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 | Back alignment and structure |
| >pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 | Back alignment and structure |
| >pdb|3J15|B Chain B, Model Of Ribosome-Bound Archaeal Pelota And Abce1 Length = 593 | Back alignment and structure |
| >pdb|1YQT|A Chain A, Rnase-L Inhibitor Length = 538 | Back alignment and structure |
| >pdb|3UX8|A Chain A, Crystal Structure Of Uvra Length = 670 | Back alignment and structure |
| >pdb|2QI9|C Chain C, Abc-Transporter Btucd In Complex With Its Periplasmic Binding Protein Btuf Length = 249 | Back alignment and structure |
| >pdb|2R6F|A Chain A, Crystal Structure Of Bacillus Stearothermophilus Uvra Length = 972 | Back alignment and structure |
| >pdb|3UWX|A Chain A, Crystal Structure Of Uvra-Uvrb Complex Length = 972 | Back alignment and structure |
| >pdb|1L7V|C Chain C, Bacterial Abc Transporter Involved In B12 Uptake Length = 249 | Back alignment and structure |
| >pdb|2VF7|A Chain A, Crystal Structure Of Uvra2 From Deinococcus Radiodurans Length = 842 | Back alignment and structure |
| >pdb|3GD7|A Chain A, Crystal Structure Of Human Nbd2 Complexed With N6- Phenylethyl-Atp (P-Atp) Length = 390 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 3e-35 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 2e-33 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 3e-29 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 9e-29 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 1e-27 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 2e-25 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 4e-25 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 3e-24 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 2e-23 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 4e-24 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 1e-23 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 2e-23 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 2e-23 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 3e-23 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 1e-22 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 2e-22 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 2e-20 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 4e-22 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 4e-21 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 4e-21 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 2e-20 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 6e-20 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 9e-20 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 1e-19 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 9e-20 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 1e-19 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 2e-19 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 3e-19 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 5e-19 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 5e-19 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 7e-19 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 1e-18 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 2e-18 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 4e-17 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 7e-17 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 1e-16 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 4e-16 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 1e-14 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 2e-14 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 4e-14 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 9e-14 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 3e-13 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 7e-13 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 1e-12 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 8e-12 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 1e-11 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 2e-11 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 6e-11 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 6e-11 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 3e-10 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 2e-10 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 2e-10 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 6e-10 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 3e-07 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 5e-05 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 2e-04 |
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 | Back alignment and structure |
|---|
Score = 122 bits (307), Expect = 3e-35
Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 7/129 (5%)
Query: 1 TVADNIRYGPQLRGKKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANE 60
TV D + +L K L + ++L L L + ++S GQ+ V + LA++
Sbjct: 89 TVNDIVYLYEEL--KGLDRDLFLEMLKALKLGEEILRRKLYKLSAGQSVLVRTSLALASQ 146
Query: 61 PEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIAD-VVCLLVNG 119
PE++ LDEP +D V+ + K++G ++V+H + + + LV
Sbjct: 147 PEIVGLDEPFENVDAAR----RHVISRYIKEYGKEGILVTHELDMLNLYKEYKAYFLVGN 202
Query: 120 EIVEVLKPD 128
+ +
Sbjct: 203 RLQGPISVS 211
|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Length = 339 | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Length = 148 | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Length = 365 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Length = 371 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 100.0 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 100.0 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 100.0 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 100.0 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 100.0 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 100.0 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 100.0 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 100.0 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 100.0 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 100.0 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 100.0 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 100.0 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 100.0 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 100.0 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 100.0 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 100.0 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 100.0 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 100.0 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 100.0 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 100.0 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 100.0 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 100.0 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 100.0 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 100.0 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 100.0 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 100.0 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 100.0 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 100.0 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 100.0 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 100.0 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 100.0 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 100.0 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 99.98 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 99.98 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 99.97 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.97 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 99.97 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 99.97 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 99.97 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 99.97 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.97 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.97 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 99.97 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 99.97 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.97 | |
| 3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 99.97 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 99.97 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.97 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.96 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.96 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.96 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 99.96 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 99.96 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.96 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.96 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.95 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.95 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 99.95 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 99.95 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.95 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 99.95 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 99.94 | |
| 3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 99.94 | |
| 2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 99.94 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 99.94 | |
| 1f2t_B | 148 | RAD50 ABC-ATPase; DNA double-strand break repair, | 99.94 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 99.94 | |
| 2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 99.93 | |
| 2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 99.93 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 99.89 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 99.87 | |
| 4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 99.87 | |
| 3kta_B | 173 | Chromosome segregation protein SMC; structural mai | 99.86 | |
| 3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 99.86 | |
| 1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 99.85 | |
| 2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 99.84 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 99.79 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 99.79 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 99.78 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 99.77 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.68 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 99.63 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 99.57 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 99.56 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 99.52 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 99.51 | |
| 2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 99.48 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 99.43 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 99.43 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 99.36 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 99.33 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 99.32 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 99.29 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 99.25 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 99.24 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 99.23 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 99.18 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 99.18 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 99.18 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 99.17 | |
| 1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 99.17 | |
| 1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 99.15 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 99.14 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 99.09 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 99.08 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 99.04 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.93 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.92 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 98.86 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 98.79 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 98.78 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 98.75 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 98.66 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.59 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 98.51 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 98.44 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.44 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 98.42 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 98.28 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 98.24 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.23 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 98.17 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 98.06 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.05 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 98.03 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 98.02 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.92 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 97.86 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 97.84 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.75 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.66 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 97.6 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 97.55 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.5 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 97.32 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 97.23 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.08 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 97.0 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.98 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.97 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.89 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.6 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 96.59 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.45 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 96.45 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.87 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 95.67 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.58 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.35 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.35 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.33 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 95.22 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.13 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.12 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 95.02 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.0 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 94.85 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 94.53 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 94.32 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.24 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.01 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 93.81 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 93.71 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.67 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 93.48 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 93.3 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 92.95 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 92.92 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.87 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 92.32 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 91.23 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 90.86 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 90.78 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 90.75 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.6 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 90.39 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 90.26 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 90.11 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 89.98 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 89.27 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 87.9 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 87.8 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 87.34 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 87.11 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 85.17 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 85.11 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 84.81 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 84.35 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 84.1 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 83.95 | |
| 4dgh_A | 130 | Sulfate permease family protein; STAS domain, anio | 83.69 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 83.59 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 83.16 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 82.89 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 82.85 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 82.57 | |
| 1b9m_A | 265 | Protein (mode); DNA-binding, gene regulation, wing | 82.16 | |
| 4dgf_A | 135 | Sulfate transporter sulfate transporter family PR; | 80.71 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 80.37 |
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
Probab=100.00 E-value=4e-39 Score=254.43 Aligned_cols=142 Identities=37% Similarity=0.564 Sum_probs=124.6
Q ss_pred ChHHHhhcCccccCCC--ccHHHHHHHHHHcCCChhhhcCCcCCCChhHHHHHHHHHHHhcCCCEEEeeCCCCCCCHHHH
Q 046954 1 TVADNIRYGPQLRGKK--LTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANEPEVLLLDEPTSALDPIST 78 (146)
Q Consensus 1 tv~eni~~~~~~~~~~--~~~~~~~~~l~~~~l~~~~~~~~~~~LSgG~~qrv~ia~al~~~p~llllDEPt~~LD~~~~ 78 (146)
||+||+.++....+.+ ...+++.++++.+|+. ++.++++.+|||||||||+|||||+++|++|||||||+|||+.++
T Consensus 121 TV~env~~~~~~~~~~~~~~~~~v~~lL~~vgL~-~~~~~~~~~LSGGqkQRVaIArAL~~~P~lLLlDEPTs~LD~~~~ 199 (366)
T 3tui_C 121 TVFGNVALPLELDNTPKDEVKRRVTELLSLVGLG-DKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDQATSALDPATT 199 (366)
T ss_dssp CHHHHHHHHHHHSCCCHHHHHHHHHHHHHHHTCG-GGTTCCTTTSCHHHHHHHHHHHHTTTCCSEEEEESTTTTSCHHHH
T ss_pred CHHHHHHHHHHhcCCCHHHHHHHHHHHHHHcCCc-hHhcCChhhCCHHHHHHHHHHHHHhcCCCEEEEECCCccCCHHHH
Confidence 7899999986554432 2245688899999996 688999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhcCCeEEEEecCHHHHHhhcCeEEEEECCEEEEeeCcccccc-CCCHHHHHHhh
Q 046954 79 QNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLSE-AKHPMALRFLQ 143 (146)
Q Consensus 79 ~~~~~~l~~l~~~~g~tvi~itH~~~~~~~~~d~v~~l~~G~i~~~g~~~~~~~-~~~~~~~~~~~ 143 (146)
..++++|++++++.|+|||+||||++++.++||||++|++|++++.|+++++.. +.+++...|+.
T Consensus 200 ~~i~~lL~~l~~~~g~Tii~vTHdl~~~~~~aDrv~vl~~G~iv~~g~~~ev~~~p~~~~~~~~~~ 265 (366)
T 3tui_C 200 RSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEVFSHPKTPLAQKFIQ 265 (366)
T ss_dssp HHHHHHHHHHHHHSCCEEEEEESCHHHHHHHCSEEEEEETTEEEECCBHHHHHSSCCSHHHHHHHH
T ss_pred HHHHHHHHHHHHhCCCEEEEEecCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhCCCcHHHHHHHh
Confidence 999999999987779999999999999999999999999999999999988754 45566665543
|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* | Back alignment and structure |
|---|
| >3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
|---|
| >1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
|---|
| >1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >4dgh_A Sulfate permease family protein; STAS domain, anion exchange, membrane, transport protein; HET: MSE; 1.90A {Vibrio cholerae} PDB: 3mgl_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1b9m_A Protein (mode); DNA-binding, gene regulation, winged helix turn helix, molybdate, OB fold, transcription; 1.75A {Escherichia coli} SCOP: a.4.5.8 b.40.6.2 b.40.6.2 PDB: 1b9n_A 1o7l_A 1h9s_A 1h9r_A 1h9s_B | Back alignment and structure |
|---|
| >4dgf_A Sulfate transporter sulfate transporter family PR; STAS domain, anion exchange, membrane, transport protein; HET: MSE; 1.60A {Wolinella succinogenes} PDB: 3oir_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 146 | ||||
| d1v43a3 | 239 | c.37.1.12 (A:7-245) Hypothetical protein PH0022, N | 9e-34 | |
| d1l2ta_ | 230 | c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann | 4e-32 | |
| d3dhwc1 | 240 | c.37.1.12 (C:1-240) Methionine import ATP-binding | 3e-31 | |
| d1b0ua_ | 258 | c.37.1.12 (A:) ATP-binding subunit of the histidin | 4e-30 | |
| d1g2912 | 240 | c.37.1.12 (1:1-240) Maltose transport protein MalK | 1e-29 | |
| d1ji0a_ | 240 | c.37.1.12 (A:) Branched chain aminoacid ABC transp | 4e-29 | |
| d2hyda1 | 255 | c.37.1.12 (A:324-578) Putative multidrug export AT | 7e-29 | |
| d1jj7a_ | 251 | c.37.1.12 (A:) Peptide transporter Tap1, C-termina | 2e-27 | |
| d3b60a1 | 253 | c.37.1.12 (A:329-581) Multidrug resistance ABC tra | 5e-27 | |
| d1g6ha_ | 254 | c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann | 6e-27 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 1e-26 | |
| d1r0wa_ | 281 | c.37.1.12 (A:) Cystic fibrosis transmembrane condu | 4e-26 | |
| d1mv5a_ | 242 | c.37.1.12 (A:) Multidrug resistance ABC transporte | 2e-24 | |
| d1sgwa_ | 200 | c.37.1.12 (A:) Putative ABC transporter PF0895 {Py | 2e-24 | |
| d2pmka1 | 241 | c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro | 4e-24 | |
| d1vpla_ | 238 | c.37.1.12 (A:) Putative ABC transporter TM0544 {Th | 3e-23 | |
| d1l7vc_ | 231 | c.37.1.12 (C:) ABC transporter involved in vitamin | 5e-23 | |
| d1oxxk2 | 242 | c.37.1.12 (K:1-242) Glucose transport protein GlcV | 5e-22 | |
| d3d31a2 | 229 | c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor | 1e-21 | |
| d2onka1 | 240 | c.37.1.12 (A:1-240) Molybdate/tungstate import ATP | 6e-21 | |
| g1ii8.1 | 369 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 2e-16 | |
| g1f2t.1 | 292 | c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio | 3e-16 | |
| d1ye8a1 | 178 | c.37.1.11 (A:1-178) Hypothetical kinase-like prote | 7e-08 | |
| d1w1wa_ | 427 | c.37.1.12 (A:) Smc head domain {Baker's yeast (Sac | 9e-06 |
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Hypothetical protein PH0022, N-terminal domain species: Pyrococcus horikoshii [TaxId: 53953]
Score = 116 bits (292), Expect = 9e-34
Identities = 39/145 (26%), Positives = 75/145 (51%), Gaps = 4/145 (2%)
Query: 1 TVADNIRYGPQLRG--KKLTENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLA 58
TV +NI + +++ K + V L ++ L++ A++S GQ QRVA+AR +
Sbjct: 94 TVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIEE-LLNRYPAQLSGGQRQRVAVARAIV 152
Query: 59 NEPEVLLLDEPTSALDPISTQNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVN 118
EP+VLL+DEP S LD + + KL++K +T + V+H + + D + ++
Sbjct: 153 VEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNR 212
Query: 119 GEIVEVLKP-DLLSEAKHPMALRFL 142
G+++++ P ++ F+
Sbjct: 213 GQLLQIGSPTEVYLRPNSVFVATFI 237
|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 427 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 100.0 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 100.0 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 100.0 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 100.0 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 100.0 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 100.0 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 100.0 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 100.0 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 100.0 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 100.0 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 100.0 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 100.0 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 100.0 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 100.0 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 100.0 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 100.0 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 100.0 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 100.0 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 100.0 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 99.95 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.83 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 99.67 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 99.41 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 99.04 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 99.0 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 98.51 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 97.05 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 96.51 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.21 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 89.54 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 88.67 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 83.22 |
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Hypothetical protein PH0022, N-terminal domain species: Pyrococcus horikoshii [TaxId: 53953]
Probab=100.00 E-value=3.5e-44 Score=267.01 Aligned_cols=142 Identities=27% Similarity=0.422 Sum_probs=127.3
Q ss_pred ChHHHhhcCccccCCCc--cHHHHHHHHHHcCCChhhhcCCcCCCChhHHHHHHHHHHHhcCCCEEEeeCCCCCCCHHHH
Q 046954 1 TVADNIRYGPQLRGKKL--TENEVYKLLSLADLDSSFLSKTGAEISVGQAQRVALARTLANEPEVLLLDEPTSALDPIST 78 (146)
Q Consensus 1 tv~eni~~~~~~~~~~~--~~~~~~~~l~~~~l~~~~~~~~~~~LSgG~~qrv~ia~al~~~p~llllDEPt~~LD~~~~ 78 (146)
||+||+.++...++.+. .++++.++++.++++ ++.+++|.+|||||||||+|||||+.+|++|||||||+||||.++
T Consensus 94 tv~enl~~~~~~~~~~~~~~~~~~~~~l~~~~l~-~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllDEPts~LD~~~~ 172 (239)
T d1v43a3 94 TVYENIAFPLKIKKFPKDEIDKRVRWAAELLQIE-ELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLR 172 (239)
T ss_dssp CHHHHHHTTCC--CCCHHHHHHHHHHHHHHTTCG-GGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEEESTTTTSCHHHH
T ss_pred hHHHHHHHHHHHcCCCHHHHHHHHHHHHHHcCCh-hhhcCChhhCCHHHHHHHHHHhhhccCCCceeecCCcccCCHHHH
Confidence 79999999887665432 345688999999995 689999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhcCCeEEEEecCHHHHHhhcCeEEEEECCEEEEeeCccccc-cCCCHHHHHHhh
Q 046954 79 QNIEDVLVKLKKKHGMTIVMVSHSIKQIQRIADVVCLLVNGEIVEVLKPDLLS-EAKHPMALRFLQ 143 (146)
Q Consensus 79 ~~~~~~l~~l~~~~g~tvi~itH~~~~~~~~~d~v~~l~~G~i~~~g~~~~~~-~~~~~~~~~~~~ 143 (146)
..+++.|++++++.|+|+|+||||++++.++||||++|++|+|++.|++++++ ++.+++.+.|++
T Consensus 173 ~~i~~ll~~l~~~~g~tii~vTHd~~~a~~~~dri~vm~~G~iv~~G~~~el~~~P~~~~~~~~lg 238 (239)
T d1v43a3 173 VAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIG 238 (239)
T ss_dssp HHHHHHHHHHHHHHTCEEEEEESCHHHHHHHCSEEEEEETTEEEEEECHHHHHHCCSBHHHHHHSS
T ss_pred HHHHHHHHHHHHhcCCeEEEEeCCHHHHHHhCCEEEEEECCEEEEEcCHHHHHhCCCCHHHHHhhC
Confidence 99999999998777999999999999999999999999999999999999986 455677887765
|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|