Citrus Sinensis ID: 047174


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
cccccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHcccccHHHHHHHHHHHHHHcccccccEEEEEEc
cccEEccccccccccccHHHHHHHHHHHHHHHHcccccccEccEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEc
mggivgkpesttsawmpeTKLEAKMVEAMQRRAAEGTALKSFNSIILkfpkiddsLRNCKAIFEKFGGLQNPLGVVIALR
mggivgkpesttsawmpeTKLEAKMVEAMQRRAAEgtalksfnsiiLKFPKIDDSLRNCKAIFekfgglqnplgvvialr
MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
************************************TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIA**
*******************************************SIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
******************TKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVVIALR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q52K82 231 Probable calcium-binding no no 0.887 0.307 0.661 3e-22
>sp|Q52K82|CML21_ARATH Probable calcium-binding protein CML21 OS=Arabidopsis thaliana GN=CML21 PE=2 SV=1 Back     alignment and function desciption
 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 57/71 (80%)

Query: 1  MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCK 60
          MGG V K E+    W+PETKLEAK++EA+QRRA+ GT +KSFNSI+LKFPKIDD LRNCK
Sbjct: 1  MGGAVTKSETLQKEWVPETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCK 60

Query: 61 AIFEKFGGLQN 71
          AIF++F    N
Sbjct: 61 AIFQEFDEDSN 71




Potential calcium sensor.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
225462035 232 PREDICTED: probable calcium-binding prot 0.887 0.306 0.746 9e-24
147819723 257 hypothetical protein VITISV_006244 [Viti 0.887 0.276 0.746 1e-23
363808176 229 uncharacterized protein LOC100820628 [Gl 0.887 0.310 0.704 7e-21
145334139 211 putative calcium-binding protein CML21 [ 0.887 0.336 0.661 8e-21
297788474142 predicted protein [Arabidopsis lyrata su 0.887 0.5 0.661 9e-21
145345290 231 putative calcium-binding protein CML21 [ 0.887 0.307 0.661 1e-20
297803450 229 calcium ion binding protein [Arabidopsis 0.887 0.310 0.661 1e-20
2982459 248 putative protein [Arabidopsis thaliana] 0.887 0.286 0.661 1e-20
255584410 227 Troponin C, skeletal muscle, putative [R 0.862 0.303 0.704 8e-20
357517327 227 hypothetical protein MTR_8g070510 [Medic 0.887 0.312 0.633 1e-18
>gi|225462035|ref|XP_002268527.1| PREDICTED: probable calcium-binding protein CML21 [Vitis vinifera] gi|296089985|emb|CBI39804.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 62/71 (87%)

Query: 1  MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCK 60
          MGG+VGK +S   AW+PETKLEAKMVEAMQRRA+EG+ +KSFNSIILKFPKID+SLRNCK
Sbjct: 1  MGGVVGKGDSPRKAWVPETKLEAKMVEAMQRRASEGSTMKSFNSIILKFPKIDESLRNCK 60

Query: 61 AIFEKFGGLQN 71
          AIF++F    N
Sbjct: 61 AIFQQFDEDSN 71




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147819723|emb|CAN71481.1| hypothetical protein VITISV_006244 [Vitis vinifera] Back     alignment and taxonomy information
>gi|363808176|ref|NP_001242483.1| uncharacterized protein LOC100820628 [Glycine max] gi|255642047|gb|ACU21290.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|145334139|ref|NP_001078450.1| putative calcium-binding protein CML21 [Arabidopsis thaliana] gi|110735789|dbj|BAE99871.1| hypothetical protein [Arabidopsis thaliana] gi|332659805|gb|AEE85205.1| putative calcium-binding protein CML21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297788474|ref|XP_002862334.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297307742|gb|EFH38592.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145345290|ref|NP_194377.2| putative calcium-binding protein CML21 [Arabidopsis thaliana] gi|75320017|sp|Q52K82.1|CML21_ARATH RecName: Full=Probable calcium-binding protein CML21; AltName: Full=Calmodulin-like protein 21 gi|62867639|gb|AAY17423.1| At4g26470 [Arabidopsis thaliana] gi|332659804|gb|AEE85204.1| putative calcium-binding protein CML21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297803450|ref|XP_002869609.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297315445|gb|EFH45868.1| calcium ion binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|2982459|emb|CAA18223.1| putative protein [Arabidopsis thaliana] gi|7269499|emb|CAB79502.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255584410|ref|XP_002532937.1| Troponin C, skeletal muscle, putative [Ricinus communis] gi|223527288|gb|EEF29441.1| Troponin C, skeletal muscle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357517327|ref|XP_003628952.1| hypothetical protein MTR_8g070510 [Medicago truncatula] gi|355522974|gb|AET03428.1| hypothetical protein MTR_8g070510 [Medicago truncatula] gi|388511046|gb|AFK43589.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
TAIR|locus:2131458 231 AT4G26470 [Arabidopsis thalian 0.825 0.285 0.696 1.9e-21
TAIR|locus:2093716 229 AT3G24110 [Arabidopsis thalian 0.587 0.205 0.46 3.1e-05
TAIR|locus:2131458 AT4G26470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 251 (93.4 bits), Expect = 1.9e-21, P = 1.9e-21
 Identities = 46/66 (69%), Positives = 56/66 (84%)

Query:     1 MGGIVGKPESTTSAWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCK 60
             MGG V K E+    W+PETKLEAK++EA+QRRA+ GT +KSFNSI+LKFPKIDD LRNCK
Sbjct:     1 MGGAVTKSETLQKEWVPETKLEAKIIEAVQRRASRGTTMKSFNSIVLKFPKIDDGLRNCK 60

Query:    61 AIFEKF 66
             AIF++F
Sbjct:    61 AIFQEF 66




GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0007165 "signal transduction" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000041 "transition metal ion transport" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0010359 "regulation of anion channel activity" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
TAIR|locus:2093716 AT3G24110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033450001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (232 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00029948001
SubName- Full=Chromosome undetermined scaffold_51, whole genome shotgun sequence; (562 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.81
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 96.74
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.2
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 95.08
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 94.05
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.96
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 93.02
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 92.62
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 92.08
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 91.95
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 91.66
KOG0027 151 consensus Calmodulin and related proteins (EF-Hand 91.6
cd0021388 S-100 S-100: S-100 domain, which represents the la 91.17
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 90.73
PTZ00183 158 centrin; Provisional 90.1
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 89.87
PTZ00184149 calmodulin; Provisional 89.46
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 89.12
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 88.19
PTZ00184 149 calmodulin; Provisional 87.55
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 87.19
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 87.14
cd0005267 EH Eps15 homology domain; found in proteins implic 85.16
KOG0041 244 consensus Predicted Ca2+-binding protein, EF-Hand 84.49
PTZ00183158 centrin; Provisional 83.79
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 82.57
KOG0044 193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 82.19
KOG4403 575 consensus Cell surface glycoprotein STIM, contains 82.07
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 81.3
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 80.94
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
Probab=96.81  E-value=0.0011  Score=34.71  Aligned_cols=18  Identities=11%  Similarity=0.067  Sum_probs=15.5

Q ss_pred             HHHHHHhhcCCCCCceee
Q 047174           59 CKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        59 ~R~vFeqfDeDsnGti~~   76 (80)
                      ++.+|++||.|.||.|+.
T Consensus         2 l~~~F~~~D~d~dG~I~~   19 (31)
T PF13405_consen    2 LREAFKMFDKDGDGFIDF   19 (31)
T ss_dssp             HHHHHHHH-TTSSSEEEH
T ss_pred             HHHHHHHHCCCCCCcCcH
Confidence            688999999999999975



...

>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.33
3k21_A 191 PFCDPK3, calcium-dependent protein kinase 3; calci 96.32
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 96.13
2lv7_A100 Calcium-binding protein 7; metal binding protein; 96.12
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 96.12
3mse_B 180 Calcium-dependent protein kinase, putative; CDPKS, 96.07
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 95.99
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 95.8
2lmt_A 148 Calmodulin-related protein 97A; spermatogenesis, m 95.79
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 95.78
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.72
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 95.7
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 95.62
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 95.62
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 95.62
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 95.57
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 95.52
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 95.48
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 95.46
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.46
2lvv_A 226 Flagellar calcium-binding protein TB-24; EF-hand, 95.4
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.36
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 95.33
1avs_A90 Troponin C; muscle contraction, calcium-activated, 95.32
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 95.32
3khe_A 191 Calmodulin-like domain protein kinase isoform 3; c 95.28
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.28
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 95.27
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 95.24
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 95.23
3cs1_A 219 Flagellar calcium-binding protein; myristoylated, 95.22
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 95.2
3i5g_B 153 Myosin regulatory light chain LC-2, mantle muscle; 95.18
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 95.17
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 95.16
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 95.08
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 95.03
3fwb_A161 Cell division control protein 31; gene gating, com 95.03
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.02
1q80_A 174 SCP, sarcoplasmic calcium-binding protein; all-alp 94.99
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 94.98
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.98
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.97
3j04_B 143 Myosin regulatory light chain 2, smooth muscle MA 94.96
1c07_A95 Protein (epidermal growth factor receptor pathway 94.95
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 94.94
2lhi_A 176 Calmodulin, serine/threonine-protein phosphatase c 94.94
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.93
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.9
3ll8_B 155 Calcineurin subunit B type 1; protein-peptide dock 94.88
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 94.87
2bec_A 202 Calcineurin B homologous protein 2; calcineurin-ho 94.87
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 94.85
2bl0_C 142 Myosin regulatory light chain; muscle protein, sli 94.76
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 94.72
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 94.71
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 94.7
2obh_A 143 Centrin-2; DNA repair complex EF hand superfamily 94.67
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 94.61
1qv0_A 195 Obelin, OBL; photoprotein, bioluminescence, atomic 94.61
1nya_A 176 Calerythrin; EF-hand, metal binding protein; NMR { 94.61
1uhk_A 191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 94.59
2hps_A 186 Coelenterazine-binding protein with bound coelent; 94.55
2ovk_B 153 RLC, myosin regulatory light chain LC-2, mantle mu 94.5
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 94.44
4ds7_A 147 Calmodulin, CAM; protein binding, metal binding, s 94.44
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 94.43
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 94.42
3akb_A 166 Putative calcium binding protein; EF-hand, metal b 94.35
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 94.3
2mys_C 149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.28
2sas_A 185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 94.26
2mys_B 166 Myosin; muscle protein, motor protein; HET: MLY; 2 94.21
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 94.18
3qrx_A 169 Centrin; calcium-binding, EF-hand, cell division, 94.12
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.12
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.12
3li6_A66 Calcium-binding protein; calcium signaling protein 94.11
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 94.1
1exr_A 148 Calmodulin; high resolution, disorder, metal trans 94.02
2k60_A 150 Protein (stromal interaction molecule 1); EF-hand, 94.01
1wdc_B 156 Scallop myosin; calcium binding protein, muscle pr 94.0
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 93.91
1w7j_B 151 Myosin light chain 1; motor protein, unconventiona 93.89
2l5y_A 150 Stromal interaction molecule 2; EF-hand, SAM domai 93.85
2ovk_C 159 Myosin catalytic light chain LC-1, mantle muscle, 93.76
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 93.75
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 93.67
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 93.64
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 93.62
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 93.61
2jnf_A 158 Troponin C; stretch activated muscle contraction, 93.59
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 93.59
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 93.48
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 93.43
2f2o_A 179 Calmodulin fused with calmodulin-binding domain of 93.42
2bl0_B 145 Myosin regulatory light chain; muscle protein, sli 93.38
2aao_A 166 CDPK, calcium-dependent protein kinase, isoform AK 93.28
3ox6_A 153 Calcium-binding protein 1; EF-hand, calcium-sensor 93.23
3dtp_E 196 RLC, myosin regulatory light chain; muscle protein 93.22
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 93.16
1top_A 162 Troponin C; contractIle system protein; 1.78A {Gal 93.14
2ccm_A 191 Calexcitin; EF hand, calcium, signaling protein; 1 93.13
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 93.11
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.92
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 92.91
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 92.82
1ggw_A 140 Protein (CDC4P); light chain, cytokinesis, cell cy 92.79
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 92.78
1exr_A148 Calmodulin; high resolution, disorder, metal trans 92.77
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 92.72
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 92.67
1dtl_A 161 Cardiac troponin C; helix-turn-helix, structural p 92.67
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 92.62
1wdc_C 156 Scallop myosin; calcium binding protein, muscle pr 92.62
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 92.56
3e3r_A 204 Calcyphosin, calcyphosine; human calcyphosine, EF- 92.55
3i5g_C 159 Myosin catalytic light chain LC-1, mantle muscle; 92.55
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 92.53
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 92.46
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 92.44
2znd_A 172 Programmed cell death protein 6; penta-EF-hand pro 92.42
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 92.42
3li6_A66 Calcium-binding protein; calcium signaling protein 92.39
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 92.38
3sjs_A 220 URE3-BP sequence specific DNA binding protein; EF- 92.31
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 92.3
3pm8_A 197 PFCDPK2, calcium-dependent protein kinase 2; malar 92.28
2qac_A 146 Myosin A tail domain interacting protein MTIP; mal 92.19
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 92.18
2hpk_A 208 Photoprotein berovin; structural genomics, PSI, pr 92.14
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 92.13
3a4u_B143 Multiple coagulation factor deficiency protein 2; 92.13
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 92.04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 91.99
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 91.98
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 91.93
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 91.93
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 91.87
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 91.86
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 91.82
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 91.82
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 91.63
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 91.6
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 91.49
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 91.49
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 91.33
1m45_A 148 MLC1P, myosin light chain; protein-peptide complex 91.33
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 91.28
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 91.14
2jnf_A158 Troponin C; stretch activated muscle contraction, 90.97
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 90.91
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 90.73
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 90.69
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 90.6
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 90.59
3fwb_A161 Cell division control protein 31; gene gating, com 90.59
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 90.55
3akb_A166 Putative calcium binding protein; EF-hand, metal b 90.45
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 90.36
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 90.28
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 90.28
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 90.18
2jq6_A139 EH domain-containing protein 1; metal binding prot 90.16
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 90.13
2ehb_A 207 Calcineurin B-like protein 4; protein complex, Ca( 90.11
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 89.93
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 89.93
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 89.86
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 89.78
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 89.74
3u0k_A 440 Rcamp; fluorescent protein, calcium binding, EF-ha 89.74
1y1x_A191 Leishmania major homolog of programmed cell death 89.61
1y1x_A 191 Leishmania major homolog of programmed cell death 89.6
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 89.5
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 89.49
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 89.4
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 89.36
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 89.33
2lv7_A100 Calcium-binding protein 7; metal binding protein; 89.33
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 89.32
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 89.29
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 89.19
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 89.12
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 89.11
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 89.07
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 89.06
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 89.03
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 89.01
1s6c_A 183 KV4 potassium channel-interacting protein kchip1B; 88.91
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 88.89
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 88.88
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 88.88
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 88.88
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 88.81
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 88.68
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 88.6
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 88.58
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 88.54
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 88.53
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 88.5
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 88.5
3dd4_A 229 KV channel-interacting protein 4; EF-hands protein 88.44
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 88.32
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 88.28
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 88.12
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 88.03
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 88.01
1avs_A90 Troponin C; muscle contraction, calcium-activated, 87.97
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 87.9
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 87.84
2zfd_A 226 Calcineurin B-like protein 2; calcium binding prot 87.73
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 87.43
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 87.43
2l2e_A 190 Calcium-binding protein NCS-1; NCS1P, myristoylate 87.42
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 87.4
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 87.35
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 87.26
1c07_A95 Protein (epidermal growth factor receptor pathway 87.26
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 87.16
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 87.12
2hps_A186 Coelenterazine-binding protein with bound coelent; 87.09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 86.81
1bjf_A 193 Neurocalcin delta; calcium-binding, myristoylation 86.7
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 86.7
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 86.64
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 86.6
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 86.54
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 86.46
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 86.13
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 86.09
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 85.84
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 85.69
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 85.66
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 85.61
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 85.46
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 85.35
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 85.14
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 85.12
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 85.08
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 84.94
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 84.48
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 84.46
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 84.43
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 84.42
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 84.36
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 84.36
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 84.21
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 84.15
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 83.78
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 83.62
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 83.55
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 83.26
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 83.01
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 82.92
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 82.83
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 82.82
2jul_A 256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 82.66
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 82.6
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 82.35
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 82.16
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 81.99
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 81.9
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 81.72
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 81.64
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 81.57
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 81.53
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 81.41
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 80.87
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 80.84
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 80.51
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 80.39
1dgu_A 183 Calcium-saturated CIB; helical, EF-hands, blood cl 80.09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 80.01
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
Probab=96.33  E-value=0.0028  Score=39.64  Aligned_cols=40  Identities=8%  Similarity=0.070  Sum_probs=20.5

Q ss_pred             CcccchhhhhhcCccchHhHHHHHHHHHhhcCCCCCceee
Q 047174           37 TALKSFNSIILKFPKIDDSLRNCKAIFEKFGGLQNPLGVV   76 (80)
Q Consensus        37 ~s~KSfnSIiMkFPkide~lr~~R~vFeqfDeDsnGti~~   76 (80)
                      -++.-|=.++.....-......++.+|+.||.|.+|.|+.
T Consensus        20 I~~~EF~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~I~~   59 (135)
T 3h4s_E           20 TKYEDMLPVMAEKMDVEEFVSELCKGFSLLADPERHLITA   59 (135)
T ss_dssp             CCC-----------CHHHHHHHHHHHHHHHSBTTTTBBCH
T ss_pred             EeHHHHHHHHHHHccccchHHHHHHHHHHHCCCCCCcCCH
Confidence            5666666666555555556677778888888888887753



>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.45
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.4
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.32
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 96.02
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 95.95
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 95.87
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.76
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.6
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 95.6
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 95.57
d2mysc_ 145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 95.51
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.47
d1qv0a_ 189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 95.37
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 95.28
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 95.16
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.14
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.07
d1nyaa_ 176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.05
d1uhka1 187 Calcium-regulated photoprotein {Jellyfish (Aequore 95.04
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.02
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.93
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 94.91
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 94.88
d1exra_ 146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.82
d1lkja_ 146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.76
d1fpwa_ 190 Frequenin (neuronal calcium sensor 1) {Baker's yea 94.7
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.69
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 94.65
d2scpa_ 174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 94.52
d1wdcb_ 142 Myosin Essential Chain {Bay scallop (Aequipecten i 94.48
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 94.46
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 94.33
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 94.3
d2mysb_ 145 Myosin Essential Chain {Chicken (Gallus gallus) [T 94.29
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 94.22
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.06
d2obha1 141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 94.03
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 93.83
d1topa_ 162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.76
d1s6ca_ 178 Kchip1, Kv4 potassium channel-interacting protein 93.66
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 93.61
d2sasa_ 185 Sarcoplasmic calcium-binding protein {Amphioxus (B 93.59
d1auib_ 165 Calcineurin regulatory subunit (B-chain) {Human (H 93.43
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 93.29
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 93.27
d1dtla_ 156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.19
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 93.18
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 92.88
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 92.88
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 92.87
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 92.74
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 92.62
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 92.53
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 92.44
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 92.43
d1jbaa_ 189 Guanylate cyclase activating protein 2, GCAP-2 {Co 92.37
d1ij5a_ 321 Cbp40 (plasmodial specific CaII-binding protein LA 92.32
d1wdcc_ 152 Myosin Regulatory Chain {Bay scallop (Aequipecten 92.27
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 92.04
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 91.98
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 91.8
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 91.73
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 91.72
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 91.63
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 91.45
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 91.37
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 91.35
d1g8ia_ 187 Frequenin (neuronal calcium sensor 1) {Human (Homo 91.34
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 91.07
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 91.0
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 90.83
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 90.74
d1ggwa_ 140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 90.73
d1s6ia_ 182 Calcium-dependent protein kinase sk5 CLD {Soybean 90.53
d1hqva_ 181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 90.31
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 90.3
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 90.23
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 90.03
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 89.88
d1omra_ 201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 89.87
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 89.63
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 89.42
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 89.37
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 89.19
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 89.18
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 89.16
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 89.06
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 89.04
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 89.04
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 88.67
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 88.57
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 88.43
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 88.39
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 88.32
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 88.16
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 88.0
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 87.96
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 87.6
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 87.42
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 87.28
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 87.13
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 86.88
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 86.61
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.58
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 86.56
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 86.38
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.23
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 86.09
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 85.87
d1y1xa_ 182 Programmed cell death 6 protein-like protein {Leis 85.85
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 85.68
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 85.5
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 84.97
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 84.92
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 84.9
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 84.59
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 84.59
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 84.01
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 83.93
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 83.59
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 83.42
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 82.99
d2zfda1 183 Calcineurin B-like protein 2 {Thale cress (Arabido 82.86
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 82.56
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 82.12
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 81.51
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 80.09
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Rattus norvegicus [TaxId: 10116]
Probab=96.45  E-value=0.001  Score=37.73  Aligned_cols=25  Identities=12%  Similarity=0.123  Sum_probs=21.6

Q ss_pred             hHhHHHHHHHHHhhcCCCCCceeee
Q 047174           53 DDSLRNCKAIFEKFGGLQNPLGVVI   77 (80)
Q Consensus        53 de~lr~~R~vFeqfDeDsnGti~~~   77 (80)
                      +|-+..+|.+|..||.|.+|.|+.-
T Consensus         4 ~eei~el~~~F~~~D~d~~G~I~~~   28 (73)
T d2pq3a1           4 EEQIAEFKEAFSLFDKDGDGTITTK   28 (73)
T ss_dssp             HHHHHHHHHHHHHTCTTSSSEEEGG
T ss_pred             HHHHHHHHHHHHHHcCCCCceEeHH
Confidence            4667899999999999999999853



>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure