Citrus Sinensis ID: 047012

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARRLASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPTTIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAGKGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSGGHS
cccccccccccHHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccHHHHHHHHccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccc
cEEEEEcccccHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccEccccccccccccccccccccHHHccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccc
mrimikggvwknTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWyewldpsikktewtrEEDEKLLHLAKLMPtqwrtiapivgrtpsqCLERYEKLLDAACakdenyepgddprklrpgeidpnpeskparpdpvdmdeDEKEMLSEARARLANTRGKKAKRKAREKQLEEARRLASLQKRRELKAAGIDTRQRKrkrrgidynaeipfekkpppgffdvtdedrpvelvsfpttieelegkrrvDIEAQLRRQDIAKNKiaqrqdapsailqanklndpetVRKRsklmlpapqisdhELEEIAKMGYasdliagneeltegsgATRALLANYaqtpqrgmtpsrtpqrtpagkgdAVMMEAENLARMresqtpllggenpelhpsdfsgghs
mrimikggvwkntedEILKAAVMKYGKNQWARISSLLVRKSAKQckarwyewldpsikktewtreEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACakdenyepgddprklrpgeidpnpeskparpdpvdMDEDEKEMLSEARArlantrgkkakrkaREKQLEEARRLaslqkrrelkaagidtrqrkrkrrgidynaeipfekkpppgfFDVTDEDRPVELVSfpttieelegkrrvdieAQLRRQDIAknkiaqrqdapsailqanklndpetvRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYaqtpqrgmtpsrtpqrtpagKGDAVMMEAENLARMRESqtpllggenpelhpsdfsgghs
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGkkakrkarekqleearrlaSLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPTTIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAGKGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSGGHS
***MIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACA*****************************************************************************************************************************ELVSFPTTI************************************************************************Y***LI********************************************************************************
**IMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKL*******************************************DEKEMLSEARARL************************SL************************YNAEIPFEKKPPPGFF************************************************************************LPAPQISDHELEEIAKMG*************************YAQ**************TPAGKGDAVMMEAENLARMRESQTPLLGGENPEL**********
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARL******************EARRLASLQKRRELKAAGI********RRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPTTIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQT*******************DAVMMEAENLARMRESQTPLLGGENPELHP********
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKD*****************************PVDMDEDEKEMLSEARARLANT***KAKRKAREKQLEEARRLASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDR*****SFPT*******KRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEEL**GSGATRA***N*AQTPQRGMTPSRTPQRTPAGKGDAVMMEAENLARMRESQTPLLGGE**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAxxxxxxxxxxxxxxxxxxxxxRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPTTIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAGKGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSGGHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query400 2.2.26 [Sep-21-2011]
P92948 844 Cell division cycle 5-lik yes no 0.992 0.470 0.901 0.0
A7SD85 805 Cell division cycle 5-rel N/A no 0.977 0.485 0.675 1e-140
Q2KJC1 802 Cell division cycle 5-lik yes no 0.975 0.486 0.638 1e-130
Q99459 802 Cell division cycle 5-lik yes no 0.975 0.486 0.635 1e-130
O08837 802 Cell division cycle 5-lik yes no 0.975 0.486 0.635 1e-130
Q6A068 802 Cell division cycle 5-lik yes no 0.975 0.486 0.635 1e-130
P0CO94 838 Pre-mRNA-splicing factor yes no 0.975 0.465 0.602 1e-127
P0CO95 833 Pre-mRNA-splicing factor N/A no 0.962 0.462 0.600 1e-124
Q4P652 820 Pre-mRNA-splicing factor N/A no 0.975 0.475 0.571 1e-118
Q4WHG0 792 Pre-mRNA-splicing factor yes no 0.957 0.483 0.557 1e-113
>sp|P92948|CDC5L_ARATH Cell division cycle 5-like protein OS=Arabidopsis thaliana GN=CDC5 PE=1 SV=2 Back     alignment and function desciption
 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/397 (90%), Positives = 378/397 (95%)

Query: 1   MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60
           MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT
Sbjct: 1   MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60

Query: 61  EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPR 120
           EWTREEDEKLLHLAKL+PTQWRTIAPIVGRTPSQCLERYEKLLDAAC KDENY+  DDPR
Sbjct: 61  EWTREEDEKLLHLAKLLPTQWRTIAPIVGRTPSQCLERYEKLLDAACTKDENYDAADDPR 120

Query: 121 KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR 180
           KLRPGEIDPNPE+KPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR
Sbjct: 121 KLRPGEIDPNPEAKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR 180

Query: 181 LASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPT 240
           LASLQKRRELKAAGID R RKRKR+GIDYNAEIPFEK+ P GF+D  DEDRP + V FPT
Sbjct: 181 LASLQKRRELKAAGIDGRHRKRKRKGIDYNAEIPFEKRAPAGFYDTADEDRPADQVKFPT 240

Query: 241 TIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAP 300
           TIEELEGKRR D+EA LR+QD+A+NKIAQRQDAP+AILQANKLNDPE VRKRSKLMLP P
Sbjct: 241 TIEELEGKRRADVEAHLRKQDVARNKIAQRQDAPAAILQANKLNDPEVVRKRSKLMLPPP 300

Query: 301 QISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAG 360
           QISDHELEEIAKMGYASDL+A NEELTEGS ATRALLANY+QTP++GMTP RTPQRTPAG
Sbjct: 301 QISDHELEEIAKMGYASDLLAENEELTEGSAATRALLANYSQTPRQGMTPMRTPQRTPAG 360

Query: 361 KGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSG 397
           KGDA+MMEAENLAR+R+SQTPLLGGENPELHPSDF+G
Sbjct: 361 KGDAIMMEAENLARLRDSQTPLLGGENPELHPSDFTG 397
Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control.
Arabidopsis thaliana (taxid: 3702)
>sp|A7SD85|CDC5L_NEMVE Cell division cycle 5-related protein OS=Nematostella vectensis GN=cdc5l PE=3 SV=1 Back     alignment and function description
>sp|Q2KJC1|CDC5L_BOVIN Cell division cycle 5-like protein OS=Bos taurus GN=CDC5L PE=2 SV=1 Back     alignment and function description
>sp|Q99459|CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens GN=CDC5L PE=1 SV=2 Back     alignment and function description
>sp|O08837|CDC5L_RAT Cell division cycle 5-like protein OS=Rattus norvegicus GN=Cdc5l PE=1 SV=2 Back     alignment and function description
>sp|Q6A068|CDC5L_MOUSE Cell division cycle 5-like protein OS=Mus musculus GN=Cdc5l PE=1 SV=2 Back     alignment and function description
>sp|P0CO94|CEF1_CRYNJ Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CEF1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO95|CEF1_CRYNB Pre-mRNA-splicing factor CEF1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CEF1 PE=3 SV=1 Back     alignment and function description
>sp|Q4P652|CEF1_USTMA Pre-mRNA-splicing factor CEF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CEF1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WHG0|CEF1_ASPFU Pre-mRNA-splicing factor cef1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cef1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
255561929 1049 cell division control protein, putative 0.992 0.378 0.957 0.0
449449655 1010 PREDICTED: cell division cycle 5-like pr 0.992 0.393 0.949 0.0
225453042 1012 PREDICTED: cell division cycle 5-like pr 0.992 0.392 0.949 0.0
356576678 963 PREDICTED: cell division cycle 5-like pr 0.99 0.411 0.931 0.0
224123540 846 predicted protein [Populus trichocarpa] 0.992 0.469 0.921 0.0
356535202 962 PREDICTED: cell division cycle 5-like pr 0.99 0.411 0.924 0.0
399950070 674 R2R3 MYB CDC5-like protein, partial [Iri 0.99 0.587 0.926 0.0
15218276 844 cell division cycle 5-like protein [Arab 0.992 0.470 0.901 0.0
1747310 844 Myb-like DNA binding protein [Arabidopsi 0.992 0.470 0.901 0.0
297843776 844 MYB transcription factor [Arabidopsis ly 0.992 0.470 0.901 0.0
>gi|255561929|ref|XP_002521973.1| cell division control protein, putative [Ricinus communis] gi|223538777|gb|EEF40377.1| cell division control protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/397 (95%), Positives = 389/397 (97%)

Query: 1   MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60
           MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT
Sbjct: 1   MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60

Query: 61  EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPR 120
           EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAAC KD+NYEPGDDPR
Sbjct: 61  EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACVKDDNYEPGDDPR 120

Query: 121 KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR 180
           KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR
Sbjct: 121 KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR 180

Query: 181 LASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPT 240
           LASLQKRRELKAAGIDTRQRKRKR+GIDYNAEIPFEK+PPPGFFDV DED  VE   FPT
Sbjct: 181 LASLQKRRELKAAGIDTRQRKRKRKGIDYNAEIPFEKRPPPGFFDVADEDSSVEQPKFPT 240

Query: 241 TIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAP 300
           TIEELEGKRRVDIEAQLR+QDIAKNKIAQRQDAPSAILQANK+NDPETVRKRSKLMLPAP
Sbjct: 241 TIEELEGKRRVDIEAQLRKQDIAKNKIAQRQDAPSAILQANKMNDPETVRKRSKLMLPAP 300

Query: 301 QISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAG 360
           QISDHELEEIAKMGYASDLIAG+EELTEGSGATRALLANYAQTPQ+GMTP RTPQRTPAG
Sbjct: 301 QISDHELEEIAKMGYASDLIAGSEELTEGSGATRALLANYAQTPQQGMTPLRTPQRTPAG 360

Query: 361 KGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSG 397
           KGDA+MMEAENLAR+RESQTPLLGGENPELHPSDFSG
Sbjct: 361 KGDAIMMEAENLARLRESQTPLLGGENPELHPSDFSG 397

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449449655|ref|XP_004142580.1| PREDICTED: cell division cycle 5-like protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|225453042|ref|XP_002265478.1| PREDICTED: cell division cycle 5-like protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|356576678|ref|XP_003556457.1| PREDICTED: cell division cycle 5-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|224123540|ref|XP_002319105.1| predicted protein [Populus trichocarpa] gi|222857481|gb|EEE95028.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356535202|ref|XP_003536137.1| PREDICTED: cell division cycle 5-like protein-like [Glycine max] Back     alignment and taxonomy information
>gi|399950070|gb|AFP65720.1| R2R3 MYB CDC5-like protein, partial [Iris fulva] Back     alignment and taxonomy information
>gi|15218276|ref|NP_172448.1| cell division cycle 5-like protein [Arabidopsis thaliana] gi|288561907|sp|P92948.2|CDC5L_ARATH RecName: Full=Cell division cycle 5-like protein; Short=Cdc5-like protein; AltName: Full=Atypical R2R3-MYB transcription factor CDC5; AltName: Full=MOS4-associated complex protein 1; Short=MAC protein 1; AltName: Full=Protein MYB DOMAIN CELL DIVISION CYCLE 5; Short=AtMYBCD5 gi|2160167|gb|AAB60730.1| Identical to A. thaliana Myb-like protein (gb|D58424) [Arabidopsis thaliana] gi|20260316|gb|AAM13056.1| putative Myb DNA-binding protein [Arabidopsis thaliana] gi|31711768|gb|AAP68240.1| At1g09770 [Arabidopsis thaliana] gi|332190369|gb|AEE28490.1| cell division cycle 5-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|1747310|dbj|BAA09598.1| Myb-like DNA binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843776|ref|XP_002889769.1| MYB transcription factor [Arabidopsis lyrata subsp. lyrata] gi|297335611|gb|EFH66028.1| MYB transcription factor [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query400
TAIR|locus:2024336 844 CDC5 "cell division cycle 5" [ 0.992 0.470 0.853 1.2e-184
MGI|MGI:1918952 802 Cdc5l "cell division cycle 5-l 0.975 0.486 0.587 2.2e-118
RGD|70892 802 Cdc5l "cell division cycle 5-l 0.975 0.486 0.587 2.2e-118
ZFIN|ZDB-GENE-040426-821 801 cdc5l "CDC5 cell division cycl 0.975 0.486 0.600 3.3e-118
UNIPROTKB|E1BWQ5 806 CDC5L "Uncharacterized protein 0.975 0.483 0.588 8.8e-118
UNIPROTKB|Q2KJC1 802 CDC5L "Cell division cycle 5-l 0.975 0.486 0.590 3.8e-117
UNIPROTKB|E2RLP4 802 CDC5L "Uncharacterized protein 0.975 0.486 0.590 3.8e-117
UNIPROTKB|Q99459 802 CDC5L "Cell division cycle 5-l 0.975 0.486 0.587 6.2e-117
UNIPROTKB|E1C6A9 807 CDC5L "Uncharacterized protein 0.975 0.483 0.584 2.1e-116
UNIPROTKB|F1RQS5 803 CDC5L "Uncharacterized protein 0.975 0.485 0.588 3.4e-116
TAIR|locus:2024336 CDC5 "cell division cycle 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1791 (635.5 bits), Expect = 1.2e-184, P = 1.2e-184
 Identities = 339/397 (85%), Positives = 359/397 (90%)

Query:     1 MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60
             MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT
Sbjct:     1 MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60

Query:    61 EWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPR 120
             EWTREEDEKLLHLAKL+PTQWRTIAPIVGRTPSQCLERYEKLLDAAC KDENY+  DDPR
Sbjct:    61 EWTREEDEKLLHLAKLLPTQWRTIAPIVGRTPSQCLERYEKLLDAACTKDENYDAADDPR 120

Query:   121 KLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGXXXXXXXXXXXXXXXXX 180
             KLRPGEIDPNPE+KPARPDPVDMDEDEKEMLSEARARLANTRG                 
Sbjct:   121 KLRPGEIDPNPEAKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEARR 180

Query:   181 XXSLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPT 240
               SLQKRRELKAAGID R RKRKR+GIDYNAEIPFEK+ P GF+D  DEDRP + V FPT
Sbjct:   181 LASLQKRRELKAAGIDGRHRKRKRKGIDYNAEIPFEKRAPAGFYDTADEDRPADQVKFPT 240

Query:   241 TIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAP 300
             TIEELEGKRR D+EA LR+QD+A+NKIAQRQDAP+AILQANKLNDPE VRKRSKLMLP P
Sbjct:   241 TIEELEGKRRADVEAHLRKQDVARNKIAQRQDAPAAILQANKLNDPEVVRKRSKLMLPPP 300

Query:   301 QISDHELEEIAKMGYASDLIAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAG 360
             QISDHELEEIAKMGYASDL+A NEELTEGS ATRALLANY+QTP++GMTP RTPQRTPAG
Sbjct:   301 QISDHELEEIAKMGYASDLLAENEELTEGSAATRALLANYSQTPRQGMTPMRTPQRTPAG 360

Query:   361 KGDAVMMEAENLARMRESQTPLLGGENPELHPSDFSG 397
             KGDA+MMEAENLAR+R+SQTPLLGGENPELHPSDF+G
Sbjct:   361 KGDAIMMEAENLARLRDSQTPLLGGENPELHPSDFTG 397
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0009507 "chloroplast" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009870 "defense response signaling pathway, resistance gene-dependent" evidence=IMP
GO:0010204 "defense response signaling pathway, resistance gene-independent" evidence=IMP
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0050832 "defense response to fungus" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
MGI|MGI:1918952 Cdc5l "cell division cycle 5-like (S. pombe)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|70892 Cdc5l "cell division cycle 5-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-821 cdc5l "CDC5 cell division cycle 5-like (S. pombe)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWQ5 CDC5L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJC1 CDC5L "Cell division cycle 5-like protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLP4 CDC5L "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99459 CDC5L "Cell division cycle 5-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6A9 CDC5L "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQS5 CDC5L "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P92948CDC5L_ARATHNo assigned EC number0.90170.99250.4703yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 8e-51
cd1165953 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding d 7e-30
pfam11831 363 pfam11831, Myb_Cef, pre-mRNA splicing factor compo 3e-14
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-12
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 5e-11
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 8e-11
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 2e-09
PLN03091459 PLN03091, PLN03091, hypothetical protein; Provisio 4e-08
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-07
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-06
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-06
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 3e-04
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information 
 Score =  177 bits (451), Expect = 8e-51
 Identities = 83/232 (35%), Positives = 115/232 (49%), Gaps = 13/232 (5%)

Query: 1   MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKT 60
           M+   KGG WK TEDE LKA V K G N W++++SLL+  + KQ   RW   L+P +KK 
Sbjct: 14  MQTKRKGGSWKRTEDEDLKALVKKLGPNNWSKVASLLISSTGKQSSNRWNNHLNPQLKKK 73

Query: 61  EWTREEDEKLLHLAKLMPTQWRTIAPIV-GRTPSQCLERYEKLLDAACAKDENYEPGDDP 119
            W+ EEDE+L+ L K + TQW TIA     RT  QC+ERY   L+   +           
Sbjct: 74  NWSEEEDEQLIDLDKELGTQWSTIADYKDRRTAQQCVERYVNTLEDLSST----HDSKLQ 129

Query: 120 RKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANTRGKKAKRKAREKQLEEAR 179
           R+    +IDP  E+   RPD  + +  E+E+  EA  RL   R  KA  K REK  E   
Sbjct: 130 RRNEFDKIDPFNENSARRPDIYEDELLEREVNREASYRLRVPRVSKADVKPREKGEENNP 189

Query: 180 RLASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDR 231
            +  LQ+ +ELK+A I        +  I+        K    G     +++ 
Sbjct: 190 DIEDLQEMKELKSASITRHLILPSKSEIN--------KAFKKGETLALEQEI 233

Length = 512
>gnl|CDD|212557 cd11659, SANT_CDC5_II, SANT/myb-like DNA-binding domain of Cell Division Cycle 5-Like Protein repeat II Back     alignment and domain information
>gnl|CDD|221250 pfam11831, Myb_Cef, pre-mRNA splicing factor component Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 400
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 100.0
PLN03091459 hypothetical protein; Provisional 99.95
PLN03212249 Transcription repressor MYB5; Provisional 99.95
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.93
PLN03212249 Transcription repressor MYB5; Provisional 99.92
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.91
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.89
PLN03091 459 hypothetical protein; Provisional 99.89
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.83
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.77
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.62
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.4
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.34
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.32
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.29
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.22
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.07
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.03
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.94
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.92
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.87
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.77
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.81
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.39
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 96.79
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.77
KOG1279506 consensus Chromatin remodeling factor subunit and 96.63
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 96.63
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 96.6
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.55
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 95.79
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.43
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.41
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.27
KOG1279506 consensus Chromatin remodeling factor subunit and 95.15
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 94.97
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.55
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 94.38
PRK13923170 putative spore coat protein regulator protein YlbO 94.19
PRK13923170 putative spore coat protein regulator protein YlbO 94.09
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 94.02
PLN031421033 Probable chromatin-remodeling complex ATPase chain 93.72
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 92.6
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 91.61
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.15
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 85.94
KOG4167907 consensus Predicted DNA-binding protein, contains 85.19
KOG4282345 consensus Transcription factor GT-2 and related pr 84.22
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 83.6
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=6.4e-83  Score=648.41  Aligned_cols=383  Identities=54%  Similarity=0.740  Sum_probs=359.3

Q ss_pred             CCCcccCCCCCHHHHHHHHHHHHHhCCCChhHHHHHhcccchhhhhhhhhccCCCCCCcCCCCHHHHHHHHHHHHhCCCC
Q 047012            1 MRIMIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPTQ   80 (400)
Q Consensus         1 Mr~~lKkG~WT~EEDe~L~~aV~kyG~~~W~~IA~~L~~RS~~QCr~RW~~~L~p~lkkg~WT~EEDekLl~lv~~~G~~   80 (400)
                      |++.+|+|+|++.||++|+.+|++||.++|++|+++++.++++||+.||..||+|.+++..||.+||++|++++..++.+
T Consensus         1 ~~i~~kggvwrntEdeilkaav~kyg~nqws~i~sll~~kt~rqC~~rw~e~ldp~i~~tews~eederlLhlakl~p~q   80 (617)
T KOG0050|consen    1 MRIEIKGGVWRNTEDEVLKAAVMKYGKNQWSRIASLLNRKTARQCKARWEEWLDPAIKKTEWSREEDERLLHLAKLEPTQ   80 (617)
T ss_pred             CceEEecceecccHHHHHHHHHHHcchHHHHHHHHHHhhcchhHHHHHHHHHhCHHHhhhhhhhhHHHHHHHHHHhcCCc
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCChHHHHHHHHHHHhHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHhcC
Q 047012           81 WRTIAPIVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLAN  160 (400)
Q Consensus        81 W~~IA~l~GRT~~QCr~Rw~~lL~~~i~k~~~~~~~~d~~~Lr~gei~p~peskpa~pd~~d~teeE~emL~ea~arlgn  160 (400)
                      |..|+.++|||+.||.+||+++|+..+.......+.+|++ |++|+++|+|++++++||++||+++|.+||++|+++|+|
T Consensus        81 wrtIa~i~gr~~~qc~eRy~~ll~~~~s~~~~~~~~~D~r-Lk~gE~ePn~e~~~aRpd~~dmdEde~eMl~eaRarlaN  159 (617)
T KOG0050|consen   81 WRTIADIMGRTSQQCLERYNNLLDVYVSYHYHSEPYIDAK-LKEGEIEPNQETNPARPDGFDMDEDEGEMLSEARARLAN  159 (617)
T ss_pred             cchHHHHhhhhHHHHHHHHHHHHHHHHhhhcccccccccc-cCCCcCCCccccccccCCcccchHHHHHHHHHHHHHHhc
Confidence            9999999999999999999999999998887777888999 999999999999999999999999999999999999999


Q ss_pred             chhHHhcCcCCchHHHHHHHHHHHHhHHHHHHcCCChhHhhhhccCCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCCc
Q 047012          161 TRGKKAKRKAREKQLEEARRLASLQKRRELKAAGIDTRQRKRKRRGIDYNAEIPFEKKPPPGFFDVTDEDRPVELVSFPT  240 (400)
Q Consensus       161 ~w~kiAkrk~R~~~~~k~r~~a~LqKrrelk~aGi~~~~~~~k~~~~d~n~~ip~e~~p~~g~~d~~~e~~~~~~~~f~~  240 (400)
                      ++|++|+|+.|++++++.++.+.|||||||++|||.+..++++++.||||++|||++.|++|||||++|+.......|..
T Consensus       160 t~gkka~Rk~reK~l~e~~r~~~lqkrrelraagi~~~~rkr~~~~Idyn~~ipfek~p~~gfydts~e~~~i~~~~f~~  239 (617)
T KOG0050|consen  160 TQGKKAKRKLREKQLEEPRRGAPLQKRRELRAAGILRTTRKRLSHLIDYNISIPFEKPPWNGFYDTSLEGYVILHNHFCS  239 (617)
T ss_pred             ccchHHHHHHHHHHHhhccCCccchhHHHHHhhhhhHHhHhhhhccCCcccccccccCCcccccccchhhhhhhhhhhhH
Confidence            99999999999999999999999999999999999999889999999999999999999999999999999988888854


Q ss_pred             -chHHhhccchhHHHHHHhhhHHHHHhHHhhhCcHHHHHHHhhcCCcchhcccCCCCCCCCCCChHHHHHHHHhchhhhh
Q 047012          241 -TIEELEGKRRVDIEAQLRRQDIAKNKIAQRQDAPSAILQANKLNDPETVRKRSKLMLPAPQISDHELEEIAKMGYASDL  319 (400)
Q Consensus       241 -~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~l~lp~p~~~~~~~~~~~~~~~~~~~  319 (400)
                       ++..++|.+..+.|...++.|+++.+..++++.+.++.+...      ..||+||+||+||||+.||+.+||+|.|++.
T Consensus       240 ~~~~~~eg~r~~d~E~~~r~~dk~~~~r~ke~~e~sa~~~~~~------~~Kr~klilpap~Is~~el~~~vK~g~A~~~  313 (617)
T KOG0050|consen  240 VDIKVSEGLRVIDDEGSARTSDKEGVSREREHEEISAFIPDLG------SYKRDKLILPAPDISWRELRLFVKFGSALLR  313 (617)
T ss_pred             HHHHHhhhhhccccchhhhccccccchhhhhcchhhhhhhhcc------hhccccccCCCCcccHHHHHHHHhcccHHHH
Confidence             688899999999999999999988888888888888766543      6899999999999999999999999999999


Q ss_pred             hhcccccccCchhhHHhhhcccCCCCCCCCCCCCCCCCCCCCcchHHHHHHHHHHHhhcCCCCCCCCCCCCCCCCCC
Q 047012          320 IAGNEELTEGSGATRALLANYAQTPQRGMTPSRTPQRTPAGKGDAVMMEAENLARMRESQTPLLGGENPELHPSDFS  396 (400)
Q Consensus       320 ~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~t~~~~~~~~~d~~~~ea~n~~~~~~~~t~l~g~~n~~l~~~~~~  396 (400)
                      ++... . .+ .....||++|+.+  +.+++.||| ++|+...|+|+.||||++++++++|||+||.|+|||+|+|+
T Consensus       314 ~R~~~-~-T~-~~~~~ll~dy~~r--~~av~~rt~-~~~~lk~d~~~ieaqn~~~~~~tk~~l~G~~~~~lh~S~~~  384 (617)
T KOG0050|consen  314 SRFIQ-I-TK-VYGIRLLKDYIFR--NLAVDCRTK-VKDRLKDDVNKIEAQNSTRRRSTKELLEGDYGSKLHRSCRG  384 (617)
T ss_pred             HHHHH-h-cc-chhhhHHHhhhhh--ccccccccc-cCccccchHHHHHHHHHHhhcCccccccCCCCCCcCcccCC
Confidence            98764 2 22 2348899999864  457789997 68887789999999999999999999999999999999986

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
2dim_A70 Solution Structure Of The Myb_dna-Binding Domain Of 2e-24
2din_A66 Solution Structure Of The Myb_dna-Binding Domain Of 9e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 3e-12
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-10
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 3e-10
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 4e-10
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 6e-10
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 8e-10
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 5e-09
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 7e-07
>pdb|2DIM|A Chain A, Solution Structure Of The Myb_dna-Binding Domain Of Human Cell Division Cycle 5-Like Protein Length = 70 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 50/55 (90%), Positives = 54/55 (98%)
Query: 9  VWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWT 63
          VW+NTEDEILKAAVMKYGKNQW+RI+SLL RKSAKQCKARWYEWLDPSIKKTEW+
Sbjct: 11 VWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWS 65
>pdb|2DIN|A Chain A, Solution Structure Of The Myb_dna-Binding Domain Of Human Cell Division Cycle 5-Like Protein Length = 66 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query400
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-30
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-08
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-29
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 1e-09
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 3e-24
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 7e-24
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 8e-22
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 8e-07
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 7e-04
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 6e-21
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 9e-08
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 9e-05
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 4e-19
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 2e-13
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-18
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 2e-18
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-11
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 4e-10
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 5e-11
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-10
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 2e-09
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 9e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-08
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 5e-04
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-07
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 2e-07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 3e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 4e-06
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 4e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 8e-06
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 6e-04
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-05
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 5e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-05
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 9e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 4e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 8e-05
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 5e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 8e-05
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 6e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 1e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-04
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
 Score =  109 bits (273), Expect = 6e-30
 Identities = 44/63 (69%), Positives = 49/63 (77%)

Query: 54  DPSIKKTEWTREEDEKLLHLAKLMPTQWRTIAPIVGRTPSQCLERYEKLLDAACAKDENY 113
             S KKTEW+REE+EKLLHLAKLMPTQWRTIAPI+GRT +QCLE YE LLD A  +D   
Sbjct: 4   GSSGKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDSGP 63

Query: 114 EPG 116
             G
Sbjct: 64  SSG 66
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.97
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.96
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.96
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.96
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.94
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.91
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.9
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.9
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.9
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.81
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.65
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.63
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.62
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.62
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.61
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.59
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.56
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.56
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.56
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.54
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.54
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.54
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.52
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.52
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.49
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.49
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.48
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.46
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.46
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.46
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.44
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.44
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.44
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.43
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.42
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.4
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.37
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.36
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.31
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.92
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.24
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.23
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.22
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.16
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.78
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.15
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.13
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.12
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.1
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.91
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.84
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.75
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.73
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.56
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.55
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.49
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.47
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.45
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.32
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.28
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.24
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.16
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.12
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.91
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.89
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.85
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.82
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.48
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.47
2crg_A70 Metastasis associated protein MTA3; transcription 97.45
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.39
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.37
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.23
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.13
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.75
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.72
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.5
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.48
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.46
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.36
2crg_A70 Metastasis associated protein MTA3; transcription 96.25
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.25
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.07
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.36
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.01
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.32
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.79
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.86
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 84.28
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 83.52
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=2.3e-40  Score=296.20  Aligned_cols=153  Identities=29%  Similarity=0.561  Sum_probs=107.4

Q ss_pred             cccCCCCCHHHHHHHHHHHHHhCCCChhHHHHHhcccchhhhhhhhhccCCCCCCcCCCCHHHHHHHHHHHHhCCC-Ccc
Q 047012            4 MIKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPSIKKTEWTREEDEKLLHLAKLMPT-QWR   82 (400)
Q Consensus         4 ~lKkG~WT~EEDe~L~~aV~kyG~~~W~~IA~~L~~RS~~QCr~RW~~~L~p~lkkg~WT~EEDekLl~lv~~~G~-~W~   82 (400)
                      .+++|+||+|||++|+.+|.+||.++|..||..|++|++.||+.||.++|+|.+++++||+|||++|+.+|..||. +|.
T Consensus         3 ~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W~   82 (159)
T 1h89_C            3 HLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWS   82 (159)
T ss_dssp             ----------------------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCCCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccHH
Confidence            4788999999999999999999988999999999999999999999999999999999999999999999999995 799


Q ss_pred             cccc-cCCCChHHHHHHHHHHHhHhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHhcCc
Q 047012           83 TIAP-IVGRTPSQCLERYEKLLDAACAKDENYEPGDDPRKLRPGEIDPNPESKPARPDPVDMDEDEKEMLSEARARLANT  161 (400)
Q Consensus        83 ~IA~-l~GRT~~QCr~Rw~~lL~~~i~k~~~~~~~~d~~~Lr~gei~p~peskpa~pd~~d~teeE~emL~ea~arlgn~  161 (400)
                      .||. ++|||+.||++||.++|+|.+++++                               ||++|+++|.+++..+|+.
T Consensus        83 ~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~-------------------------------WT~eEd~~L~~~~~~~g~~  131 (159)
T 1h89_C           83 VIAKHLKGRIGKQCRERWHNHLNPEVKKTS-------------------------------WTEEEDRIIYQAHKRLGNR  131 (159)
T ss_dssp             HHHHTSTTCCHHHHHHHHHHTTCTTSCCSC-------------------------------CCHHHHHHHHHHHHHHCSC
T ss_pred             HHHHHcCCCCHHHHHHHHHHHhCccccccC-------------------------------CChHHHHHHHHHHHHHCCC
Confidence            9999 7899999999999999999887765                               9999999999999999999


Q ss_pred             hhHHhcC-cCCchHHHHHHHHHHHHhH
Q 047012          162 RGKKAKR-KAREKQLEEARRLASLQKR  187 (400)
Q Consensus       162 w~kiAkr-k~R~~~~~k~r~~a~LqKr  187 (400)
                      |.+||+. +||+++.++|||+.+|+++
T Consensus       132 W~~Ia~~l~gRt~~~~knr~~~~~r~~  158 (159)
T 1h89_C          132 WAEIAKLLPGRTDNAIKNHWNSTMRRK  158 (159)
T ss_dssp             HHHHHTTSTTCCHHHHHHHHHTTTCC-
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            9999999 8999999999999888765
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 400
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-13
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-04
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 5e-11
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-07
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-11
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-10
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-06
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 5e-08
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 5e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 2e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 9e-08
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 9e-06
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-07
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 0.002
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-07
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-05
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 7e-07
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-05
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 2e-06
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-06
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 8e-06
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 2e-06
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-06
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 1e-04
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 0.003
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 61.5 bits (149), Expect = 9e-13
 Identities = 11/79 (13%), Positives = 28/79 (35%), Gaps = 6/79 (7%)

Query: 8  GVWKNTEDEILKAAVMKYGKNQ-----WARISSLLVRKSAKQCKARWYEWLDPSIKKTEW 62
            + + EDE +   V K    +     +  IS  +   +    + R+  +L   ++    
Sbjct: 2  ASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYE 61

Query: 63 TREEDEKLLHL-AKLMPTQ 80
            +  + +      L+ T+
Sbjct: 62 VDKFGKLVRDDDGNLIKTK 80
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query400
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.67
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.66
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.57
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.51
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.48
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.47
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.46
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.45
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.41
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.38
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.38
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.37
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.3
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.27
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.25
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.23
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.21
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.2
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.2
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.14
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.08
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.95
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.92
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.87
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.85
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.81
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.52
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.99
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.94
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.67
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.46
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.14
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.83
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.3
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 95.18
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.03
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 93.54
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 92.09
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 91.85
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 81.56
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 80.54
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.67  E-value=1.9e-17  Score=121.37  Aligned_cols=52  Identities=37%  Similarity=0.764  Sum_probs=49.9

Q ss_pred             ccCCCCCHHHHHHHHHHHHHhCCCChhHHHHHhcccchhhhhhhhhccCCCC
Q 047012            5 IKGGVWKNTEDEILKAAVMKYGKNQWARISSLLVRKSAKQCKARWYEWLDPS   56 (400)
Q Consensus         5 lKkG~WT~EEDe~L~~aV~kyG~~~W~~IA~~L~~RS~~QCr~RW~~~L~p~   56 (400)
                      |++|+||++||++|+.+|.+||.++|..||..|++||+.||++||.++|+|.
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTSTTCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHhhCCCC
Confidence            5789999999999999999999889999999999999999999999999984
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure