Citrus Sinensis ID: 047027

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLPLLDNGQPSPPAALK
cEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEEcccHHHHHHccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEccHHHHHHHHHHccccEEEEEcccEEEEccccccccccEEEEEEEcccccccccccccccccccEEEEcccccccccccHHHcccccccEEEccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccccccccccccEEccccccccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccEEEEcccccccEEcccccHHHHHHHHccccccccccccccEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccccccc
cEEEEcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHcccccccccccEEEEEEccHHHHHHHcccccEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccHHHHHEcHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEHHHHHHHHHHHHccccEEEEEccccccccccccccccccEEEEEccccccccccHccccccccEEEEEccccccccccHHHHHcccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHccccccccccHHHHHHHHHHccccccccHHHcccccccccccccccccHccccccccHHHccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccHHcccccccccccccccccccccccccccccEEEEcccHcHccccccccccccccccEEEEcccccHHccccccccHHHcccccccccc
iwvtvsqpldlFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDdtweafpleevgipepneengckLVITTRshtvcrsmKCKQVVVELLSKQEAFNLFIDGvgnsilqvpaLNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLvrsrngvnadVLGRLEFSYHRLKDEKLQQCFLYCalypedfaipkdeLIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLlesaedgscvkMHDLIRDMALRITSESPLFMVKAGLRllkfpgeqeWEENLERVSLMRNNieeipsnmsphcEILSTLLLQRNGllqripecfFVHMHGlkvlnlsrtnievlpssvsdLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDleatgieevpEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRldsfeghffklkdfniyvksadgrgskdyclwlsasgkrrflthlipknYTHLEKLYKHKSVCLFACKicereepivlpedvqflqmnrvhdvaslndvlpreqglvnigkfshdLKVIRFIYCGnlknlfslrllpalqnlevlkvegcdsieeivavddeetekelatntivntvtlprlkklrfsklpefksvcsnngvlvcnslqeikvygcpklkrlslslplldngqpsppaalk
iwvtvsqpldlfkLQTEIATAlkqsllenedkVRRAGRLLGMLKAKEKFVLILDDTWEAFPLeevgipepneengCKLVITTrshtvcrsMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIvavddeetekelatntivntvtlprlkklrfsklpefksvcsnngvlVCNSLQEIKVYGCPKLKRLSlslplldngqpsppaalk
IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHlylylpllkkfpaalRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCpklkrlslslpllDNGQPSPPAALK
*WVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLP**************
IWVTVSQPLDLFKLQTEIATALK***************LLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELR***********DVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETE*******IVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSL********SPPA***
IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLPLLDNG*********
IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLPLLDNGQPSP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEGCDSIEEIVAVDDEETEKELATNTIVNTVTLPRLKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLPLLDNGQPSPPAALK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query692 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.929 0.699 0.284 2e-67
Q42484909 Disease resistance protei no no 0.926 0.705 0.3 2e-67
Q9T048985 Disease resistance protei no no 0.648 0.455 0.368 2e-66
O82484892 Putative disease resistan no no 0.576 0.447 0.370 2e-63
Q8RXS5888 Probable disease resistan no no 0.898 0.700 0.307 2e-63
Q9FG91848 Probable disease resistan no no 0.606 0.495 0.395 3e-63
P60838894 Probable disease resistan no no 0.585 0.453 0.371 7e-63
Q940K0889 Probable disease resistan no no 0.573 0.446 0.361 1e-62
Q8L3R3885 Disease resistance protei no no 0.576 0.450 0.370 4e-61
O64973889 Disease resistance protei no no 0.566 0.440 0.353 1e-60
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  257 bits (657), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 215/755 (28%), Positives = 362/755 (47%), Gaps = 112/755 (14%)

Query: 1   IWVTVSQPLDLFKLQTEIATALKQSLLE---NEDKVRRAGRLLGMLKAKEKFVLILDDTW 57
           IWVTVS+  DL ++Q +IA  L +       N+  +    RL+ +    + F+LILDD W
Sbjct: 171 IWVTVSKDFDLKRVQMDIAKRLGKRFTREQMNQLGLTICERLIDL----KNFLLILDDVW 226

Query: 58  EAFPLEEVGIPEPNEEN-GCKLVITTRSHTVCRSMKCKQ-VVVELLSKQEAFNLFIDGVG 115
               L+++GIP   E +   K+V+T+R   VC+ M   + + V  L ++EA+ LF   VG
Sbjct: 227 HPIDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVG 286

Query: 116 NSILQVPALN--KEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSR 173
               +V   +  K I  +V  EC  LPLAI+T+  ++ G+ ++  W++ LN L+   RS 
Sbjct: 287 ----EVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLK---RSA 339

Query: 174 NGVNAD--VLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVK 231
             ++ +  + G L+ SY  L+D  ++ CFL+CAL+PED++I   ELI YW+AEG ++   
Sbjct: 340 PSIDTEEKIFGTLKLSYDFLQD-NMKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQH 398

Query: 232 DVQAKYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALR-ITSESPLF--MVKAGL 288
             +   + G T++ RL + CLLE  +    VKMHD++RD A+  ++S+   F  +V AG 
Sbjct: 399 HYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGR 458

Query: 289 RLLKFPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVH 348
            L++FP + ++  +++RVSLM N +E +P+N+    E L  LLLQ N  ++ +P  F   
Sbjct: 459 GLIEFP-QDKFVSSVQRVSLMANKLERLPNNVIEGVETL-VLLLQGNSHVKEVPNGFLQA 516

Query: 349 MHGLKVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGI 408
              L++L+LS   I  LP S S+L +LRSL+L  C +L+ +PS+  L+ LQ+LDL  + I
Sbjct: 517 FPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAI 576

Query: 409 EEVPEGMEMLENLSHLYLYLPL-LKKFPAAL----------------------------R 439
            E+P G+E L +L ++ +     L+  PA                              +
Sbjct: 577 RELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIKGEEREGQ 636

Query: 440 ETVEEAA----------------SLSDRLDSFEGHFFKLKDFNIYVKSADGRGSKDYCLW 483
            T++E                  S S   DS      K +     ++S    G+ + CL 
Sbjct: 637 ATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPGTGEGCLA 696

Query: 484 LSASGKRRFLTHLIPKNYTHLEKLYKHKSVCLFACKICEREEPIVLPEDVQ---FLQMNR 540
           +S           + ++ T L+  Y      +F   + + +   V  + +    F  ++ 
Sbjct: 697 ISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALSIHYFPSLSL 756

Query: 541 VHDVASLNDVLPREQGLVNIGKFSHDLKVIRFIYCGNLKNLFSLRLLPALQNLEVLKVEG 600
                S  D+ P      N+ + S D   +     G L     +R    LQ L++L+V G
Sbjct: 757 ASGCESQLDLFP------NLEELSLD--NVNLESIGELNGFLGMR----LQKLKLLQVSG 804

Query: 601 CDSIEEIVAVDDEETEKELATNTIVNTVT----------------------LPRLKKLRF 638
           C  ++ + +  D+     L     +  V+                      LP+L  ++ 
Sbjct: 805 CRQLKRLFS--DQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESLLPKLTVIKL 862

Query: 639 SKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRL 673
             LP+ +S+C++  VL   SL+ ++V  C  LK L
Sbjct: 863 KYLPQLRSLCNDRVVL--ESLEHLEVESCESLKNL 895
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|O82484|DRL23_ARATH Putative disease resistance protein At4g10780 OS=Arabidopsis thaliana GN=At4g10780 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description
>sp|Q9FG91|DRL32_ARATH Probable disease resistance protein At5g43730 OS=Arabidopsis thaliana GN=At5g43730 PE=2 SV=1 Back     alignment and function description
>sp|P60838|DRL1_ARATH Probable disease resistance protein At1g12280 OS=Arabidopsis thaliana GN=At1g12280 PE=3 SV=1 Back     alignment and function description
>sp|Q940K0|DRL15_ARATH Probable disease resistance protein At1g61180 OS=Arabidopsis thaliana GN=At1g61180 PE=2 SV=2 Back     alignment and function description
>sp|Q8L3R3|RFL1_ARATH Disease resistance protein RFL1 OS=Arabidopsis thaliana GN=RFL1 PE=3 SV=2 Back     alignment and function description
>sp|O64973|RPS5_ARATH Disease resistance protein RPS5 OS=Arabidopsis thaliana GN=RPS5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
224128410 1075 BED finger-nbs-lrr resistance protein [P 0.965 0.621 0.408 1e-130
224112395 1062 nbs-lrr resistance protein [Populus tric 0.972 0.633 0.402 1e-127
224117250 958 nbs-lrr resistance protein [Populus tric 0.969 0.700 0.403 1e-127
224115986 1093 BED finger-nbs-lrr resistance protein [P 0.962 0.609 0.412 1e-126
224128424 954 BED finger-nbs-lrr resistance protein [P 0.953 0.691 0.402 1e-125
224105081 957 nbs-lrr resistance protein [Populus tric 0.962 0.695 0.424 1e-124
356542242 962 PREDICTED: probable disease resistance p 0.945 0.679 0.380 1e-119
224109372 1077 BED finger-nbs-lrr resistance protein [P 0.960 0.617 0.392 1e-119
224145639 1010 BED finger-nbs-lrr resistance protein [P 0.968 0.663 0.381 1e-119
224112383 926 nbs-lrr resistance protein [Populus tric 0.949 0.709 0.403 1e-119
>gi|224128410|ref|XP_002329155.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869824|gb|EEF06955.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 315/772 (40%), Positives = 418/772 (54%), Gaps = 104/772 (13%)

Query: 1    IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAF 60
             WVTVSQ   + KLQ  IA A+   L   ED+ +RA +L   L AK K VLILDD W  F
Sbjct: 281  FWVTVSQNFTISKLQYLIAKAINLDLSNEEDEKKRAAKLSKALVAKGKSVLILDDLWNHF 340

Query: 61   PLEEVGIPEPNEENGCKLVITTRSHTVCRSMKC-KQVVVELLSKQEAFNLFIDGVGNSIL 119
             LE VGIP   E N CKL++T+RS  VCR M C K + VELL+K+EA+ LF++ +GN   
Sbjct: 341  LLEMVGIPV--EVNACKLILTSRSLEVCRRMGCQKSIKVELLTKEEAWTLFVEKLGNYAD 398

Query: 120  QVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVNAD 179
              P +  +I   V  EC  LPL I+ +A SM    +++EWRNAL EL+        +  +
Sbjct: 399  LSPEV-ADIAKSVAAECACLPLGIIAMAGSMREVNDLYEWRNALTELKQSEVGVEDMEPE 457

Query: 180  VLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQAKYDR 239
            V   L FSY  L D  LQQC LYCA +PEDF + +++LI Y I EG I+ +K  QA+YDR
Sbjct: 458  VFHILRFSYMHLNDSALQQCLLYCAFFPEDFTVDREDLIGYLIDEGIIQPMKSRQAEYDR 517

Query: 240  GHTILNRLVNCCLLES---AEDGSCVKMHDLIRDMALRITSESPLFMVKAGLRLLKFPGE 296
            G  +LN+L N CLLES    ED  C KMHDLIRDMAL+   E    MV+   +L + P E
Sbjct: 518  GQAMLNKLENACLLESYISKEDYRCFKMHDLIRDMALQKLREKSPIMVEVEEQLKELPDE 577

Query: 297  QEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLN 356
             EW+ ++ RVSLM+N+++EIPS  SP C  LSTL L  N  L+ I + FF H+ GLKVL+
Sbjct: 578  DEWKVDVMRVSLMKNHLKEIPSGCSPMCPKLSTLFLFSNFKLEMIADSFFKHLQGLKVLD 637

Query: 357  LSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVPEGME 416
            LS T I  LPSS SDL NL +L L  C  L+ +PS+AKL  L+ LDL  T +EE+P+GME
Sbjct: 638  LSATAIRELPSSFSDLVNLTALYLRRCHNLRYIPSLAKLRGLRKLDLRYTALEELPQGME 697

Query: 417  MLENLSHLYLYLPLLKKFPAAL-------------RET-------VEEAASLSDRLDSFE 456
            ML NL +L L+   LK+ PA +             R +       VEE A L +R+++  
Sbjct: 698  MLSNLRYLNLFGNSLKEMPAGILPKLSQLQFLNANRASGIFKTVRVEEVACL-NRMETLR 756

Query: 457  GHFFKLKDFNIYVKSADGRGS-KDYCLWLSASGKRRFLTHLIPKNYTHLEKLYKHKSVCL 515
              F  L DF  Y+KS + R     Y   +   G  R +  L+   Y   E+++ +K V +
Sbjct: 757  YQFCDLVDFKKYLKSPEVRQYLTTYFFTIGQLGVDREMDSLL---YMTPEEVF-YKEVLV 812

Query: 516  FACKICEREEPIVLPEDVQFLQMNRVHDVASLNDVLPREQG----------------LVN 559
              C+I E+   + LPEDV    + R HD  SL DV P +                  L +
Sbjct: 813  HDCQIGEKGRFLELPEDVSSFSIGRCHDARSLCDVSPFKHATSLKSLGMWECDGIECLAS 872

Query: 560  IGKFSHD--------------------------------------LKVIRFIYCGNLKNL 581
            + + S D                                      LK +    C ++KNL
Sbjct: 873  MSESSTDIFESLESLYLKTLKNFCVFITREGAAPPSWQSNGTFSHLKKVTIGECPSMKNL 932

Query: 582  FSLRLLPALQNLEVLKVEGCDSIEEI---------VAVDDEETEKELATNTIVNTVTLPR 632
            FSL LLP L NLEV++V+ CD +EEI         + V+D  +    A        +LP 
Sbjct: 933  FSLDLLPNLTNLEVIEVDDCDQMEEIIAIEDEEEGMMVEDSSSSSHYA------VTSLPN 986

Query: 633  LKKLRFSKLPEFKSVCSNNGVLVCNSLQEIKVYGCPKLKRLSLSLPLLDNGQ 684
            LK L+ S LPE KS+   +G ++C+SLQEI V  CP LKR+SLS     NGQ
Sbjct: 987  LKVLKLSNLPELKSIF--HGEVICDSLQEIIVVNCPNLKRISLSHRNHANGQ 1036

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112395|ref|XP_002332783.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833192|gb|EEE71669.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117250|ref|XP_002317519.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222860584|gb|EEE98131.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224115986|ref|XP_002332020.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222875245|gb|EEF12376.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224128424|ref|XP_002329158.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222869827|gb|EEF06958.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105081|ref|XP_002333864.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222838740|gb|EEE77105.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356542242|ref|XP_003539578.1| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Back     alignment and taxonomy information
>gi|224109372|ref|XP_002333267.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222835868|gb|EEE74289.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145639|ref|XP_002325714.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222862589|gb|EEF00096.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112383|ref|XP_002332780.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222833189|gb|EEE71666.1| nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.596 0.449 0.364 5.2e-77
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.598 0.420 0.378 5.7e-72
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.583 0.444 0.347 3.1e-70
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.595 0.463 0.374 2.5e-68
TAIR|locus:2170892848 AT5G43730 [Arabidopsis thalian 0.592 0.483 0.397 2.9e-68
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.575 0.445 0.381 2.9e-68
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.596 0.485 0.386 3.7e-68
TAIR|locus:2132741892 AT4G10780 [Arabidopsis thalian 0.573 0.445 0.379 7.3e-67
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.596 0.466 0.371 2.2e-65
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.601 0.470 0.378 1.1e-64
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 683 (245.5 bits), Expect = 5.2e-77, Sum P(2) = 5.2e-77
 Identities = 157/431 (36%), Positives = 255/431 (59%)

Query:     1 IWVTVSQPLDLFKLQTEIATALKQSLLENEDKVRRAG-RLLGMLKAKEKFVLILDDTWEA 59
             IWVTVS+  DL ++Q +IA  L +      +++ + G  +   L   + F+LILDD W  
Sbjct:   171 IWVTVSKDFDLKRVQMDIAKRLGKRF--TREQMNQLGLTICERLIDLKNFLLILDDVWHP 228

Query:    60 FPLEEVGIPEPNEEN-GCKLVITTRSHTVCRSMKCKQ-VVVELLSKQEAFNLFIDGVGNS 117
               L+++GIP   E +   K+V+T+R   VC+ M   + + V  L ++EA+ LF   VG  
Sbjct:   229 IDLDQLGIPLALERSKDSKVVLTSRRLEVCQQMMTNENIKVACLQEKEAWELFCHNVGE- 287

Query:   118 ILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRNGVN 177
             +     + K I  +V  EC  LPLAI+T+  ++ G+ ++  W++ LN L+   RS   ++
Sbjct:   288 VANSDNV-KPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHTLNLLK---RSAPSID 343

Query:   178 AD--VLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQA 235
              +  + G L+ SY  L+D  ++ CFL+CAL+PED++I   ELI YW+AEG ++     + 
Sbjct:   344 TEEKIFGTLKLSYDFLQDN-MKSCFLFCALFPEDYSIKVSELIMYWVAEGLLDGQHHYED 402

Query:   236 KYDRGHTILNRLVNCCLLESAEDGSCVKMHDLIRDMALR-ITSESPLF--MVKAGLRLLK 292
               + G T++ RL + CLLE  +    VKMHD++RD A+  ++S+   F  +V AG  L++
Sbjct:   403 MMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEGFHSLVMAGRGLIE 462

Query:   293 FPGEQEWEENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGL 352
             FP + ++  +++RVSLM N +E +P+N+    E L  LLLQ N  ++ +P  F      L
Sbjct:   463 FP-QDKFVSSVQRVSLMANKLERLPNNVIEGVETL-VLLLQGNSHVKEVPNGFLQAFPNL 520

Query:   353 KVLNLSRTNIEVLPSSVSDLTNLRSLLLGMCGRLKRVPSVAKLLALQYLDLEATGIEEVP 412
             ++L+LS   I  LP S S+L +LRSL+L  C +L+ +PS+  L+ LQ+LDL  + I E+P
Sbjct:   521 RILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFLDLHESAIRELP 580

Query:   413 EGMEMLENLSH 423
              G+E L +L +
Sbjct:   581 RGLEALSSLRY 591
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170892 AT5G43730 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132741 AT4G10780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 7e-50
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN032101153 PLN03210, PLN03210, Resistant to P 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information 
 Score =  175 bits (446), Expect = 7e-50
 Identities = 84/236 (35%), Positives = 132/236 (55%), Gaps = 11/236 (4%)

Query: 1   IWVTVSQPLDLFKLQTEIATALKQ---SLLENEDKVRRAGRLLGMLKAKEKFVLILDDTW 57
            WV VS+    F+LQ +I   L       +E  +    A ++   L  K +F+L+LDD W
Sbjct: 53  AWVVVSKTYTEFRLQKDILQELGLDDSDWVEKNESEL-AVKIKEALLRK-RFLLVLDDVW 110

Query: 58  EAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSM--KCKQVVVELLSKQEAFNLFIDGVG 115
           E    +++G+P P+ ENG ++++TTRS +V   M    K   VE L  +E++ LF + V 
Sbjct: 111 EKNDWDKIGVPFPDGENGSRVIVTTRSESVAGRMGGTSKPHEVESLEPEESWELFSNKVF 170

Query: 116 -NSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGLVRSRN 174
              +   P L +E+  E+VE+C  LPLA+  +   ++ +  + EW + L +L   +  R+
Sbjct: 171 EKELPPCPEL-EEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEWEHVLEQLNNELAGRD 229

Query: 175 GVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEV 230
           G+N +VL  L  SY  L    L++CFLY AL+PED+ I K++LI  WIAEGF+   
Sbjct: 230 GLN-EVLSILSLSYDNLPMH-LKRCFLYLALFPEDYNIRKEQLIKLWIAEGFVIPS 283

Length = 285
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 692
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.82
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.81
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.7
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG0617264 consensus Ras suppressor protein (contains leucine 99.47
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.47
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.44
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.36
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.35
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.28
KOG4237498 consensus Extracellular matrix protein slit, conta 99.18
KOG4237498 consensus Extracellular matrix protein slit, conta 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.85
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.81
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.74
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.65
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.59
PRK04841 903 transcriptional regulator MalT; Provisional 98.32
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.29
PLN03150623 hypothetical protein; Provisional 98.24
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.21
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.21
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.18
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.08
PRK15386426 type III secretion protein GogB; Provisional 98.07
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.06
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.01
PLN03150623 hypothetical protein; Provisional 97.95
KOG4341483 consensus F-box protein containing LRR [General fu 97.95
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.94
PRK15386426 type III secretion protein GogB; Provisional 97.79
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.63
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.58
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.44
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.37
KOG4341483 consensus F-box protein containing LRR [General fu 97.36
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.35
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.23
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.16
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.12
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.92
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.64
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.63
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 96.57
PF05729166 NACHT: NACHT domain 95.91
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.88
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.43
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.36
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.3
PRK06893229 DNA replication initiation factor; Validated 95.16
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.0
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.93
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.88
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.42
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.4
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.22
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.7
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.64
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 93.32
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.88
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 92.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.42
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 92.07
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.03
COG3903414 Predicted ATPase [General function prediction only 90.41
KOG1947 482 consensus Leucine rich repeat proteins, some prote 89.65
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 88.2
smart0037026 LRR Leucine-rich repeats, outliers. 88.2
PRK09087226 hypothetical protein; Validated 88.1
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 84.26
smart0037026 LRR Leucine-rich repeats, outliers. 84.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.82
PF13173128 AAA_14: AAA domain 82.53
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 82.47
KOG0473326 consensus Leucine-rich repeat protein [Function un 80.65
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-69  Score=605.15  Aligned_cols=446  Identities=38%  Similarity=0.611  Sum_probs=373.9

Q ss_pred             CEEEecCCCCHHHHHHHHHHHhhhhhhccch--HHHHHHHHHHHHHhCCeEEEEecCccCcCCcccccCCCCCCCCCeEE
Q 047027            1 IWVTVSQPLDLFKLQTEIATALKQSLLENED--KVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPNEENGCKL   78 (692)
Q Consensus         1 ~wv~vs~~~~~~~l~~~i~~~l~~~~~~~~~--~~~~~~~~~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~~~~gs~I   78 (692)
                      |||+||+.|+..+++++|+..++........  .......+. .++++|||+||+||||++.+|+.+..++|....||+|
T Consensus       214 iWV~VSk~f~~~~iq~~Il~~l~~~~~~~~~~~~~~~~~~i~-~~L~~krfllvLDDIW~~~dw~~I~~~~p~~~~g~Kv  292 (889)
T KOG4658|consen  214 IWVVVSKEFTTRKIQQTILERLGLLDEEWEDKEEDELASKLL-NLLEGKRFLLVLDDIWEEVDWDKIGVPFPSRENGSKV  292 (889)
T ss_pred             EEEEEcccccHHhHHHHHHHHhccCCcccchhhHHHHHHHHH-HHhccCceEEEEecccccccHHhcCCCCCCccCCeEE
Confidence            7999999999999999999998764333222  234444444 4448899999999999999999999999988899999


Q ss_pred             EEEecchhhhcc-cccccee-eccCChHhHHHHHHhhhcCCCCCCchhHHHHHHHHHHHhCCchhHHHHHHHHhcCCcCH
Q 047027           79 VITTRSHTVCRS-MKCKQVV-VELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEI  156 (692)
Q Consensus        79 ivTTR~~~v~~~-~~~~~~~-l~~l~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~g~~L~~~~~~  156 (692)
                      ++|||++.|+.. +++...+ ++.|+.+|||.||++.||.......+.++++|++|+++|+|+|||++++|+.|+.+.+.
T Consensus       293 vlTTRs~~V~~~~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~  372 (889)
T KOG4658|consen  293 VLTTRSEEVCGRAMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTV  372 (889)
T ss_pred             EEEeccHhhhhccccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcH
Confidence            999999999998 7776777 99999999999999999988544445699999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhccccC-CCchhhhhhhhhhccccCCChhhhHHHhHhcCCCCCCccCHHHHHHHHHHcCCcccchhhhh
Q 047027          157 HEWRNALNELRGLVRSR-NGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEGFIEEVKDVQA  235 (692)
Q Consensus       157 ~~w~~~~~~l~~~~~~~-~~~~~~~~~~l~~sy~~L~~~~~k~~fl~la~fp~~~~i~~~~l~~~w~a~~~~~~~~~~~~  235 (692)
                      ++|+++.+.+....... ..+.+.+..++.+|||.|+ +++|.||+|||+||+|+.|++..++.+|+||||+.+...+..
T Consensus       373 ~eW~~~~~~l~s~~~~~~~~~~~~i~~iLklSyd~L~-~~lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~  451 (889)
T KOG4658|consen  373 QEWRRALNVLKSSLAADFSGMEESILPILKLSYDNLP-EELKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGET  451 (889)
T ss_pred             HHHHHHHccccccccCCCCchhhhhHHhhhccHhhhh-HHHHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccc
Confidence            99999999887663332 3457789999999999999 999999999999999999999999999999999998777888


Q ss_pred             HHHhHHHHHHHHHhhccccccCC---CCEEEehHHHHHHHHHHhc-----CCCeEEEecCcceeecCCcccccccccEEE
Q 047027          236 KYDRGHTILNRLVNCCLLESAED---GSCVKMHDLIRDMALRITS-----ESPLFMVKAGLRLLKFPGEQEWEENLERVS  307 (692)
Q Consensus       236 ~~~~~~~~l~~L~~~~ll~~~~~---~~~~~mhdl~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~  307 (692)
                      ++++|.+++++|++++|+....+   ...|+|||++|++|.+++.     +++ .++..+......|.... ...+|+++
T Consensus       452 ~~d~G~~~i~~LV~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~-~~~~rr~s  529 (889)
T KOG4658|consen  452 AEDVGYDYIEELVRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKS-WNSVRRMS  529 (889)
T ss_pred             hhcchHHHHHHHHHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccc-hhheeEEE
Confidence            99999999999999999998753   3789999999999999998     666 55555544445554433 36789999


Q ss_pred             eecCCccccCCCCCCCCCCccEEEccCCCc-cCCCchhHhhcCCCCcEEEccCCC-CccCCccccCCCCCcEEEccCCCC
Q 047027          308 LMRNNIEEIPSNMSPHCEILSTLLLQRNGL-LQRIPECFFVHMHGLKVLNLSRTN-IEVLPSSVSDLTNLRSLLLGMCGR  385 (692)
Q Consensus       308 l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~-~~~~~~~~~~~l~~L~~L~l~~~~-~~~lp~~i~~l~~L~~L~l~~c~~  385 (692)
                      +.++.+..++...  .+++|++|.+.+|.. +..++..+|..|+.||+|||++|. +..+|.+|+.|.|||||++++ +.
T Consensus       530 ~~~~~~~~~~~~~--~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~-t~  606 (889)
T KOG4658|consen  530 LMNNKIEHIAGSS--ENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSD-TG  606 (889)
T ss_pred             EeccchhhccCCC--CCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccC-CC
Confidence            9999998876653  677899999999974 788888888999999999999876 789999999999999999998 67


Q ss_pred             CcCCC-cccccccCCEEecccC-CCcccCccccCCCCCCEEEccCCCCCCCChhHHhhHHHhhhhhccccceeEE
Q 047027          386 LKRVP-SVAKLLALQYLDLEAT-GIEEVPEGMEMLENLSHLYLYLPLLKKFPAALRETVEEAASLSDRLDSFEGH  458 (692)
Q Consensus       386 ~~~lp-~~~~l~~L~~L~l~~~-~l~~lp~~i~~l~~L~~L~l~~~~~~~lp~~l~~~~~~l~~L~~~L~~L~~~  458 (692)
                      +..+| ++++|+.|++|++..+ .+..+|..+..|.+|++|.+....... -   .....++.+|+ .|+.+...
T Consensus       607 I~~LP~~l~~Lk~L~~Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~-~---~~~l~el~~Le-~L~~ls~~  676 (889)
T KOG4658|consen  607 ISHLPSGLGNLKKLIYLNLEVTGRLESIPGILLELQSLRVLRLPRSALSN-D---KLLLKELENLE-HLENLSIT  676 (889)
T ss_pred             ccccchHHHHHHhhheeccccccccccccchhhhcccccEEEeecccccc-c---hhhHHhhhccc-chhhheee
Confidence            89999 8999999999999998 555665555669999999996654111 0   12234455555 55555553

>PLN03210 Resistant to P Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-05
1z6t_A591 Structure Of The Apoptotic Protease-activating Fact 1e-04
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 2e-04
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-04
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 4e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 7e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 7e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure 
Iteration: 1

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 6/125 (4%)
Query: 301 ENLERVSLMRNNIEEIPSNMSPHCEILSTLLLQRNGLLQRIPECFFVHMHGLKVLNLSRT 360
           +NLE + +  N ++ +P  +      L+ L L RN  L+ +P   F  +  L  L+L   
Sbjct: 85  KNLETLWVTDNKLQALPIGVFDQLVNLAELRLDRNQ-LKSLPPRVFDSLTKLTYLSLGYN 143
Query: 361 NIEVLPSSVSD-LTNLRSLLLGMCGRLKRVPSVA--KLLALQYLDLEATGIEEVPEG-ME 416
            ++ LP  V D LT+L+ L L    +LKRVP  A  KL  L+ L L+   ++ VPEG  +
Sbjct: 144 ELQSLPKGVFDKLTSLKELRL-YNNQLKRVPEGAFDKLTELKTLKLDNNQLKRVPEGAFD 202
Query: 417 MLENL 421
            LE L
Sbjct: 203 SLEKL 207
>pdb|1Z6T|A Chain A, Structure Of The Apoptotic Protease-activating Factor 1 Bound To Adp Length = 591 Back     alignment and structure
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 5e-48
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 4e-45
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-34
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-13
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-14
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-13
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-13
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-13
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-12
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-12
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-12
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-07
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-09
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-09
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-08
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score =  176 bits (448), Expect = 5e-48
 Identities = 44/296 (14%), Positives = 89/296 (30%), Gaps = 29/296 (9%)

Query: 1   IWVTVSQPL---------DLFKLQTEIATALKQSLLENEDKVRRAGRLLGMLKAKEKFVL 51
           +W+  S            D+  +       L    +E+   V     +   L  +   + 
Sbjct: 188 VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLF 247

Query: 52  ILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVEL--LSKQEAFNL 109
           + DD  +    EE       +E   + ++TTR   +  +       +E+  L   E ++ 
Sbjct: 248 VFDDVVQ----EET--IRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDF 301

Query: 110 FIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSG--EEEIHEWRNALN--E 165
                      V    ++++N+ +E     P  ++    S      E++ +  N L    
Sbjct: 302 LEAYGMPM--PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRG 359

Query: 166 LRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYCALYPEDFAIPKDELIDYWIAEG 225
           L G+          +   L+     L DE  +    +  + P    IP          + 
Sbjct: 360 LVGVECITPYSYKSLAMALQRCVEVLSDE-DRSALAFAVVMPPGVDIPVKLWSCVIPVDI 418

Query: 226 FIEEVKDVQAKYDRGHTILNRLVNCCLLESAEDGS--CVKMHDLIRDMALRITSES 279
              E + +    D     L RL     L S +       K+  +I      +    
Sbjct: 419 CSNEEEQLD---DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQ 471
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 100.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.95
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.94
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.9
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.89
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.87
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.87
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.87
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.87
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.86
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.86
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.86
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.86
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.85
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.85
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.85
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.85
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.84
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.84
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.84
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.84
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.84
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.84
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.84
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.83
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.83
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.83
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.82
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.82
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.81
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.8
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.79
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.78
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.77
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.75
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.75
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.74
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.72
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.72
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.7
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.7
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.7
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.68
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.68
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.66
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.66
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.65
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.64
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.6
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.6
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.59
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.58
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.58
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.56
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.54
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.53
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.52
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.51
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.5
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.49
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.49
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.47
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.47
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.46
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.46
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.45
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.45
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.45
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.44
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.43
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.42
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.41
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.41
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.41
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.4
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.39
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.38
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.38
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.37
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.33
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.31
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.3
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.3
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.29
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.28
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.26
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.26
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.26
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.24
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.23
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.22
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.2
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.2
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.17
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.17
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.16
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.1
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.03
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.01
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.99
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.95
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.95
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.93
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.75
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.59
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.43
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.37
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.21
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.07
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.01
2fna_A357 Conserved hypothetical protein; structural genomic 97.88
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.53
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.23
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.18
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.13
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.12
2v1u_A387 Cell division control protein 6 homolog; DNA repli 96.91
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.77
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.58
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 96.57
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.53
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.96
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.06
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.83
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 94.79
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.2
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.7
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.37
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 87.33
2chq_A319 Replication factor C small subunit; DNA-binding pr 83.27
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 82.61
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 82.3
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-33  Score=311.07  Aligned_cols=258  Identities=18%  Similarity=0.239  Sum_probs=196.4

Q ss_pred             CEEEecCCC--CHHHHHHHHHHHhhhhhh-------ccchHHHHHHHHHHHHHhCC-eEEEEecCccCcCCcccccCCCC
Q 047027            1 IWVTVSQPL--DLFKLQTEIATALKQSLL-------ENEDKVRRAGRLLGMLKAKE-KFVLILDDTWEAFPLEEVGIPEP   70 (692)
Q Consensus         1 ~wv~vs~~~--~~~~l~~~i~~~l~~~~~-------~~~~~~~~~~~~~~~l~~~k-r~LlVlDdv~~~~~~~~l~~~~~   70 (692)
                      +||+|++.+  ++.+++++|+++++....       +..+.......+.+.+ +++ ||||||||||+.+++ .+.    
T Consensus       188 ~wv~vs~~~~~~~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~~~L-~~~kr~LlVLDdv~~~~~~-~~~----  261 (549)
T 2a5y_B          188 VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNAL-IDRPNTLFVFDDVVQEETI-RWA----  261 (549)
T ss_dssp             EEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHH-TTSTTEEEEEEEECCHHHH-HHH----
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHhcCcccccccccccccHHHHHHHHHHHH-cCCCcEEEEEECCCCchhh-ccc----
Confidence            599999985  899999999999976421       1112233344555555 675 999999999998765 111    


Q ss_pred             CCCCCeEEEEEecchhhhcccc-cccee-eccCChHhHHHHHHhhhcCCCCCCchhHHHHHHHHHHHhCCchhHHHHHHH
Q 047027           71 NEENGCKLVITTRSHTVCRSMK-CKQVV-VELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAA  148 (692)
Q Consensus        71 ~~~~gs~IivTTR~~~v~~~~~-~~~~~-l~~l~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~g~  148 (692)
                       ..+||+||||||++.++..++ ....+ +++|+.+|||+||.+.++....  ++.+++++.+|+++|+|+||||+++|+
T Consensus       262 -~~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~--~~~~~~~~~~I~~~c~GlPLAl~~~g~  338 (549)
T 2a5y_B          262 -QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFK  338 (549)
T ss_dssp             -HHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHT
T ss_pred             -ccCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC--chhHHHHHHHHHHHhCCChHHHHHHHH
Confidence             127999999999999998775 44556 9999999999999999987632  357889999999999999999999999


Q ss_pred             HhcCCcCHHHHHHHHHHHhhccccCCCchhhhhhhhhhccccCCChhhhHHHh-----------HhcCCCCCCccCHHHH
Q 047027          149 SMSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFL-----------YCALYPEDFAIPKDEL  217 (692)
Q Consensus       149 ~L~~~~~~~~w~~~~~~l~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~~fl-----------~la~fp~~~~i~~~~l  217 (692)
                      .|+.+ +   |+.+ +.+.......  ...++..++.+||+.|+ +++|.||+           |||+||+++.|+    
T Consensus       339 ~l~~~-~---w~~~-~~l~~~l~~~--~~~~i~~~l~~Sy~~L~-~~lk~~f~~Ls~~er~l~~~ls~fp~~~~i~----  406 (549)
T 2a5y_B          339 SCEPK-T---FEKM-AQLNNKLESR--GLVGVECITPYSYKSLA-MALQRCVEVLSDEDRSALAFAVVMPPGVDIP----  406 (549)
T ss_dssp             TCCSS-S---HHHH-HHHHHHHHHH--CSSTTCCCSSSSSSSHH-HHHHHHHHTSCHHHHHHTTGGGSSCTTCCEE----
T ss_pred             Hhccc-h---HHHH-HHhHHHhhcc--cHHHHHHHHhccccccc-HHHHHHHhccchhhhhHhhheeeeCCCCeee----
Confidence            99875 3   4433 3332221110  13568999999999999 89999999           999999999998    


Q ss_pred             HHHHHHc--CCcccchhhhhHHHhHHHHHHHHHhhccccccCC--CCEEEehHHHHHHHHHHhcCCC
Q 047027          218 IDYWIAE--GFIEEVKDVQAKYDRGHTILNRLVNCCLLESAED--GSCVKMHDLIRDMALRITSESP  280 (692)
Q Consensus       218 ~~~w~a~--~~~~~~~~~~~~~~~~~~~l~~L~~~~ll~~~~~--~~~~~mhdl~~~~~~~~~~~~~  280 (692)
                      +..|+|+  ||+.........++.++ ++++|++++|++....  ...|+|||++|++++.++.+++
T Consensus       407 i~~w~a~~~G~i~~~~~~~~~~~~~~-~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          407 VKLWSCVIPVDICSNEEEQLDDEVAD-RLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             HHHHHHHSCC-------CCCTHHHHH-HHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             eeeeeeeccceeccCCCCCCHHHHHH-HHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence            8899999  99986543445566776 9999999999998643  3679999999999998877653
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 692
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 5e-04
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 81.4 bits (200), Expect = 1e-17
 Identities = 28/211 (13%), Positives = 61/211 (28%), Gaps = 27/211 (12%)

Query: 1   IWVTVSQPLDLFKLQTEIATALKQSLLE---------NEDKVRRAGRLLGMLKAKEKFVL 51
           +W+  S               L     +         +   V     +   L  +   + 
Sbjct: 80  VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLF 139

Query: 52  ILDDTWEAFPLEEVGIPEPNEENGCKLVITTRSHTVCRSMKCKQVVVEL--LSKQEAFNL 109
           + DD  +             +E   + ++TTR   +  +       +E+  L   E ++ 
Sbjct: 140 VFDDVVQ------EETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDF 193

Query: 110 FIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAASMSGEEEIHEWRNALNELRGL 169
                      V    ++++N+ +E     P  ++    S    +   +     N+L   
Sbjct: 194 LEAYGMPM--PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEP-KTFEKMAQLNNKL--- 247

Query: 170 VRSRNGVNADVLGRLEFSYHRLKDEKLQQCF 200
               +     V     +SY  L    LQ+C 
Sbjct: 248 ---ESRGLVGVECITPYSYKSL-AMALQRCV 274
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.7
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.57
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.54
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.49
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.48
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.45
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.41
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.41
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.38
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.34
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.34
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.28
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.26
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.23
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.19
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.18
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.11
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.03
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.86
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.73
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.68
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.76
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.03
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.59
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 94.11
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 88.56
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 83.97
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.93  E-value=2.1e-26  Score=227.62  Aligned_cols=187  Identities=15%  Similarity=0.152  Sum_probs=148.1

Q ss_pred             CEEEecCCCCHHHHHHHHHHHhhhhhh---------ccchHHHHHHHHHHHHHhCCeEEEEecCccCcCCcccccCCCCC
Q 047027            1 IWVTVSQPLDLFKLQTEIATALKQSLL---------ENEDKVRRAGRLLGMLKAKEKFVLILDDTWEAFPLEEVGIPEPN   71 (692)
Q Consensus         1 ~wv~vs~~~~~~~l~~~i~~~l~~~~~---------~~~~~~~~~~~~~~~l~~~kr~LlVlDdv~~~~~~~~l~~~~~~   71 (692)
                      +||++++.++...+...+...+.....         .............+..+.++|+|+||||||+.++|+.+.     
T Consensus        80 ~Wv~vs~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~kr~LlVLDDv~~~~~~~~~~-----  154 (277)
T d2a5yb3          80 VWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQ-----  154 (277)
T ss_dssp             EEEECCCCSTTHHHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHHHHTTSTTEEEEEEEECCHHHHHHHH-----
T ss_pred             EEEEecCCCCHHHHHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHHHHhccCCeeEecchhhHHhhhhhhc-----
Confidence            599999999988887777555432111         112233334445666668899999999999998887653     


Q ss_pred             CCCCeEEEEEecchhhhcccccc-cee-eccCChHhHHHHHHhhhcCCCCCCchhHHHHHHHHHHHhCCchhHHHHHHHH
Q 047027           72 EENGCKLVITTRSHTVCRSMKCK-QVV-VELLSKQEAFNLFIDGVGNSILQVPALNKEIINEVVEECGRLPLAIVTVAAS  149 (692)
Q Consensus        72 ~~~gs~IivTTR~~~v~~~~~~~-~~~-l~~l~~~~~~~Lf~~~~~~~~~~~~~~~~~~~~~i~~~c~glPlal~~~g~~  149 (692)
                       ..|||||||||+++|+..+... ..| +++|+.+|||+||.++++....  .+..++++++|+++|+|+||||+++|+.
T Consensus       155 -~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~--~~~~~~~~~~iv~~c~GlPLAl~~ig~~  231 (277)
T d2a5yb3         155 -ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV--GEKEEDVLNKTIELSSGNPATLMMFFKS  231 (277)
T ss_dssp             -HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC----CHHHHHHHHHHHHHTTCHHHHHHHHTT
T ss_pred             -ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccC--chhhHHHHHHHHHHhCCCHHHHHHHHHH
Confidence             2589999999999999877554 556 9999999999999999887632  3366889999999999999999999999


Q ss_pred             hcCCcCHHHHHHHHHHHhhccccCCCchhhhhhhhhhccccCCChhhhHHHhHh
Q 047027          150 MSGEEEIHEWRNALNELRGLVRSRNGVNADVLGRLEFSYHRLKDEKLQQCFLYC  203 (692)
Q Consensus       150 L~~~~~~~~w~~~~~~l~~~~~~~~~~~~~~~~~l~~sy~~L~~~~~k~~fl~l  203 (692)
                      |+. ++.+.|.+..+.+....      ..++..++.+||++|| +++|+||.++
T Consensus       232 l~~-k~~~~~~~~~~~L~~~~------~~~v~~il~~sY~~L~-~~lk~c~~~l  277 (277)
T d2a5yb3         232 CEP-KTFEKMAQLNNKLESRG------LVGVECITPYSYKSLA-MALQRCVEVL  277 (277)
T ss_dssp             CCS-SSHHHHHHHHHHHHHHC------SSTTCCCSSSSSSSHH-HHHHHHHHTS
T ss_pred             hcc-CCHHHHHHHHHHHhcCc------HHHHHHHHHHHHhccc-HHHHHHHHhC
Confidence            987 47889999888886432      3579999999999999 8999999764
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure