Citrus Sinensis ID: 047203

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSEIDGT
ccccccEEEccccccccccccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccHHccccccccEEEccccccccccccccccccccccEEEcccccccccccHHHHHcccccccccccEEEcccccccccccccccccccccEEEccccccEEcccccccccccccEEEccccccccccccccccccccEEEcccccccEEEcHHHHcccccccEEEccccccccEEEEEccccccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccccEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccEEEccccEEEEEccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccEEEccccccccccccEEEcccccccccccHHHHcccccccccccccEEEEEEEEEEEcccEEEccccccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccc
cccccEEEEccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccccccHHHcccccccEEEEccccccccccHHHccHHHcccccccEEEEEccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHcccHEEEEEccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHHHHHccEEEcccccccccccHHHcccccEEEEEcccccccccccccccccEEEcccccccccccHHHHHHcccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHHHHcHcccEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHcccccccEEEcccccccccccHHHcccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccccccccccccHHHHccccccccccccccccccccc
MLRSLVELhlpncnlpippfhfpslnftslqvldlsnngfnskiphWLFNITrlssldlntndlqgdipdgfsslnslqqldltgnsflggrlsrnlgklcnlrtlklsrnsisGEVSDFINGlsectnsslLEKLELGFnqltgdlpnslgylknlrylelwdnsfvgsippsignlTFLKELYLssnqmngfpesfgqlsaievldldenqwegIITETHFrnlsnlkeislyKLSENISLIFNisshwippfklTFIKIrscqlgpkfptwlrnQTELTTLVLnnarisdtvpnwfWQLDLALDeldvgsnelsgripnslgfrfpgtvdlssnsfegplplwsfnvtklylnnnsfsgpiprdfgqkipfltdldisfnslngsvpksiGNLQQLLTLVISnnnlsgeipQLWSNISSLYILDmsnntlsgeipdsigCLLSVRFLILCNnhisgevppslkncsmmdsldlgdnqlsgnipawigesmpslSILRLRsnyfngtippelCKLSALHILDlshnnlsgfipscvgnfsrmkieppdsveyeGSLQVVLKGTQYVFYSTLYLVNLMdlssnnlsgempVELTRLIHLGtlnlsqnhlvgkiptqigklewlesldlsknklsgsippsmvSLTFMNHLNLSYnnlsgeipkvnqfqslkdpsiyegnlalcgdplpercseidgt
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITethfrnlsnLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLalcgdplpercseidgt
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSEIDGT
****LVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKL***IPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCG*************
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDP***********
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSEIDGT
*LRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLP*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSEIDGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query698 2.2.26 [Sep-21-2011]
Q9FL28 1173 LRR receptor-like serine/ no no 0.865 0.514 0.326 4e-73
Q9LYN8 1192 Leucine-rich repeat recep no no 0.936 0.548 0.329 5e-71
Q9C9H7847 Receptor-like protein 12 no no 0.928 0.765 0.320 5e-71
C0LGQ5 1249 LRR receptor-like serine/ no no 0.879 0.491 0.326 4e-69
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.869 0.484 0.331 2e-68
C0LGS2 1136 Probable LRR receptor-lik no no 0.892 0.548 0.335 6e-68
Q9SHI2 1101 Leucine-rich repeat recep no no 0.853 0.541 0.322 3e-64
Q9LP24 1120 Probable leucine-rich rep no no 0.928 0.578 0.294 8e-63
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.823 0.476 0.334 3e-61
Q9LHP4 1141 Receptor-like protein kin no no 0.845 0.517 0.313 6e-61
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function desciption
 Score =  276 bits (706), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 222/679 (32%), Positives = 347/679 (51%), Gaps = 75/679 (11%)

Query: 28  TSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGFSSLNSLQQLDLTGNS 87
           +SL ++    N    KIP  L ++  L       N L G IP    +L +L  LDL+GN 
Sbjct: 168 SSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQ 227

Query: 88  FLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDL 147
            L G++ R+ G L NL++L L+ N + G++       +E  N S L +LEL  NQLTG +
Sbjct: 228 -LTGKIPRDFGNLLNLQSLVLTENLLEGDIP------AEIGNCSSLVQLELYDNQLTGKI 280

Query: 148 PNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNG-FPESFGQLSAIEV 206
           P  LG L  L+ L ++ N    SIP S+  LT L  L LS N + G   E  G L ++EV
Sbjct: 281 PAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEV 340

Query: 207 LDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQ 266
           L L  N + G   ++    ++NL+ +++      +++ FN  S  +P        +R+  
Sbjct: 341 LTLHSNNFTGEFPQS----ITNLRNLTV------LTVGFNNISGELPADLGLLTNLRNLS 390

Query: 267 L------GPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRI 320
                  GP  P+ + N T L  L L++ +++  +P  F +++L    + +G N  +G I
Sbjct: 391 AHDNLLTGP-IPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMNLTF--ISIGRNHFTGEI 447

Query: 321 PNSLGFRFPG--TVDLSSNSFEGPLPLWSFNVTKLYL---NNNSFSGPIPRDFGQKIPFL 375
           P+ + F      T+ ++ N+  G L      + KL +   + NS +GPIPR+ G     L
Sbjct: 448 PDDI-FNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGN----L 502

Query: 376 TDLDISF---NSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNT 432
            DL+I +   N   G +P+ + NL  L  L + +N+L G IP+   ++  L +LD+SNN 
Sbjct: 503 KDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNK 562

Query: 433 LSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGES 492
            SG+IP     L S+ +L L  N  +G +P SLK+ S++++ D+ DN L+G IP  +  S
Sbjct: 563 FSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLAS 622

Query: 493 MPSLSI-LRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDS 551
           + ++ + L   +N   GTIP EL KL  +  +DLS+N  SG IP                
Sbjct: 623 LKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRS-------------- 668

Query: 552 VEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTR-LIHLGTLNLSQNHL 610
                     L+  + VF         +D S NNLSG +P E+ + +  + +LNLS+N  
Sbjct: 669 ----------LQACKNVFT--------LDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSF 710

Query: 611 VGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQS 670
            G+IP   G +  L SLDLS N L+G IP S+ +L+ + HL L+ NNL G +P+   F++
Sbjct: 711 SGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPESGVFKN 770

Query: 671 LKDPSIYEGNLALCGDPLP 689
           + + S   GN  LCG   P
Sbjct: 771 I-NASDLMGNTDLCGSKKP 788
Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Flagellin-binding to the receptor is the first step to initiate the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6), resulting in enhanced resistance against pathogens. Binding to the effector AvrPto1 from Pseudomonas syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query698
359488583 958 PREDICTED: LRR receptor-like serine/thre 0.997 0.726 0.654 0.0
359484185 990 PREDICTED: LRR receptor-like serine/thre 0.995 0.702 0.64 0.0
147789266 925 hypothetical protein VITISV_040339 [Viti 0.995 0.751 0.64 0.0
359496390 1113 PREDICTED: LRR receptor-like serine/thre 0.978 0.613 0.634 0.0
359488639 1097 PREDICTED: LRR receptor-like serine/thre 0.978 0.622 0.632 0.0
359488641 1012 PREDICTED: LRR receptor-like serine/thre 0.981 0.676 0.625 0.0
225451409 1007 PREDICTED: leucine-rich repeat receptor 0.972 0.674 0.626 0.0
359496388 1014 PREDICTED: brassinosteroid LRR receptor 0.971 0.668 0.620 0.0
359496717 1014 PREDICTED: brassinosteroid LRR receptor 0.971 0.668 0.617 0.0
359496701 904 PREDICTED: LRR receptor-like serine/thre 0.972 0.751 0.620 0.0
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/700 (65%), Positives = 564/700 (80%), Gaps = 4/700 (0%)

Query: 2   LRSLVELHLPNCNLPIPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNT 61
           L SL+ELH+PNC L       P LNFTSL +LDLSNNGF+S IPHWLFN++ L  LDLN+
Sbjct: 183 LPSLLELHMPNCQLSNLSLSLPFLNFTSLSILDLSNNGFDSTIPHWLFNLSSLVYLDLNS 242

Query: 62  NDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFI 121
           N+LQG +PD F +  SLQ LDL+ NS + G L R LG LC LRTL LS N +SGE+++F+
Sbjct: 243 NNLQGGLPDAFQNFTSLQLLDLSKNSNIEGELPRTLGNLCYLRTLILSVNKLSGEIAEFL 302

Query: 122 NGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFL 181
           +GLS C+ S+L E L+LGFN+LTG+LP+SLG+LKNLRYL+LW NSF GSIP SIG+L+ L
Sbjct: 303 DGLSACSYSTL-ENLDLGFNKLTGNLPDSLGHLKNLRYLQLWSNSFRGSIPESIGSLSSL 361

Query: 182 KELYLSSNQMNGF-PESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSEN 240
           +ELYLS NQM G  P+S GQLS++ VL+L+EN WEG+ITE HF NLS+LK++S+ K S N
Sbjct: 362 QELYLSQNQMGGIIPDSLGQLSSLVVLELNENSWEGVITEAHFANLSSLKQLSITKSSPN 421

Query: 241 ISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFW 300
           +SL+FNISS W PPFKLT+I +RSCQLGPKFPTWLR Q ELTT+VLNNA IS T+P+W W
Sbjct: 422 VSLVFNISSDWAPPFKLTYINLRSCQLGPKFPTWLRTQNELTTIVLNNAGISGTIPDWLW 481

Query: 301 QLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSF 360
           +LDL L ELD+  N+LSGR+PNSL F +   VDLSSN F+GPLPLWS NV+ LYL  N F
Sbjct: 482 KLDLQLSELDIAYNQLSGRVPNSLVFSYLANVDLSSNLFDGPLPLWSSNVSTLYLRGNLF 541

Query: 361 SGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNI 420
           SGPIP++ GQ +P LTDLDIS+NSLNGS+P S+G+LQ L+TLVISNNNLSGEIPQ W+ +
Sbjct: 542 SGPIPQNIGQVMPILTDLDISWNSLNGSIPLSMGDLQALITLVISNNNLSGEIPQFWNKM 601

Query: 421 SSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQ 480
            SLYI+DMSNN+LSG IP S+G L ++RFL+L NN++SGE+P  L+NCS+++SLDLGDN+
Sbjct: 602 PSLYIVDMSNNSLSGTIPRSLGSLTALRFLVLSNNNLSGELPSQLQNCSVLESLDLGDNK 661

Query: 481 LSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGN 540
            SGNIP+WIGESMPSL IL L+SN+F+G IP E+C LSALHILDLSHN++SGFIP C GN
Sbjct: 662 FSGNIPSWIGESMPSLLILALQSNFFSGNIPSEICALSALHILDLSHNHVSGFIPPCFGN 721

Query: 541 FSRMKIEPPDS--VEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLI 598
            S  K E  D     YEG L++V KG    +YSTLYLVN +DLS+N+LSGE+P+ELT L+
Sbjct: 722 LSGFKSELSDDDLERYEGRLKLVAKGRALEYYSTLYLVNSLDLSNNSLSGEIPIELTSLL 781

Query: 599 HLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNL 658
            LGTLNLS N+L G IP +IG L+WLE+LDLSKNKLSG IP SM S+TF+ HLNL++NNL
Sbjct: 782 KLGTLNLSSNNLGGNIPEKIGNLQWLETLDLSKNKLSGPIPMSMASITFLVHLNLAHNNL 841

Query: 659 SGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSEIDGT 698
           SG+IP  NQFQ+L DPSIY+GNLALCG PL   C + +GT
Sbjct: 842 SGKIPTGNQFQTLIDPSIYQGNLALCGFPLTTECHDNNGT 881

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789266|emb|CAN71149.1| hypothetical protein VITISV_040339 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496390|ref|XP_002268557.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488639|ref|XP_003633795.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488641|ref|XP_003633796.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225451409|ref|XP_002273126.1| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496388|ref|XP_003635224.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496717|ref|XP_003635312.1| PREDICTED: brassinosteroid LRR receptor kinase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496701|ref|XP_003635305.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like, partial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query698
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.971 0.749 0.436 3.9e-147
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.929 0.800 0.357 6.7e-88
TAIR|locus:2005629 1140 AT1G75640 [Arabidopsis thalian 0.954 0.584 0.332 6.4e-83
TAIR|locus:2825384847 RLP12 "AT1G71400" [Arabidopsis 0.919 0.757 0.328 4.2e-79
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.958 0.656 0.330 6.2e-78
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.939 0.659 0.317 1e-75
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.924 0.515 0.33 1.9e-75
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.942 0.579 0.325 1.1e-74
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.921 0.734 0.320 1.2e-74
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.909 0.532 0.349 1.3e-74
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1437 (510.9 bits), Expect = 3.9e-147, P = 3.9e-147
 Identities = 303/694 (43%), Positives = 436/694 (62%)

Query:     2 LRSLVELHLPNCNLP-IPPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLN 60
             + +L ELHL N  L  +PP    S +   L+VLDLS N  NS IP+WLF +T L  L L 
Sbjct:   220 ISALKELHLFNSELKNLPPTLSSSADLKLLEVLDLSENSLNSPIPNWLFGLTNLRKLFLR 279

Query:    61 TNDLQGDIPDGFSSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDF 120
              + LQG IP GF +L  L+ LDL+ N  L G +   LG L  L+ L LS N ++G++  F
Sbjct:   280 WDFLQGSIPTGFKNLKLLETLDLSNNLALQGEIPSVLGDLPQLKFLDLSANELNGQIHGF 339

Query:   121 INGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTF 180
             ++  S    +SL+  L+L  N+L G LP SLG L+NL+ L+L  NSF GS+P SIGN+  
Sbjct:   340 LDAFSRNKGNSLVF-LDLSSNKLAGTLPESLGSLRNLQTLDLSSNSFTGSVPSSIGNMAS 398

Query:   181 LKELYLSSNQMNG-FPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSE 239
             LK+L LS+N MNG   ES GQL+ +  L+L  N W G++ ++HF NL +LK I L     
Sbjct:   399 LKKLDLSNNAMNGTIAESLGQLAELVDLNLMANTWGGVLQKSHFVNLRSLKSIRL-TTEP 457

Query:   240 NISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPN-W 298
               SL+F + S WIPPF+L  I+I +C++G  FP WL+ QT+L  + L N  I DT+P+ W
Sbjct:   458 YRSLVFKLPSTWIPPFRLELIQIENCRIG-LFPMWLQVQTKLNFVTLRNTGIEDTIPDSW 516

Query:   299 FWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNN 358
             F  +   +  L + +N + GR+P  L F    T+DLSSN+FEG  PLWS N T+L L  N
Sbjct:   517 FSGISSKVTYLILANNRIKGRLPQKLAFPKLNTIDLSSNNFEGTFPLWSTNATELRLYEN 576

Query:   359 SFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWS 418
             +FSG +P++    +P +  + +  NS  G++P S+  +  L  L +  N+ SG  P+ W 
Sbjct:   577 NFSGSLPQNIDVLMPRMEKIYLFSNSFTGNIPSSLCEVSGLQILSLRKNHFSGSFPKCWH 636

Query:   419 NISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGD 478
                 L+ +D+S N LSGEIP+S+G L S+  L+L  N + G++P SL+NCS + ++DLG 
Sbjct:   637 RQFMLWGIDVSENNLSGEIPESLGMLPSLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGG 696

Query:   479 NQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCV 538
             N+L+G +P+W+G+ + SL +LRL+SN F G IP +LC +  L ILDLS N +SG IP C+
Sbjct:   697 NKLTGKLPSWVGK-LSSLFMLRLQSNSFTGQIPDDLCNVPNLRILDLSGNKISGPIPKCI 755

Query:   539 GNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLI 598
              N + +     + V ++  + +V +  +Y       + N ++LS NN+SGE+P E+  L+
Sbjct:   756 SNLTAIARGTNNEV-FQNLVFIVTRAREYEA-----IANSINLSGNNISGEIPREILGLL 809

Query:   599 HLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNL 658
             +L  LNLS+N + G IP +I +L  LE+LDLSKNK SG+IP S  +++ +  LNLS+N L
Sbjct:   810 YLRILNLSRNSMAGSIPEKISELSRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKL 869

Query:   659 SGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERC 692
              G IPK+ +FQ   DPSIY GN  LCG PLP++C
Sbjct:   870 EGSIPKLLKFQ---DPSIYIGNELLCGKPLPKKC 900
GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005629 AT1G75640 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00037833001
SubName- Full=Chromosome chr14 scaffold_9, whole genome shotgun sequence; (735 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-71
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-57
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-29
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  248 bits (634), Expect = 8e-71
 Identities = 208/662 (31%), Positives = 315/662 (47%), Gaps = 121/662 (18%)

Query: 26  NFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDG-FSSLNSLQQLDLT 84
           N + +  +DLS    + KI   +F +  + +++L+ N L G IPD  F++ +SL+ L+L+
Sbjct: 67  NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLS 126

Query: 85  GNSFLGGRLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLT 144
            N+F G   S   G + NL TL LS N +SGE+ + I   S       L+ L+LG N L 
Sbjct: 127 NNNFTG---SIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSS------LKVLDLGGNVLV 177

Query: 145 GDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNG-FPESFGQLSA 203
           G +PNSL  L +L +L L  N  VG IP  +G +  LK +YL  N ++G  P   G L++
Sbjct: 178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS 237

Query: 204 IEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIR 263
           +  LDL  N   G I  +   NL NL+ + LY+         N  S  IPP   +  K+ 
Sbjct: 238 LNHLDLVYNNLTGPIPSS-LGNLKNLQYLFLYQ---------NKLSGPIPPSIFSLQKLI 287

Query: 264 SCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNS 323
           S                                            LD+  N LSG IP  
Sbjct: 288 S--------------------------------------------LDLSDNSLSGEIPE- 302

Query: 324 LGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFN 383
                              L +   N+  L+L +N+F+G IP      +P L  L +  N
Sbjct: 303 -------------------LVIQLQNLEILHLFSNNFTGKIPVAL-TSLPRLQVLQLWSN 342

Query: 384 SLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGC 443
             +G +PK++G    L  L +S NNL+GEIP+   +  +L+ L + +N+L GEIP S+G 
Sbjct: 343 KFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGA 402

Query: 444 LLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRS 503
             S+R + L +N  SGE+P       ++  LD+ +N L G I +   + MPSL +L L  
Sbjct: 403 CRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD-MPSLQMLSLAR 461

Query: 504 NYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLK 563
           N F G + P+      L  LDLS N  SG +P  +G+ S +             +Q    
Sbjct: 462 NKFFGGL-PDSFGSKRLENLDLSRNQFSGAVPRKLGSLSEL-------------MQ---- 503

Query: 564 GTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEW 623
                          + LS N LSGE+P EL+    L +L+LS N L G+IP    ++  
Sbjct: 504 ---------------LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPV 548

Query: 624 LESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLAL 683
           L  LDLS+N+LSG IP ++ ++  +  +N+S+N+L G +P    F ++   ++  GN+ L
Sbjct: 549 LSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAV-AGNIDL 607

Query: 684 CG 685
           CG
Sbjct: 608 CG 609

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 698
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.97
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.9
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.79
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.77
KOG4237498 consensus Extracellular matrix protein slit, conta 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.71
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.54
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.19
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.11
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.03
PLN03150623 hypothetical protein; Provisional 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.96
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.89
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.89
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.84
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.84
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.84
PLN03150623 hypothetical protein; Provisional 98.82
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.79
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.66
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.62
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
PRK15386 426 type III secretion protein GogB; Provisional 98.28
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.28
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.15
KOG4341483 consensus F-box protein containing LRR [General fu 98.12
KOG4341483 consensus F-box protein containing LRR [General fu 97.98
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.93
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.91
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.82
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.78
PRK15386 426 type III secretion protein GogB; Provisional 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.65
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.6
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.59
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.3
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.07
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.91
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.85
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.1
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.46
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.25
KOG4308478 consensus LRR-containing protein [Function unknown 93.64
KOG3864221 consensus Uncharacterized conserved protein [Funct 92.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.45
KOG4308478 consensus LRR-containing protein [Function unknown 91.11
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 87.75
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.61
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.52
smart0037026 LRR Leucine-rich repeats, outliers. 86.52
smart0037026 LRR Leucine-rich repeats, outliers. 86.06
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.06
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.52
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.66
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-55  Score=508.69  Aligned_cols=542  Identities=36%  Similarity=0.597  Sum_probs=458.9

Q ss_pred             CCCCcEEECCCCCCCCCCCccccCCCCCCEEEcccCcccccCCccc-cCCCCCcEEECCCCCCCCcccchhccCCCCCCE
Q 047203           27 FTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPDGF-SSLNSLQQLDLTGNSFLGGRLSRNLGKLCNLRT  105 (698)
Q Consensus        27 ~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~-~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~  105 (698)
                      ..+++.|+|+++.+++..+.+|..+++|++|++++|.+.+.+|..+ .++++|++|++++|.+ .+..|  .+.+++|++
T Consensus        68 ~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l-~~~~p--~~~l~~L~~  144 (968)
T PLN00113         68 SSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNF-TGSIP--RGSIPNLET  144 (968)
T ss_pred             CCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCcc-ccccC--ccccCCCCE
Confidence            3579999999999988888899999999999999999987777665 5899999999999984 33333  256889999


Q ss_pred             EeCcCccCCCccchhhccccccccCCCCcEEEccCCcccccCCccccCCCCCcEEEccCceeeecCCCCCcCcccCCeee
Q 047203          106 LKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELY  185 (698)
Q Consensus       106 L~l~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~i~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~  185 (698)
                      |++++|.+.+..+..+..+.      +|++|++++|.+.+..|..+.++++|++|++++|.+.+..|..++++++|++|+
T Consensus       145 L~Ls~n~~~~~~p~~~~~l~------~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  218 (968)
T PLN00113        145 LDLSNNMLSGEIPNDIGSFS------SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIY  218 (968)
T ss_pred             EECcCCcccccCChHHhcCC------CCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEE
Confidence            99999998877766666655      899999999998888899999999999999999999888899999999999999


Q ss_pred             ccCcccCc-cccccCCCCCCcEEEccCCeeeeecCchhhcCCCCccEEecccccccceeeeecCCCccCCcceeEEEecc
Q 047203          186 LSSNQMNG-FPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRS  264 (698)
Q Consensus       186 l~~~~~~~-~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~  264 (698)
                      +++|.+.. +|..+.++++|++|++++|.+.+..+. .+.++++|+.|.+..                            
T Consensus       219 L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~----------------------------  269 (968)
T PLN00113        219 LGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPS-SLGNLKNLQYLFLYQ----------------------------  269 (968)
T ss_pred             CcCCccCCcCChhHhcCCCCCEEECcCceeccccCh-hHhCCCCCCEEECcC----------------------------
Confidence            99999875 888899999999999999988765554 566666666666544                            


Q ss_pred             ccCCccCCccccCCCCccEEEccCCcCcCCCCchhhhhccCCcEEEeccccccccCCCCcCCCCCCeEECCCCCCcCCCC
Q 047203          265 CQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVDLSSNSFEGPLP  344 (698)
Q Consensus       265 ~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~~~~l~~l~l~~~~~~~~~~  344 (698)
                      |.+....|.++..+++|+.|++++|.+....+..+... +                                        
T Consensus       270 n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l-~----------------------------------------  308 (968)
T PLN00113        270 NKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQL-Q----------------------------------------  308 (968)
T ss_pred             CeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCC-C----------------------------------------
Confidence            45555677778888889999998888776665544332 3                                        


Q ss_pred             CcccCccEEEcccCcccccCCcchhcCCCCCCEEEccCCcCCCCCCccccCccCCcEEEeeCCccccCcCccCCCCCCcc
Q 047203          345 LWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLY  424 (698)
Q Consensus       345 ~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~  424 (698)
                          +|+.|++++|.+.+..+..+. .+++|+.|++++|.+.+..+..+..+++|+.|++++|.+.+..|..+..+++|+
T Consensus       309 ----~L~~L~l~~n~~~~~~~~~~~-~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~  383 (968)
T PLN00113        309 ----NLEILHLFSNNFTGKIPVALT-SLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLF  383 (968)
T ss_pred             ----CCcEEECCCCccCCcCChhHh-cCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCC
Confidence                344444444444444444433 478888888888888877777788888999999999988877888888889999


Q ss_pred             EEEcccCccccccCccccccCCCcEEEccCCeeeeeCCCCCCCCCCCCEEEcCCCcCcccCchhhhhcCCCCcEEEccCC
Q 047203          425 ILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSN  504 (698)
Q Consensus       425 ~L~L~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~L~l~~~  504 (698)
                      .|++++|.+.+..+..+..+++|+.|++++|.+++..|..+..+++|+.|++++|.+.+.++..... +++|+.|++++|
T Consensus       384 ~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~-l~~L~~L~L~~n  462 (968)
T PLN00113        384 KLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWD-MPSLQMLSLARN  462 (968)
T ss_pred             EEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhcc-CCCCcEEECcCc
Confidence            9999999998888888888999999999999998888888999999999999999998777766554 899999999999


Q ss_pred             cccccCChhhccCCCCCEEECCCCcCccCCCcccccccCCCcCCCCCcccccceEEeecccceeeeccccccCeEEcCCC
Q 047203          505 YFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDLSSN  584 (698)
Q Consensus       505 ~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~l~l~~n  584 (698)
                      .+.+.+|..+ ..++|++|++++|.+.+..|..+.++++|                                +.|++++|
T Consensus       463 ~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l~~L--------------------------------~~L~Ls~N  509 (968)
T PLN00113        463 KFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSLSEL--------------------------------MQLKLSEN  509 (968)
T ss_pred             eeeeecCccc-ccccceEEECcCCccCCccChhhhhhhcc--------------------------------CEEECcCC
Confidence            9987777655 46899999999999998888777766666                                88999999


Q ss_pred             cCCccCChhhhccCCCCEEeCCCCcccccCCccccCCCCCCeEeccCCcccccCCcCccCCCCCCeEecccceeeecCCC
Q 047203          585 NLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPK  664 (698)
Q Consensus       585 ~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~sL~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~  664 (698)
                      .+.+..|..+.++++|++|+|++|.+++.+|..+..+++|++|++++|.+.+.+|..+..+++|+.+++++|++.+.+|.
T Consensus       510 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        510 KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCCccccCCCCCcCCC
Q 047203          665 VNQFQSLKDPSIYEGNLALCGDP  687 (698)
Q Consensus       665 ~~~~~~~~~~~~~~~~~~~~~~~  687 (698)
                      .|++.++...+ |.|++.+|++.
T Consensus       590 ~~~~~~~~~~~-~~~n~~lc~~~  611 (968)
T PLN00113        590 TGAFLAINASA-VAGNIDLCGGD  611 (968)
T ss_pred             cchhcccChhh-hcCCccccCCc
Confidence            99999998877 99999999865

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-58
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-10
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-57
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-21
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 9e-09
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 6e-08
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-04
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-08
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 6e-04
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 9e-08
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 6e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-07
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-07
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 4e-07
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 4e-07
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-06
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 1e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 6e-06
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-05
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 1e-04
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-04
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 1e-04
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-04
3b2d_A 603 Crystal Structure Of Human Rp105MD-1 Complex Length 3e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 6e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 6e-04
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 8e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 8e-04
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 9e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  222 bits (565), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 227/720 (31%), Positives = 354/720 (49%), Gaps = 105/720 (14%)
Query: 35  LSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPD--GFSSLNSLQQLDLTGNSF-LGG 91
           LSN+  N  +  +  + + L+SLDL+ N L G +       S + L+ L+++ N+    G
Sbjct: 84  LSNSHINGSVSGFKCSAS-LTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPG 142
Query: 92  RLSRNLGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSL 151
           ++S  L KL +L  L LS NSISG     + G         L+ L +  N+++GD+   +
Sbjct: 143 KVSGGL-KLNSLEVLDLSANSISGAN---VVGWVLSDGCGELKHLAISGNKISGDV--DV 196
Query: 152 GYLKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNG-FPESFGQLSAIEVLDLD 210
               NL +L++  N+F   IP  +G+ + L+ L +S N+++G F  +    + +++L++ 
Sbjct: 197 SRCVNLEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNIS 255
Query: 211 ENQWEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPF------KLTFIKIRS 264
            NQ+ G I     ++L            + +SL  N  +  IP F       LT + +  
Sbjct: 256 SNQFVGPIPPLPLKSL------------QYLSLAENKFTGEIPDFLSGACDTLTGLDLSG 303
Query: 265 CQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSL 324
                  P +  + + L +L L++   S  +P         L  LD+  NE SG +P SL
Sbjct: 304 NHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESL 363
Query: 325 GFRFPG--TVDLSSNSFEGP-LPLWSFN----VTKLYLNNNSFSGPIPRDFGQKIPFLTD 377
                   T+DLSSN+F GP LP    N    + +LYL NN F+G IP         L  
Sbjct: 364 TNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL-SNCSELVS 422
Query: 378 LDISFNSLNGSVPKSIGNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEI 437
           L +SFN L+G++P S+G+L +L  L            +LW N+            L GEI
Sbjct: 423 LHLSFNYLSGTIPSSLGSLSKLRDL------------KLWLNM------------LEGEI 458
Query: 438 PDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLS 497
           P  +  + ++  LIL  N ++GE+P  L NC+ ++ + L +N+L+G IP WIG  + +L+
Sbjct: 459 PQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGR-LENLA 517
Query: 498 ILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCV--------GNF-------- 541
           IL+L +N F+G IP EL    +L  LDL+ N  +G IP+ +         NF        
Sbjct: 518 ILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVY 577
Query: 542 ---SRMKIEPPDS---VEYEG--SLQV--------------VLKGTQYVFYSTLYLVNLM 579
                MK E   +   +E++G  S Q+              V  G     +     +  +
Sbjct: 578 IKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFL 637
Query: 580 DLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIP 639
           D+S N LSG +P E+  + +L  LNL  N + G IP ++G L  L  LDLS NKL G IP
Sbjct: 638 DMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIP 697
Query: 640 PSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERC--SEIDG 697
            +M +LT +  ++LS NNLSG IP++ QF++   P+ +  N  LCG PLP RC  S  DG
Sbjct: 698 QAMSALTMLTEIDLSNNNLSGPIPEMGQFETFP-PAKFLNNPGLCGYPLP-RCDPSNADG 755
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query698
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-170
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-108
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-71
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-40
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-39
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-72
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-66
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-19
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-71
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-42
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-69
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-56
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-40
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-35
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-63
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-56
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-55
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-60
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-59
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-55
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-56
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-44
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-25
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-49
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-44
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-40
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-14
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-38
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-38
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-33
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-31
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-26
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-27
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-23
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-26
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-21
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 7e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-25
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 7e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-24
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-21
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-22
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-21
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-12
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-18
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-05
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-19
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-18
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-15
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-07
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-04
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-14
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-09
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-13
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 9e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-05
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  506 bits (1305), Expect = e-170
 Identities = 211/713 (29%), Positives = 315/713 (44%), Gaps = 57/713 (7%)

Query: 2   LRSLVELHLPNCNL--PIPPFHFPSLNFTSLQVLDLSNNGFNSKIP--HWLFNITRLSSL 57
           L  L  L L N ++   +  F        SL  LDLS N  +  +     L + + L  L
Sbjct: 76  LTGLESLFLSNSHINGSVSGF----KCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFL 131

Query: 58  DLNTNDLQGDIPD-GFSSLNSLQQLDLTGNSFLGGRLS--RNLGKLCNLRTLKLSRNSIS 114
           ++++N L       G   LNSL+ LDL+ NS  G  +           L+ L +S N IS
Sbjct: 132 NVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKIS 191

Query: 115 GEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKNLRYLELWDNSFVGSIPPS 174
           G+V      +S C N   LE L++  N  +  +P  LG    L++L++  N   G    +
Sbjct: 192 GDVD-----VSRCVN---LEFLDVSSNNFSTGIP-FLGDCSALQHLDISGNKLSGDFSRA 242

Query: 175 IGNLTFLKELYLSSNQMNG-FPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEIS 233
           I   T LK L +SSNQ  G  P     L +++ L L EN++ G I +        L  + 
Sbjct: 243 ISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLD 300

Query: 234 LY--KLSENI-SLIFNISSHWIPPFKLTFIKIRSCQLGPKFPT-WLRNQTELTTLVLNNA 289
           L        +     + S        L  + + S     + P   L     L  L L+  
Sbjct: 301 LSGNHFYGAVPPFFGSCSL-------LESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN 353

Query: 290 RISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPG---TVDLSSNSFEGPLPLW 346
             S  +P     L  +L  LD+ SN  SG I  +L          + L +N F G +P  
Sbjct: 354 EFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPT 413

Query: 347 SFNVTKL---YLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSIGNLQQLLTLV 403
             N ++L   +L+ N  SG IP   G  +  L DL +  N L G +P+ +  ++ L TL+
Sbjct: 414 LSNCSELVSLHLSFNYLSGTIPSSLG-SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLI 472

Query: 404 ISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPP 463
           +  N+L+GEIP   SN ++L  + +SNN L+GEIP  IG L ++  L L NN  SG +P 
Sbjct: 473 LDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPA 532

Query: 464 SLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHIL 523
            L +C  +  LDL  N  +G IPA + +        ++ +N+  G     +         
Sbjct: 533 ELGDCRSLIWLDLNTNLFNGTIPAAMFKQS-----GKIAANFIAGKRYVYIKNDGMKKEC 587

Query: 524 DLSHN--NLSGFIPSCVGNFSRMKIEPPDSVEYEGSLQVVLKGTQYVFYSTLYLVNLMDL 581
             + N     G     +   S        S  Y G                   +  +D+
Sbjct: 588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFD--------NNGSMMFLDM 639

Query: 582 SSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPS 641
           S N LSG +P E+  + +L  LNL  N + G IP ++G L  L  LDLS NKL G IP +
Sbjct: 640 SYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA 699

Query: 642 MVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERCSE 694
           M +LT +  ++LS NNLSG IP++ QF++   P+ +  N  LCG PLP     
Sbjct: 700 MSALTMLTEIDLSNNNLSGPIPEMGQFETF-PPAKFLNNPGLCGYPLPRCDPS 751
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query698
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.71
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.69
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.67
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.61
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.53
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.46
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.39
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.34
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.29
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.29
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.07
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.84
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.77
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.49
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.41
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.12
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.99
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.36
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.47
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.35
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 80.05
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-69  Score=607.84  Aligned_cols=655  Identities=32%  Similarity=0.454  Sum_probs=448.1

Q ss_pred             cceEEeCCCCCCCC----CCCCCCCCCCCCCcEEECCCCCCCCCCCccccCCCCCCEEEcccCcccccCCc--cccCCCC
Q 047203            4 SLVELHLPNCNLPI----PPFHFPSLNFTSLQVLDLSNNGFNSKIPHWLFNITRLSSLDLNTNDLQGDIPD--GFSSLNS   77 (698)
Q Consensus         4 ~L~~L~l~~~~~~~----~~~~~~~~~~~~L~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~--~~~~l~~   77 (698)
                      +++.|+|+++.+.+    ++  ..+.++++|+.++++.+.+. ..|..|..+++|++|++++|.+.+..|.  .++++++
T Consensus        51 ~v~~L~L~~~~l~g~~~~l~--~~l~~L~~L~~l~~~~~~~~-~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~  127 (768)
T 3rgz_A           51 KVTSIDLSSKPLNVGFSAVS--SSLLSLTGLESLFLSNSHIN-GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSG  127 (768)
T ss_dssp             EEEEEECTTSCCCEEHHHHH--HHTTTCTTCCEEECTTSCEE-ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTT
T ss_pred             cEEEEECCCCCcCCccCccC--hhHhccCcccccCCcCCCcC-CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCC
Confidence            46667777666654    23  24456666777776666654 2455677777777777777777666666  6677777


Q ss_pred             CcEEECCCCCCCCcccchh-ccCCCCCCEEeCcCccCCCccchhhccccccccCCCCcEEEccCCcccccCCccccCCCC
Q 047203           78 LQQLDLTGNSFLGGRLSRN-LGKLCNLRTLKLSRNSISGEVSDFINGLSECTNSSLLEKLELGFNQLTGDLPNSLGYLKN  156 (698)
Q Consensus        78 L~~L~l~~~~~~~~~~~~~-~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~~~~~~~L~~L~l~~~~i~~~~~~~~~~l~~  156 (698)
                      |++|++++|.+ ....+.. +.++++|++|++++|.+++..+..+..+.   ++++|++|++++|.+.+..+  +..+++
T Consensus       128 L~~L~Ls~n~l-~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~---~l~~L~~L~Ls~n~l~~~~~--~~~l~~  201 (768)
T 3rgz_A          128 LKFLNVSSNTL-DFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD---GCGELKHLAISGNKISGDVD--VSRCVN  201 (768)
T ss_dssp             CCEEECCSSEE-ECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTT---CCTTCCEEECCSSEEESCCB--CTTCTT
T ss_pred             CCEEECcCCcc-CCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhc---cCCCCCEEECCCCcccccCC--cccCCc
Confidence            77777777763 2233333 36677777777777766655444321111   22257777777776664433  256677


Q ss_pred             CcEEEccCceeeecCCCCCcCcccCCeeeccCcccCc-cccccCCCCCCcEEEccCCeeeeecCchhhcCCCCccEEecc
Q 047203          157 LRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNG-FPESFGQLSAIEVLDLDENQWEGIITETHFRNLSNLKEISLY  235 (698)
Q Consensus       157 L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~-~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~  235 (698)
                      |++|++++|.+.+..|. ++.+++|++|++++|.++. +|..+..+++|+.|++++|.+.+..+..   .+++|++|++.
T Consensus       202 L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L~L~  277 (768)
T 3rgz_A          202 LEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---PLKSLQYLSLA  277 (768)
T ss_dssp             CCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC---CCTTCCEEECC
T ss_pred             CCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc---ccCCCCEEECc
Confidence            77777777776655554 6677777777777777664 5666677777777777777665544431   45555555555


Q ss_pred             cccccceeeeecCCCccC-CcceeEEEeccccCCccCCccccCCCCccEEEccCCcCcCCCCchhhhhccCCcEEEeccc
Q 047203          236 KLSENISLIFNISSHWIP-PFKLTFIKIRSCQLGPKFPTWLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSN  314 (698)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~-~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~  314 (698)
                      ++    ......+..+.. +++|++|++++|.+....|.++..+++|++|++++|.+.+..+.......++|++|++++|
T Consensus       278 ~n----~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n  353 (768)
T 3rgz_A          278 EN----KFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFN  353 (768)
T ss_dssp             SS----EEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSS
T ss_pred             CC----ccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCC
Confidence            41    111122223322 2445555555555444445555555555555555555443333332222244445555444


Q ss_pred             cccccCCCCcCCCCCCeEECCCCCCcCCCCCcccCccEEEcccCcccccCCcchhc-CCCCCCEEEccCCcCCCCCCccc
Q 047203          315 ELSGRIPNSLGFRFPGTVDLSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQ-KIPFLTDLDISFNSLNGSVPKSI  393 (698)
Q Consensus       315 ~l~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~-~~~~L~~L~L~~~~~~~~~~~~~  393 (698)
                      .+.+.++..+..                   ...+|+.|++++|.+.+..+..+.. .+++|++|++++|.+.+..+..+
T Consensus       354 ~l~~~~p~~l~~-------------------l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l  414 (768)
T 3rgz_A          354 EFSGELPESLTN-------------------LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL  414 (768)
T ss_dssp             EEEECCCTTHHH-------------------HTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGG
T ss_pred             ccCccccHHHHh-------------------hhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHH
Confidence            444433332211                   0126777777777776666555443 25678888888887776677777


Q ss_pred             cCccCCcEEEeeCCccccCcCccCCCCCCccEEEcccCccccccCccccccCCCcEEEccCCeeeeeCCCCCCCCCCCCE
Q 047203          394 GNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDS  473 (698)
Q Consensus       394 ~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~  473 (698)
                      .++++|+.|++++|.+.+..|..+..+++|++|++++|.+.+..+..+..+++|++|++++|.+.+..|..+..+++|++
T Consensus       415 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~  494 (768)
T 3rgz_A          415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNW  494 (768)
T ss_dssp             GGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             hcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCE
Confidence            77888888888888877777777888888888888888887777777778888888888888887777777888888888


Q ss_pred             EEcCCCcCcccCchhhhhcCCCCcEEEccCCcccccCChhhccCCCCCEEECCCCcCccCCCcccccccCCCcCCCCCcc
Q 047203          474 LDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSALHILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVE  553 (698)
Q Consensus       474 L~L~~n~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~~~~~~~~  553 (698)
                      |++++|++.+.+|..+.. +++|+.|++++|++.+.+|..+..+++|++|++++|++.+.+|..+.....+.........
T Consensus       495 L~L~~N~l~~~~p~~~~~-l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~  573 (768)
T 3rgz_A          495 ISLSNNRLTGEIPKWIGR-LENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGK  573 (768)
T ss_dssp             EECCSSCCCSCCCGGGGG-CTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSC
T ss_pred             EEccCCccCCcCChHHhc-CCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccc
Confidence            888888887777776655 8888888888888887788888888888888888888888777777665554433221100


Q ss_pred             c--------------------------------------ccceEEeecccceeeeccccccCeEEcCCCcCCccCChhhh
Q 047203          554 Y--------------------------------------EGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELT  595 (698)
Q Consensus       554 ~--------------------------------------~~~~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~l~  595 (698)
                      .                                      .......+.+.....+..+++|+.||+++|.+++.+|..+.
T Consensus       574 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~  653 (768)
T 3rgz_A          574 RYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIG  653 (768)
T ss_dssp             EEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGG
T ss_pred             cccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHh
Confidence            0                                      00000112233334566788999999999999999999999


Q ss_pred             ccCCCCEEeCCCCcccccCCccccCCCCCCeEeccCCcccccCCcCccCCCCCCeEecccceeeecCCCCCccccCCCCc
Q 047203          596 RLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKLSGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPS  675 (698)
Q Consensus       596 ~l~~L~~L~l~~n~~~~~~~~~l~~l~sL~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~~~~~~~~~~~  675 (698)
                      ++++|+.|+|++|.+++.+|+.++.+++|++|++++|++.+.+|+.+..+++|+.|+|++|++++.+|..++++++..++
T Consensus       654 ~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~  733 (768)
T 3rgz_A          654 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAK  733 (768)
T ss_dssp             GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGG
T ss_pred             ccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             cccCCCCCcCCCCCCCCccccC
Q 047203          676 IYEGNLALCGDPLPERCSEIDG  697 (698)
Q Consensus       676 ~~~~~~~~~~~~~~~~~~~~~~  697 (698)
                       |.||+.+|++|+. .|....|
T Consensus       734 -~~gN~~Lcg~~l~-~C~~~~~  753 (768)
T 3rgz_A          734 -FLNNPGLCGYPLP-RCDPSNA  753 (768)
T ss_dssp             -GCSCTEEESTTSC-CCCSCC-
T ss_pred             -hcCCchhcCCCCc-CCCCCcc
Confidence             9999999999998 9987765
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 698
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-12
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-14
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-12
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.003
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-11
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-09
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 7e-06
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 9e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 86.6 bits (213), Expect = 9e-19
 Identities = 62/382 (16%), Positives = 121/382 (31%), Gaps = 34/382 (8%)

Query: 154 LKNLRYLELWDNSFVGSIPPSIGNLTFLKELYLSSNQMNGFPESFGQLSAIEVLDLDENQ 213
           L       L   +   ++  +  +L  +  L      +    +    L+ +  ++   NQ
Sbjct: 21  LAEKMKTVLGKTNVTDTVSQT--DLDQVTTLQADRLGIKSI-DGVEYLNNLTQINFSNNQ 77

Query: 214 WEGIITETHFRNLSNLKEISLYKLSENISLIFNISSHWIPPFKLTFIKIRSCQLGPKFPT 273
              I      +NL+ L +I +              ++                L      
Sbjct: 78  LTDIT---PLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNL 134

Query: 274 WLRNQTELTTLVLNNARISDTVPNWFWQLDLALDELDVGSNELSGRIPNSLGFRFPGTVD 333
                +  T   ++      ++    +             N+++   P +          
Sbjct: 135 NRLELSSNTISDISALSGLTSLQQLSFG------------NQVTDLKPLANLTTLERLDI 182

Query: 334 LSSNSFEGPLPLWSFNVTKLYLNNNSFSGPIPRDFGQKIPFLTDLDISFNSLNGSVPKSI 393
            S+   +  +     N+  L   NN  S   P      +  L +L ++ N L      ++
Sbjct: 183 SSNKVSDISVLAKLTNLESLIATNNQISDITPLGI---LTNLDELSLNGNQLKD--IGTL 237

Query: 394 GNLQQLLTLVISNNNLSGEIPQLWSNISSLYILDMSNNTLSGEIPDSIGCLLSVRFLILC 453
            +L  L  L ++NN +S   P   S ++ L  L +  N +S   P  +  L ++  L L 
Sbjct: 238 ASLTNLTDLDLANNQISNLAP--LSGLTKLTELKLGANQISNISP--LAGLTALTNLELN 293

Query: 454 NNHISGEVPPSLKNCSMMDSLDLGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPE 513
            N +    P    N   +  L L  N +S   P     S+  L  L   +N    +    
Sbjct: 294 ENQLEDISPI--SNLKNLTYLTLYFNNISDISPV---SSLTKLQRLFFANNKV--SDVSS 346

Query: 514 LCKLSALHILDLSHNNLSGFIP 535
           L  L+ ++ L   HN +S   P
Sbjct: 347 LANLTNINWLSAGHNQISDLTP 368
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query698
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.62
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.31
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.14
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.62
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.09
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.03
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.95  E-value=7.6e-27  Score=232.13  Aligned_cols=257  Identities=33%  Similarity=0.573  Sum_probs=182.2

Q ss_pred             CcEEEeeCCcccc--CcCccCCCCCCccEEEccc-CccccccCccccccCCCcEEEccCCeeeeeCCCCCCCCCCCCEEE
Q 047203          399 LLTLVISNNNLSG--EIPQLWSNISSLYILDMSN-NTLSGEIPDSIGCLLSVRFLILCNNHISGEVPPSLKNCSMMDSLD  475 (698)
Q Consensus       399 L~~L~l~~~~~~~--~~~~~~~~l~~L~~L~L~~-n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~  475 (698)
                      ++.|+++++.+.+  .+|..+.++++|++|++++ |.+.+.+|..+..+++|++|++++|.+.+..+..+..++.|+.++
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~  131 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLD  131 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEE
T ss_pred             EEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccc
Confidence            4444444444433  2344555555555555554 445545555555556666666666665555555555666666666


Q ss_pred             cCCCcCcccCchhhhhcCCCCcEEEccCCcccccCChhhccCCCC-CEEECCCCcCccCCCcccccccCCCcCCCCCccc
Q 047203          476 LGDNQLSGNIPAWIGESMPSLSILRLRSNYFNGTIPPELCKLSAL-HILDLSHNNLSGFIPSCVGNFSRMKIEPPDSVEY  554 (698)
Q Consensus       476 L~~n~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L-~~L~l~~~~~~~~~~~~~~~l~~L~~~~~~~~~~  554 (698)
                      +++|.+.+.+|..+.. ++.++.+++++|.+.+.+|..+..+..+ +.+++++|.+.+..|..+.++..           
T Consensus       132 l~~N~~~~~~p~~l~~-l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~-----------  199 (313)
T d1ogqa_         132 FSYNALSGTLPPSISS-LPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNL-----------  199 (313)
T ss_dssp             CCSSEEESCCCGGGGG-CTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCC-----------
T ss_pred             cccccccccCchhhcc-Ccccceeecccccccccccccccccccccccccccccccccccccccccccc-----------
Confidence            6666655555555443 6666666666666666666666666554 66777777776666655543322           


Q ss_pred             ccceEEeecccceeeeccccccCeEEcCCCcCCccCChhhhccCCCCEEeCCCCcccccCCccccCCCCCCeEeccCCcc
Q 047203          555 EGSLQVVLKGTQYVFYSTLYLVNLMDLSSNNLSGEMPVELTRLIHLGTLNLSQNHLVGKIPTQIGKLEWLESLDLSKNKL  634 (698)
Q Consensus       555 ~~~~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~l~~l~sL~~L~l~~~~~  634 (698)
                                            ..++++.+...+..+..+..+++|+.+++++|.+.+..+ .+..+++|+.|++++|++
T Consensus       200 ----------------------~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l  256 (313)
T d1ogqa_         200 ----------------------AFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRI  256 (313)
T ss_dssp             ----------------------SEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCC
T ss_pred             ----------------------ccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCee
Confidence                                  347777777777888888889999999999999986544 578889999999999999


Q ss_pred             cccCCcCccCCCCCCeEecccceeeecCCCCCccccCCCCccccCCCCCcCCCCCCCC
Q 047203          635 SGSIPPSMVSLTFMNHLNLSYNNLSGEIPKVNQFQSLKDPSIYEGNLALCGDPLPERC  692 (698)
Q Consensus       635 ~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  692 (698)
                      .+.+|+.++++++|++|+|++|++++.+|..+.+++|+.+. +.+|..+|+.|++ .|
T Consensus       257 ~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~-l~~N~~l~g~plp-~c  312 (313)
T d1ogqa_         257 YGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSA-YANNKCLCGSPLP-AC  312 (313)
T ss_dssp             EECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGG-TCSSSEEESTTSS-CC
T ss_pred             cccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHH-hCCCccccCCCCC-CC
Confidence            99999999999999999999999999999999999999888 8899999999886 56
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure