Citrus Sinensis ID: 047160

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
FRYGFNPARIIRVHPGPGRFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFDHEAQGRQKSSLKKGALSPEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD
cccccccccEEEEEccccEEEEEcccEEEEccccccccccccccHHHHEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHccccccccccccccHHHHHHHHHHHHHHcc
ccccccccEEEEEcccccHHHHHHHHHHHHccccHHHHHHHcccccccccHHccccccccHHccccccccccHHHHHHHHHHHHHcccHHccccHHHHHHHccccccccccccHHHHHHHHHHHHHHcc
frygfnpariirvhpgpgrflVILPSLVTMSKRQESKINAQSTMNWFQVKKlkfdheaqgrqksslkkgalspeedQKLINYVTSrcllrcgkscrlcwrnyqrpdinrdsftqEEDEIIIKLHQQLRD
frygfnpariirvhpgpgrFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFdheaqgrqksslkkgalspeedqKLINYVTSRCLLRCGKSCRLCWrnyqrpdinrdsftqeeDEIIIKLHQQLRD
FRYGFNPARIIRVHPGPGRFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFDHEAQGRQKSSLKKGALSPEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD
***GFNPARIIRVHPGPGRFLVILPSLVTM************TMNWFQVKKL*************************KLINYVTSRCLLRCGKSCRLCWRNYQRPDINR*********III********
*****NPARIIRVHPGPGRFLVILPSLV*****************WFQVKKL*************L*KGALSPEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLR*
FRYGFNPARIIRVHPGPGRFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFDH****************PEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD
FRYGFNPARIIRVHPGPGRFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFDHEAQGRQKSSLKKGALSPEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FRYGFNPARIIRVHPGPGRFLVILPSLVTMSKRQESKINAQSTMNWFQVKKLKFDHEAQGRQKSSLKKGALSPEEDQKLINYVTSRCLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
P81395 274 Myb-related protein 330 O N/A no 0.511 0.240 0.551 5e-15
Q38851 236 Transcription repressor M yes no 0.511 0.279 0.5 3e-14
Q8LPH6 352 Transcription factor MYB8 no no 0.503 0.184 0.506 6e-14
Q9SZP1 282 Transcription repressor M no no 0.511 0.234 0.487 8e-14
Q9S9K9 257 Transcription factor MYB3 no no 0.511 0.256 0.487 2e-13
P81393 232 Myb-related protein 308 O N/A no 0.511 0.284 0.5 3e-13
P20026 267 Myb-related protein Hv1 O N/A no 0.511 0.247 0.487 1e-12
Q7XBH4 257 Myb-related protein Myb4 no no 0.511 0.256 0.461 2e-12
O49608 274 Transcription factor MYB3 no no 0.511 0.240 0.5 2e-12
P20024 340 Myb-related protein Zm1 O N/A no 0.503 0.191 0.467 2e-12
>sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (66%), Gaps = 12/78 (15%)

Query: 62  QKSSLKKGALSPEEDQKLINYVTSR---C---------LLRCGKSCRLCWRNYQRPDINR 109
           +K+   KGA + EEDQ+LINY+ +    C         LLRCGKSCRL W NY RPD+ R
Sbjct: 8   EKAHTNKGAWTKEEDQRLINYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYLRPDLKR 67

Query: 110 DSFTQEEDEIIIKLHQQL 127
            +FT+EEDEIIIKLH  L
Sbjct: 68  GNFTEEEDEIIIKLHSLL 85
Transcription factor.
Antirrhinum majus (taxid: 4151)
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description
>sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 Back     alignment and function description
>sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 Back     alignment and function description
>sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
449505152 245 PREDICTED: myb-related protein Myb4-like 0.527 0.277 0.537 2e-14
449468552 245 PREDICTED: transcription repressor MYB6- 0.527 0.277 0.537 2e-14
255567266 302 Transcription repressor MYB4, putative [ 0.511 0.218 0.525 1e-13
242084960215 hypothetical protein SORBIDRAFT_08g00472 0.511 0.306 0.525 2e-13
357453601 250 MYB transcription factor [Medicago trunc 0.511 0.264 0.538 2e-13
195628398222 hypothetical protein [Zea mays] 0.511 0.297 0.512 2e-13
338173757 292 transcription factor R2R3-MYB1 [Camellia 0.511 0.226 0.538 2e-13
330688600207 transcription factor MYB3 [Fagopyrum tat 0.511 0.318 0.538 2e-13
19548409188 P-type R2R3 Myb protein [Sorghum bicolor 0.511 0.351 0.538 2e-13
164414407226 transcription factor MYB8 [Zea mays] gi| 0.511 0.292 0.512 2e-13
>gi|449505152|ref|XP_004162391.1| PREDICTED: myb-related protein Myb4-like [Cucumis sativus] Back     alignment and taxonomy information
 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 49/80 (61%), Gaps = 12/80 (15%)

Query: 62  QKSSLKKGALSPEEDQKLINYVT------------SRCLLRCGKSCRLCWRNYQRPDINR 109
           +K  LKKG  +PEEDQ LINY+                LLRCGKSCRL W NY RPDI R
Sbjct: 8   EKMGLKKGPWTPEEDQTLINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNYLRPDIKR 67

Query: 110 DSFTQEEDEIIIKLHQQLRD 129
            +FT EE+E II LHQ L +
Sbjct: 68  GNFTAEEEETIINLHQMLGN 87

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449468552|ref|XP_004151985.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255567266|ref|XP_002524614.1| Transcription repressor MYB4, putative [Ricinus communis] gi|223536167|gb|EEF37822.1| Transcription repressor MYB4, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|242084960|ref|XP_002442905.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor] gi|241943598|gb|EES16743.1| hypothetical protein SORBIDRAFT_08g004720 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357453601|ref|XP_003597081.1| MYB transcription factor [Medicago truncatula] gi|355486129|gb|AES67332.1| MYB transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|195628398|gb|ACG36029.1| hypothetical protein [Zea mays] Back     alignment and taxonomy information
>gi|338173757|gb|AEI83425.1| transcription factor R2R3-MYB1 [Camellia sinensis] Back     alignment and taxonomy information
>gi|330688600|gb|AEC32978.1| transcription factor MYB3 [Fagopyrum tataricum] Back     alignment and taxonomy information
>gi|19548409|gb|AAL90628.1|AF470060_1 P-type R2R3 Myb protein [Sorghum bicolor] Back     alignment and taxonomy information
>gi|164414407|ref|NP_001106037.1| transcription factor MYB8 [Zea mays] gi|89143143|emb|CAJ42201.1| transcription factor MYB8 [Zea mays] gi|323388599|gb|ADX60104.1| ZmMYB8 transcription factor [Zea mays] gi|414878402|tpg|DAA55533.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2088187 367 MYB26 "myb domain protein 26" 0.317 0.111 0.609 9e-15
TAIR|locus:2059883 269 MYB7 "myb domain protein 7" [A 0.511 0.245 0.5 1.1e-14
TAIR|locus:2009452 257 MYB3 "myb domain protein 3" [A 0.511 0.256 0.5 2.3e-14
TAIR|locus:2133677 236 MYB6 "myb domain protein 6" [A 0.511 0.279 0.5 2.3e-14
TAIR|locus:2121259 282 MYB4 "myb domain protein 4" [A 0.511 0.234 0.5 2.3e-14
TAIR|locus:2087725 307 MYB67 "myb domain protein 67" 0.612 0.257 0.436 3.1e-14
TAIR|locus:2133382 348 MYB55 "myb domain protein 55" 0.310 0.114 0.6 3.1e-14
TAIR|locus:2146804 352 MYB86 "myb domain protein 86" 0.503 0.184 0.506 4.3e-14
TAIR|locus:2027508 314 MYB50 "myb domain protein 50" 0.503 0.207 0.493 1.3e-13
TAIR|locus:2075387 321 MYB107 "myb domain protein 107 0.503 0.202 0.532 1.9e-13
TAIR|locus:2088187 MYB26 "myb domain protein 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 136 (52.9 bits), Expect = 9.0e-15, Sum P(2) = 9.0e-15
 Identities = 25/41 (60%), Positives = 30/41 (73%)

Query:    87 CLLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQL 127
             CL RCGKSCRL W NY RPD+ R SF+ +E  +II+LH  L
Sbjct:    54 CLQRCGKSCRLRWINYLRPDLKRGSFSPQEAALIIELHSIL 94
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009901 "anther dehiscence" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009834 "secondary cell wall biogenesis" evidence=IMP
TAIR|locus:2059883 MYB7 "myb domain protein 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009452 MYB3 "myb domain protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133677 MYB6 "myb domain protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2121259 MYB4 "myb domain protein 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087725 MYB67 "myb domain protein 67" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133382 MYB55 "myb domain protein 55" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146804 MYB86 "myb domain protein 86" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027508 MYB50 "myb domain protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075387 MYB107 "myb domain protein 107" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Myb23
hypothetical protein (215 aa)
(Sorghum bicolor)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-18
PLN03212 249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-12
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 5e-06
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-04
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.002
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score = 80.0 bits (197), Expect = 1e-18
 Identities = 37/77 (48%), Positives = 49/77 (63%), Gaps = 12/77 (15%)

Query: 63  KSSLKKGALSPEEDQKLINYVTSR---C---------LLRCGKSCRLCWRNYQRPDINRD 110
           K  L+KG  SPEED+KL+ ++T     C         L RCGKSCRL W NY RPD+ R 
Sbjct: 9   KQKLRKGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYLRPDLKRG 68

Query: 111 SFTQEEDEIIIKLHQQL 127
           +F+Q+E+ +II+LH  L
Sbjct: 69  TFSQQEENLIIELHAVL 85

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
PLN03212 249 Transcription repressor MYB5; Provisional 99.92
PLN03091 459 hypothetical protein; Provisional 99.9
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.88
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.75
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.6
PLN03212249 Transcription repressor MYB5; Provisional 99.58
PLN03091 459 hypothetical protein; Provisional 99.55
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.54
KOG0048 238 consensus Transcription factor, Myb superfamily [T 99.34
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.19
KOG0051 607 consensus RNA polymerase I termination factor, Myb 98.93
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.92
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.77
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.76
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.51
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.49
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.29
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.23
KOG0051 607 consensus RNA polymerase I termination factor, Myb 97.53
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 97.44
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.4
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.03
PRK13923170 putative spore coat protein regulator protein YlbO 96.99
PF13325 199 MCRS_N: N-terminal region of micro-spherule protei 96.99
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.6
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 96.58
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 95.84
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.04
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 94.92
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 92.78
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.3
KOG4282 345 consensus Transcription factor GT-2 and related pr 90.18
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 89.2
KOG1279 506 consensus Chromatin remodeling factor subunit and 88.37
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 87.7
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 87.58
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 86.78
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 83.42
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 82.49
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=99.92  E-value=1.4e-25  Score=174.94  Aligned_cols=78  Identities=37%  Similarity=0.747  Sum_probs=74.3

Q ss_pred             hhCCCCcccccCCCCCCCCCCHHHHHHHHHHHHhhC------------cccCchhHHHHHHHhcCCCCCCCCCCHHHHHH
Q 047160           52 LKFDHEAQGRQKSSLKKGALSPEEDQKLINYVTSRC------------LLRCGKSCRLCWRNYQRPDINRDSFTQEEDEI  119 (129)
Q Consensus        52 ~~~~~r~~~~~k~~i~kg~WT~eED~~L~~~v~~~G------------~gRt~~qcr~Rw~~~L~p~ik~~~Wt~eEd~~  119 (129)
                      -+++++.+||.++.+++++||+|||++|+++|+++|            ++|+++|||+||.++|+|.+++++||.|||++
T Consensus         9 ~~~~~~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~l   88 (249)
T PLN03212          9 PVSKKTTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDL   88 (249)
T ss_pred             CCCCCCCCCcccCCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHH
Confidence            357789999999999999999999999999999977            58999999999999999999999999999999


Q ss_pred             HHHHHHhcCC
Q 047160          120 IIKLHQQLRD  129 (129)
Q Consensus       120 Ll~~v~~~G~  129 (129)
                      |++++.+|||
T Consensus        89 Llel~~~~Gn   98 (249)
T PLN03212         89 ILRLHRLLGN   98 (249)
T ss_pred             HHHHHHhccc
Confidence            9999999996

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-07
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-07
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 1e-06
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 1e-06
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-06
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 11/74 (14%)
Query: 65  SLKKGALSPEEDQKLIN----YVTSRCLL-------RCGKSCRLCWRNYQRPDINRDSFT 113
            L KG  + EEDQK+I     Y T +  L       R GK CR  W N+  P++ + S+T
Sbjct: 4   DLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWT 63
Query: 114 QEEDEIIIKLHQQL 127
           +EED II + H+ L
Sbjct: 64  EEEDRIIFEAHKVL 77
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-26
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 6e-25
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-09
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 6e-24
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 6e-23
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-20
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-13
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-19
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 9e-14
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-12
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 7e-08
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 4e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score = 93.0 bits (232), Expect = 4e-26
 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 11/73 (15%)

Query: 66  LKKGALSPEEDQKLINYVT-----------SRCLLRCGKSCRLCWRNYQRPDINRDSFTQ 114
           L KG  + EEDQ++I  V                 R GK CR  W N+  P++ + S+T+
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTE 61

Query: 115 EEDEIIIKLHQQL 127
           EED II + H++L
Sbjct: 62  EEDRIIYQAHKRL 74
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.93
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.93
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.89
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.89
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.89
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.88
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.84
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.82
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.78
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.73
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.71
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.69
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.69
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.67
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.64
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.63
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.62
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.51
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.48
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.47
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.47
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.46
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.42
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.4
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.39
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.36
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.85
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.14
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.09
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.99
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.78
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.66
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.58
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.5
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.26
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.24
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.23
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.22
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.2
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.09
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.06
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.06
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 97.95
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 97.94
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 97.9
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 97.86
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 97.86
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 97.82
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 96.89
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.68
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 97.66
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 97.64
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.58
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 97.54
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.37
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.33
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.28
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 97.19
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.13
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.14
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 96.98
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 96.15
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.82
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.48
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 95.31
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 95.24
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 95.01
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 94.05
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 93.89
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 93.43
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 92.66
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 91.47
2crg_A70 Metastasis associated protein MTA3; transcription 89.82
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 88.56
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 88.1
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 87.8
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 85.39
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 84.78
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 84.49
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 84.8
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 84.34
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 83.73
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=99.93  E-value=1e-26  Score=169.94  Aligned_cols=97  Identities=30%  Similarity=0.502  Sum_probs=66.8

Q ss_pred             hhHHHHhhhCCCChHHHhhhhCCCCccccc-------CCCCCCCCCCHHHHHHHHHHHHhhC-----------cccCchh
Q 047160           33 RQESKINAQSTMNWFQVKKLKFDHEAQGRQ-------KSSLKKGALSPEEDQKLINYVTSRC-----------LLRCGKS   94 (129)
Q Consensus        33 ~~~~~v~~~g~~~W~~Ia~~~~~~r~~~~~-------k~~i~kg~WT~eED~~L~~~v~~~G-----------~gRt~~q   94 (129)
                      .+...|..+|..+|..||+.+++++..+|.       .|.+++|+||+|||++|+++|..+|           +|||++|
T Consensus        16 ~L~~~v~~~g~~~W~~Ia~~l~~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~q   95 (159)
T 1h89_C           16 KLKKLVEQNGTDDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQ   95 (159)
T ss_dssp             ---------------------------CHHHHHHTTTCTTCCCSCCCHHHHHHHHHHHHHHCSCCHHHHHHTSTTCCHHH
T ss_pred             HHHHHHHHhCCCCHHHHHHHcCCCCHHHHHHHHHHccCCCcCCCCCChHHHHHHHHHHHHhCcccHHHHHHHcCCCCHHH
Confidence            344567788889999999999888887776       3999999999999999999999988           5999999


Q ss_pred             HHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHhcCC
Q 047160           95 CRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQLRD  129 (129)
Q Consensus        95 cr~Rw~~~L~p~ik~~~Wt~eEd~~Ll~~v~~~G~  129 (129)
                      |++||.++|+|.+++++||+|||.+|+++|.+||+
T Consensus        96 cr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~  130 (159)
T 1h89_C           96 CRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGN  130 (159)
T ss_dssp             HHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCS
T ss_pred             HHHHHHHHhCccccccCCChHHHHHHHHHHHHHCC
Confidence            99999999999999999999999999999999996
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 9e-11
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-09
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-07
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 5e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-05
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 5e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 2e-04
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 4e-04
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 52.3 bits (125), Expect = 9e-11
 Identities = 11/76 (14%), Positives = 23/76 (30%), Gaps = 16/76 (21%)

Query: 68  KGALSPEEDQKLINYVTSRCLL----------------RCGKSCRLCWRNYQRPDINRDS 111
           K + + EED+ +++ V                        G S R  +R Y    +    
Sbjct: 1   KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVY 60

Query: 112 FTQEEDEIIIKLHQQL 127
              +  +++      L
Sbjct: 61  EVDKFGKLVRDDDGNL 76
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.77
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.61
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.49
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.48
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.47
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.19
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.19
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.18
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.04
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.67
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.66
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.57
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.15
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.09
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.04
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.81
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 97.74
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 97.69
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.5
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 97.21
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 97.1
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 96.94
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 96.7
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 96.68
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 96.55
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 96.16
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 96.15
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 95.97
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 93.91
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 92.83
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 92.49
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 87.46
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 83.07
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 82.23
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 80.85
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.77  E-value=2.7e-21  Score=127.60  Aligned_cols=59  Identities=17%  Similarity=0.188  Sum_probs=54.2

Q ss_pred             CCCCCHHHHHHHHHHHHhhC----------------cccCchhHHHHHHHhcCCCCCCCCCCHHHHHHHHHHHHh
Q 047160           68 KGALSPEEDQKLINYVTSRC----------------LLRCGKSCRLCWRNYQRPDINRDSFTQEEDEIIIKLHQQ  126 (129)
Q Consensus        68 kg~WT~eED~~L~~~v~~~G----------------~gRt~~qcr~Rw~~~L~p~ik~~~Wt~eEd~~Ll~~v~~  126 (129)
                      |++||+|||++|+++|..+|                +|||++|||+||+++|+|.+++++||++||.+|+.++..
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lpgRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~   75 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGN   75 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTSTTSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcCCCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhc
Confidence            68999999999999999876                699999999999999999999999999999988776543
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure