Citrus Sinensis ID: 047332

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610----
MASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQKKDRE
cccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEcEEEEcccccEEEEEccccccEEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccEEcccHHHHccccccEEEcccccccccccccccccccccEEEEEcccccccccHHccccccccEEEccccccEEcccHHHHcccccccEEccccccEEcccccccccccccEEEcccccccccccccccccccccEEcccccccEEcccHHHccccccccccccccccEEcccHHHHccccccEEEcccccccccccccccccccccEEEccccEEccccccccccccccccEEccccEEEcccccccccccccccEEccccEEcccccccccccccccEEEccccEEEEEccHHcccccccccEEccccEEEEcccccccccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEccccccccccccHHHHccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccc
ccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEcccccccccccHHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEcccccEEccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHccccEEEccccEEEEccHHHccccccccEEEccccEEcccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHccc
MASDSSKETFALLKWKRSLQNKNISLLSswtlhpdnasnvpsyskskispcawlgiscnqAGRVISINLSsmalngtlqefafssfphlvqlnlsfniffgiippqignlsklqyldlgsnqlsgvippeighlnQLRILYFDvnqlhgsippeigQLSLINVLALCHNnlygsipsslgnlsnlanfyfnnnslfdsiplvlgnlnslstmdlsqnqfsgsiplslgnlsnlgILYLysnsfsgsipSIIGNLKSLLQldlsenqligsiplsfgnlsRLTLMSLFNNllsgslppilgnlKSLSALGLHInqlsgvipssignLSSLRALYLYnnglcgfvpEEIRYLKSLSELELCKNHlsgviphsigNLTGLLLLNMCEnhlsgpipksfknLTSVERVLLNQnnlsgkvyeafgdhpnltflnlsqnnfcgeisfnwrnfpklGTFIVSVnnisgsippeigdspklqvldlssnsivgeipvqlgKLFSLNKLILNLnqlsggmplelgsltelQYLDLSANKlkssipksIGNLLRLRYLdlsnnqfghkiPIELEKLIHLSeldlsynflgeeipfqicnvKSLEKLNLCHNnllgsfqqkkdre
MASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHnnllgsfqqkkdre
MASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFsgsiplslgnlsnlgilylysnsFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQKKDRE
*********FALLKWKRSLQNKNISLLSSWTLHP***********SKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIG**PKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLG*********
**SDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQKKD**
*********FALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQKKDRE
*****SKETFALLKWKRSLQNKN*SLLSSW*********VPSY**SKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQKKDRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query614 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep yes no 0.956 0.524 0.416 1e-127
Q8VZG8 1045 Probable LRR receptor-lik no no 0.964 0.566 0.436 1e-125
Q9FL28 1173 LRR receptor-like serine/ no no 0.952 0.498 0.378 7e-93
Q9SHI2 1101 Leucine-rich repeat recep no no 0.962 0.536 0.370 3e-92
P93194 1109 Receptor-like protein kin N/A no 0.902 0.499 0.377 2e-88
Q9LVP0 1102 Probable leucine-rich rep no no 0.931 0.519 0.361 3e-88
C0LGR3 1091 Probable LRR receptor-lik no no 0.952 0.536 0.366 7e-82
O49318 1124 Probable leucine-rich rep no no 0.907 0.495 0.374 2e-81
Q9LHP4 1141 Receptor-like protein kin no no 0.959 0.516 0.360 4e-81
Q9SSL9 1123 Leucine-rich repeat recep no no 0.928 0.507 0.335 4e-80
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score =  457 bits (1176), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 289/694 (41%), Positives = 393/694 (56%), Gaps = 107/694 (15%)

Query: 8   ETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISI 67
           E  ALLKWK +  N   S LSSW +H  N       + +  S  +W G+SCN  G +  +
Sbjct: 33  EANALLKWKSTFTNS--SKLSSW-VHDAN-------TNTSFSCTSWYGVSCNSRGSIEEL 82

Query: 68  NLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSNQLSGVI 127
           NL++  + GT Q+F F S  +L  ++LS N+  G IPPQ GNLSKL Y DL +N L+G I
Sbjct: 83  NLTNTGIEGTFQDFPFISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEI 142

Query: 128 PPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLAN 187
            P +G+L  L +LY   N L   IP E+G +  +  LAL  N L GSIPSSLGNL NL  
Sbjct: 143 SPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMV 202

Query: 188 FYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNSFSGSI 247
            Y   N L   IP  LGN+ S++ + LSQN+ +GSIP +LGNL NL +LYLY N  +G I
Sbjct: 203 LYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVI 262

Query: 248 PSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLF-------------------- 287
           P  IGN++S+  L LS+N+L GSIP S GNL  LTL+SLF                    
Sbjct: 263 PPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMID 322

Query: 288 ----NNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCG-- 341
               NN L+GS+P  LGNLK+L+ L L+ N L+GVIP  +GN+ S+  L L NN L G  
Sbjct: 323 LELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSI 382

Query: 342 ----------------------FVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGL-- 377
                                  +P+E+  ++S+  L+L +N L+G +P S GN T L  
Sbjct: 383 PSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLES 442

Query: 378 ------------------------LLLN-----------MCE-----------NHLSGPI 391
                                   L+L+           +C+           NHL GPI
Sbjct: 443 LYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPI 502

Query: 392 PKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGT 451
           PKS ++  S+ R     N  +G ++EAFG +P+L F++ S N F GEIS NW   PKLG 
Sbjct: 503 PKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGA 562

Query: 452 FIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGM 511
            I+S NNI+G+IP EI +  +L  LDLS+N++ GE+P  +G L +L++L LN NQLSG +
Sbjct: 563 LIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRV 622

Query: 512 PLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSE 571
           P  L  LT L+ LDLS+N   S IP++  + L+L  ++LS N+F   IP  L KL  L++
Sbjct: 623 PAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIP-RLSKLTQLTQ 681

Query: 572 LDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLG 605
           LDLS+N L  EIP Q+ +++SL+KL+L HNNL G
Sbjct: 682 LDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSG 715

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query614
225456159 1038 PREDICTED: probable LRR receptor-like se 0.946 0.559 0.533 1e-159
225456161 1037 PREDICTED: probable LRR receptor-like se 0.946 0.560 0.537 1e-159
147767326 1032 hypothetical protein VITISV_008862 [Viti 0.978 0.582 0.526 1e-146
359491509 1032 PREDICTED: probable LRR receptor-like se 0.978 0.582 0.523 1e-144
359491512 1078 PREDICTED: probable LRR receptor-like se 0.946 0.538 0.496 1e-142
147772402 996 hypothetical protein VITISV_022117 [Viti 0.916 0.565 0.494 1e-137
255545702 1008 receptor protein kinase, putative [Ricin 0.939 0.572 0.482 1e-132
297846638 1123 hypothetical protein ARALYDRAFT_473694 [ 0.959 0.524 0.425 1e-131
359484864 1091 PREDICTED: probable LRR receptor-like se 0.959 0.539 0.470 1e-129
15219699 1120 putative leucine-rich repeat receptor-li 0.956 0.524 0.416 1e-126
>gi|225456159|ref|XP_002278561.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  569 bits (1467), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 323/605 (53%), Positives = 414/605 (68%)

Query: 1   MASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQ 60
           ++S S++ET ALLKWK SLQN N S L SW L+P+N++N  ++  +  SPC W GISCN 
Sbjct: 27  VSSYSNEETQALLKWKASLQNHNHSSLLSWDLYPNNSTNSSTHLGTATSPCKWYGISCNH 86

Query: 61  AGRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGS 120
           AG VI INL+   LNGTL +F+FSSFP+L  +++S N   G IPPQIG L +L+YLDL  
Sbjct: 87  AGSVIKINLTESGLNGTLMDFSFSSFPNLAYVDISMNNLSGPIPPQIGLLFELKYLDLSI 146

Query: 121 NQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLG 180
           NQ SG IP EIG L  L +L+   NQL+GSIP EIGQL+ +  LAL  N L GSIP+SLG
Sbjct: 147 NQFSGGIPSEIGLLTNLEVLHLVQNQLNGSIPHEIGQLASLYELALYTNQLEGSIPASLG 206

Query: 181 NLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYS 240
           NLSNLA+ Y   N L  SIP  +GNL +L  +  + N  +G IP + GNL  L +LYL++
Sbjct: 207 NLSNLASLYLYENQLSGSIPPEMGNLTNLVEIYSNNNNLTGPIPSTFGNLKRLTVLYLFN 266

Query: 241 NSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILG 300
           NS SG IP  IGNLKSL +L L EN L G IP+S  +LS LTL+ L+ N LSG +P  +G
Sbjct: 267 NSLSGPIPPEIGNLKSLQELSLYENNLSGPIPVSLCDLSGLTLLHLYANQLSGPIPQEIG 326

Query: 301 NLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCK 360
           NLKSL  L L  NQL+G IP+S+GNL++L  L+L +N L G++P+EI  L  L  LE+  
Sbjct: 327 NLKSLVDLELSENQLNGSIPTSLGNLTNLEILFLRDNQLSGYIPQEIGKLHKLVVLEIDT 386

Query: 361 NHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFG 420
           N L G +P  I     L+   + +NHLSGPIPKS KN  ++ R L   N L+G + E  G
Sbjct: 387 NQLFGSLPEGICQAGSLVRFAVSDNHLSGPIPKSLKNCRNLTRALFQGNRLTGNISEVVG 446

Query: 421 DHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSS 480
           D PNL F++LS N F GE+S NW   P+L    ++ NNI+GSIP + G S  L +LDLSS
Sbjct: 447 DCPNLEFIDLSYNRFHGELSHNWGRCPQLQRLEIAGNNITGSIPEDFGISTNLTLLDLSS 506

Query: 481 NSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIG 540
           N +VGEIP ++G L SL  LILN NQLSG +P ELGSL+ L+YLDLSAN+L  SIP+ +G
Sbjct: 507 NHLVGEIPKKMGSLTSLLGLILNDNQLSGSIPPELGSLSHLEYLDLSANRLNGSIPEHLG 566

Query: 541 NLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCH 600
           + L L YL+LSNN+  H IP+++ KL HLS+LDLS+N L   IP QI  ++SLE L+L H
Sbjct: 567 DCLDLHYLNLSNNKLSHGIPVQMGKLSHLSQLDLSHNLLAGGIPPQIQGLQSLEMLDLSH 626

Query: 601 NNLLG 605
           NNL G
Sbjct: 627 NNLCG 631

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456161|ref|XP_002278590.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147767326|emb|CAN68996.1| hypothetical protein VITISV_008862 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491509|ref|XP_002278522.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491512|ref|XP_002278614.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147772402|emb|CAN73988.1| hypothetical protein VITISV_022117 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545702|ref|XP_002513911.1| receptor protein kinase, putative [Ricinus communis] gi|223546997|gb|EEF48494.1| receptor protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297846638|ref|XP_002891200.1| hypothetical protein ARALYDRAFT_473694 [Arabidopsis lyrata subsp. lyrata] gi|297337042|gb|EFH67459.1| hypothetical protein ARALYDRAFT_473694 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359484864|ref|XP_002273966.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g08850-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|15219699|ref|NP_174809.1| putative leucine-rich repeat receptor-like protein [Arabidopsis thaliana] gi|75175345|sp|Q9LP24.1|Y1571_ARATH RecName: Full=Probable leucine-rich repeat receptor-like protein kinase At1g35710; Flags: Precursor gi|8778966|gb|AAF79881.1|AC021198_1 Contains similarity to receptor protein kinase-like protein from Arabidopsis thaliana gb|AL161513. It contains a eukaryotic protein kinase domain PF|00069. EST gb|AI997574 comes from this gene [Arabidopsis thaliana] gi|332193703|gb|AEE31824.1| putative leucine-rich repeat receptor-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query614
TAIR|locus:2138268 1045 AT4G08850 [Arabidopsis thalian 0.962 0.565 0.422 3.9e-115
TAIR|locus:2011339 1120 AT1G35710 [Arabidopsis thalian 0.871 0.477 0.418 2.5e-104
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.949 0.497 0.364 1.2e-88
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.959 0.540 0.356 1.3e-84
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.936 0.521 0.350 2.7e-84
TAIR|locus:2020417 1101 AT1G17230 [Arabidopsis thalian 0.840 0.468 0.394 3.6e-82
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.959 0.516 0.354 3.6e-82
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.967 0.528 0.350 1.2e-81
TAIR|locus:2182870 1192 EMS1 "EXCESS MICROSPOROCYTES1" 0.959 0.494 0.369 2.3e-80
TAIR|locus:2154344 1135 AT5G48940 [Arabidopsis thalian 0.938 0.507 0.351 1.1e-79
TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1135 (404.6 bits), Expect = 3.9e-115, P = 3.9e-115
 Identities = 255/604 (42%), Positives = 360/604 (59%)

Query:     3 SDSSKETFALLKWKRSLQNK-NISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQA 61
             S + +E  ALLKWK +  N+ + S LSSW ++P    N  S+  S      W G++C+  
Sbjct:    45 SATVEEANALLKWKSTFTNQTSSSKLSSW-VNP----NTSSFCTS------WYGVACS-L 92

Query:    62 GRVISINLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLGSN 121
             G +I +NL++  + GT ++F FSS P+L  ++LS N F G I P  G  SKL+Y DL  N
Sbjct:    93 GSIIRLNLTNTGIEGTFEDFPFSSLPNLTFVDLSMNRFSGTISPLWGRFSKLEYFDLSIN 152

Query:   122 QLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGN 181
             QL G IPPE+G L+ L  L+   N+L+GSIP EIG+L+ +  +A+  N L G IPSS GN
Sbjct:   153 QLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGN 212

Query:   182 LSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFXXXXXXXXXXXXXXXXXXXXXX 241
             L+ L N Y   NSL  SIP  +GNL +L  + L +N                        
Sbjct:   213 LTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFEN 272

Query:   242 XFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGN 301
               SG IP  IGN+ +L  L L  N+L G IP + GN+  L ++ L+ N L+GS+PP LG 
Sbjct:   273 QLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGE 332

Query:   302 LKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKN 361
             ++S+  L +  N+L+G +P S G L++L  L+L +N L G +P  I     L+ L+L  N
Sbjct:   333 MESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTN 392

Query:   362 HLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGD 421
             + +G +P +I     L  L + +NH  GP+PKS ++  S+ RV    N+ SG + EAFG 
Sbjct:   393 NFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGV 452

Query:   422 HPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSN 481
             +P L F++LS NNF G++S NW    KL  FI+S N+I+G+IPPEI +  +L  LDLSSN
Sbjct:   453 YPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSN 512

Query:   482 SIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGN 541
              I GE+P  +  +  ++KL LN N+LSG +P  +  LT L+YLDLS+N+  S IP ++ N
Sbjct:   513 RITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNN 572

Query:   542 LLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHN 601
             L RL Y++LS N     IP  L KL  L  LDLSYN L  EI  Q  ++++LE+L+L HN
Sbjct:   573 LPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHN 632

Query:   602 NLLG 605
             NL G
Sbjct:   633 NLSG 636
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006857 "oligopeptide transport" evidence=RCA
GO:0006995 "cellular response to nitrogen starvation" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0031347 "regulation of defense response" evidence=RCA
TAIR|locus:2011339 AT1G35710 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020417 AT1G17230 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2182870 EMS1 "EXCESS MICROSPOROCYTES1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154344 AT5G48940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-95
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-38
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-34
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 5e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-06
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  311 bits (799), Expect = 8e-95
 Identities = 228/620 (36%), Positives = 307/620 (49%), Gaps = 92/620 (14%)

Query: 12  LLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVIS----- 66
           LL +K S+ +  +  LS+W               S    C W GI+CN + RV+S     
Sbjct: 34  LLSFKSSINDP-LKYLSNWN--------------SSADVCLWQGITCNNSSRVVSIDLSG 78

Query: 67  -------------------INLSSMALNGTLQEFAFSSFPHLVQLNLSFNIFFGIIPPQI 107
                              INLS+  L+G + +  F++   L  LNLS N F G IP   
Sbjct: 79  KNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR-- 136

Query: 108 GNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALC 167
           G++  L+ LDL +N LSG IP +IG  + L++L    N L G IP  +  L+ +  L L 
Sbjct: 137 GSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLA 196

Query: 168 HNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSL 227
            N L G IP  LG + +L   Y   N+L   IP  +G L SL+ +DL  N  +G IP SL
Sbjct: 197 SNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL 256

Query: 228 GNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLF 287
           GNL NL  L+LY N  SG IP  I +L+ L+ LDLS+N L G IP     L  L ++ LF
Sbjct: 257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLF 316

Query: 288 NNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEEI 347
           +N  +G +P  L +L  L  L L  N+ SG IP ++G  ++L  L L  N L G +PE  
Sbjct: 317 SNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPE-- 374

Query: 348 RYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLN 407
                     LC          S GNL  L+L +   N L G IPKS     S+ RV L 
Sbjct: 375 ---------GLC----------SSGNLFKLILFS---NSLEGEIPKSLGACRSLRRVRLQ 412

Query: 408 QNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEI-SFNWRNFPKLGTFIVSVNNISGSIPPE 466
            N+ SG++   F   P + FL++S NN  G I S  W                       
Sbjct: 413 DNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKW----------------------- 449

Query: 467 IGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDL 526
             D P LQ+L L+ N   G +P   G    L  L L+ NQ SG +P +LGSL+EL  L L
Sbjct: 450 --DMPSLQMLSLARNKFFGGLPDSFGSK-RLENLDLSRNQFSGAVPRKLGSLSELMQLKL 506

Query: 527 SANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQ 586
           S NKL   IP  + +  +L  LDLS+NQ   +IP    ++  LS+LDLS N L  EIP  
Sbjct: 507 SENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKN 566

Query: 587 ICNVKSLEKLNLCHNNLLGS 606
           + NV+SL ++N+ HN+L GS
Sbjct: 567 LGNVESLVQVNISHNHLHGS 586

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 614
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
PLN03150623 hypothetical protein; Provisional 99.58
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.24
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.15
PLN03150623 hypothetical protein; Provisional 99.14
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.08
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.08
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.07
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.98
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.72
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.64
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.48
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.48
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.39
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.09
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.08
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.91
PRK15386 426 type III secretion protein GogB; Provisional 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.81
PRK15386 426 type III secretion protein GogB; Provisional 97.76
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.68
KOG4341483 consensus F-box protein containing LRR [General fu 97.6
KOG4341483 consensus F-box protein containing LRR [General fu 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.53
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.52
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.49
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.36
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.19
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.09
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.0
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.87
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.69
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.38
KOG4308 478 consensus LRR-containing protein [Function unknown 94.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.35
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.28
KOG4308 478 consensus LRR-containing protein [Function unknown 93.29
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.17
KOG3864221 consensus Uncharacterized conserved protein [Funct 91.19
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.31
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.19
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 86.86
smart0037026 LRR Leucine-rich repeats, outliers. 86.86
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 86.16
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.02
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.15
smart0037026 LRR Leucine-rich repeats, outliers. 84.15
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.3e-70  Score=626.82  Aligned_cols=579  Identities=36%  Similarity=0.570  Sum_probs=530.3

Q ss_pred             CchHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCCcccCcccc
Q 047332            4 DSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGTLQEFAF   83 (614)
Q Consensus         4 ~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~c~w~~~~c~~~~~v~~l~l~~~~l~~~~~~~~~   83 (614)
                      ..++|++||++||+++.+ |.+.+++|+  .            ..+||.|.|+.|+..++|+.|+++++.+.|.++. +|
T Consensus        26 ~~~~~~~~l~~~~~~~~~-~~~~~~~w~--~------------~~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~-~~   89 (968)
T PLN00113         26 LHAEELELLLSFKSSIND-PLKYLSNWN--S------------SADVCLWQGITCNNSSRVVSIDLSGKNISGKISS-AI   89 (968)
T ss_pred             CCHHHHHHHHHHHHhCCC-CcccCCCCC--C------------CCCCCcCcceecCCCCcEEEEEecCCCccccCCh-HH
Confidence            467899999999999975 667788996  3            5689999999999888999999999999999877 89


Q ss_pred             cCCCCCcEEECCCCCCCccCccccc-CCCCCCEEeCCCCCCCCCCCcCCCCCCCCCEEEcccccCCCCCCccccCCCCCc
Q 047332           84 SSFPHLVQLNLSFNIFFGIIPPQIG-NLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLIN  162 (614)
Q Consensus        84 ~~l~~L~~L~Ls~~~~~~~~~~~l~-~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~  162 (614)
                      ..+++|++|+|++|.+.+.+|..+. .+++|++|++++|.+++.+|.  +.+++|++|++++|.+.+.+|..++++++|+
T Consensus        90 ~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~  167 (968)
T PLN00113         90 FRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLSGEIPNDIGSFSSLK  167 (968)
T ss_pred             hCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCcccccCChHHhcCCCCC
Confidence            9999999999999999988887654 999999999999999988875  5689999999999999999999999999999


Q ss_pred             EEEeccccCCCCCCcccCCCCCCcEEEeecCCCcccCCccccCCCCCCeeeccCccCCccCCccccCCCCCCeEEcccCc
Q 047332          163 VLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGILYLYSNS  242 (614)
Q Consensus       163 ~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~~  242 (614)
                      +|++++|.+.+.+|..++++++|++|++++|.+.+.+|..++++++|+.|++++|.+.+..|..+..+++|++|++++|.
T Consensus       168 ~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~  247 (968)
T PLN00113        168 VLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNN  247 (968)
T ss_pred             EEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccchhccCCCCCCEEeccCCcCccccCccccCCCCCCEEecCCCcccccCCccCCCCCCCCEeecCCCcccccCCcc
Q 047332          243 FSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQLSGVIPSS  322 (614)
Q Consensus       243 ~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~  322 (614)
                      +.+.+|..+.++++|++|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+..+++|+.|++++|.+.+..|..
T Consensus       248 l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~  327 (968)
T PLN00113        248 LTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVA  327 (968)
T ss_pred             eccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChh
Confidence            99999999999999999999999999899999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCEEEccCCcccccCcccccCCCCCcEEEcccccCCccCCccccCCCCCCEEECcCCCCCCCCCccccCCCCCc
Q 047332          323 IGNLSSLRALYLYNNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVE  402 (614)
Q Consensus       323 l~~~~~L~~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~~~~L~  402 (614)
                      +..+++|+.|++++|.+.+.+|..+..+++|+.|++++|.+++..|..++.+++|+.+++++|.+.+.+|..+..+++|+
T Consensus       328 ~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~  407 (968)
T PLN00113        328 LTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLR  407 (968)
T ss_pred             HhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCC
Confidence            99999999999999999999999999999999999999999989999999999999999999999999999999999999


Q ss_pred             EEEccCCcCCcccccccCCCCCCCEEECcCcccccccCccccCCCCCcEEEcccCcccccCCccCCCCCCCCEEeCCCCc
Q 047332          403 RVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNS  482 (614)
Q Consensus       403 ~L~l~~n~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~  482 (614)
                      .|++++|.+++..+..+..++.|+.|++++|.+.+.++..+..+++|+.|++++|++.+.+|..+ ..++|+.|++++|+
T Consensus       408 ~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~  486 (968)
T PLN00113        408 RVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQ  486 (968)
T ss_pred             EEECcCCEeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCc
Confidence            99999999998888889999999999999999998888888889999999999999988887755 45789999999999


Q ss_pred             CccccchhccCCCCCCEeeccCCccccCccccccCCCCCCEEeCCCCcCcccCCccccccCCCCEEeCCCCcCCcCCChh
Q 047332          483 IVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIE  562 (614)
Q Consensus       483 ~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~  562 (614)
                      +.+..|..+..+++|++|++++|.+.+.+|..+..+++|++|++++|.+++.+|..+..+++|+.|++++|++++.+|..
T Consensus       487 l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~  566 (968)
T PLN00113        487 FSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKN  566 (968)
T ss_pred             cCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChh
Confidence            98888888888999999999999998888888889999999999999999889999999999999999999999899988


Q ss_pred             hhcCCCCCeeeCCCCCCCCCCCccccCCCCCCeEECcCCC
Q 047332          563 LEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNN  602 (614)
Q Consensus       563 l~~l~~L~~L~L~~n~~~~~~p~~l~~l~sL~~L~l~~n~  602 (614)
                      +.++++|+.|++++|++.+.+|.. ..+..+....+.+|+
T Consensus       567 l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~  605 (968)
T PLN00113        567 LGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNI  605 (968)
T ss_pred             HhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCc
Confidence            989999999999999998888864 444555666667776

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-46
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-18
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-46
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 7e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-14
2omx_A 462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 7e-10
2omt_A 462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 8e-10
2omu_A 462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 9e-10
2omv_A 461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 1e-09
2omy_A 461 Crystal Structure Of Inla S192n/hec1 Complex Length 1e-09
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 3e-09
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 6e-05
2omz_A 466 Crystal Structure Of Inla Y369a/hec1 Complex Length 8e-09
1o6s_A 466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 8e-09
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 7e-08
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 7e-08
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-06
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-06
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-05
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 3e-05
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-04
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-05
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 4e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 4e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 5e-05
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 8e-05
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 1e-04
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-04
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 5e-04
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 2e-04
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 3e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 3e-04
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 3e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-04
2xot_A 361 Crystal Structure Of Neuronal Leucine Rich Repeat P 8e-04
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 9e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  158 bits (399), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 192/718 (26%), Positives = 303/718 (42%), Gaps = 146/718 (20%)
Query: 7   KETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVIS 66
           +E   L+ +K  L +KN+               +P +S +K +PC + G++C +  +V S
Sbjct: 9   REIHQLISFKDVLPDKNL---------------LPDWSSNK-NPCTFDGVTC-RDDKVTS 51
Query: 67  INLSSMALN---------------------------GTLQEFAFSSFPHLVQLNLSFNIF 99
           I+LSS  LN                           G++  F  S+   L  L+LS N  
Sbjct: 52  IDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSA--SLTSLDLSRNSL 109
Query: 100 FGIIPP--QIGNLSKLQYLDLGSNQLSGVIPPEIG---HLNQLRILYFDVNQLHGS---- 150
            G +     +G+ S L++L++ SN L    P ++     LN L +L    N + G+    
Sbjct: 110 SGPVTTLTSLGSCSGLKFLNVSSNTLD--FPGKVSGGLKLNSLEVLDLSANSISGANVVG 167
Query: 151 --IPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNS 208
             +    G+L     LA+  N + G +  S     NL     ++N+    IP  LG+ ++
Sbjct: 168 WVLSDGCGELK---HLAISGNKISGDVDVS--RCVNLEFLDVSSNNFSTGIPF-LGDCSA 221
Query: 209 LSTMDLSQNQFXXXXXXXXXXXXXXXXXXXXXXXFSGSIPSIIGNLKSLLQLDLSENQLI 268
           L  +D+S N+                        F G IP +   LKSL  L L+EN+  
Sbjct: 222 LQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLP--LKSLQYLSLAENKFT 279
Query: 269 GSIP-LSFGNLSRLTLMSLFNNLLSGSLPPILG-------------------------NL 302
           G IP    G    LT + L  N   G++PP  G                          +
Sbjct: 280 GEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKM 339
Query: 303 KSLSALGLHINQLSGVIPSSIGNLS---------------------------SLRALYLY 335
           + L  L L  N+ SG +P S+ NLS                           +L+ LYL 
Sbjct: 340 RGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ 399
Query: 336 NNGLCGFVPEEIRYLKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSF 395
           NNG  G +P  +     L  L L  N+LSG IP S+G+L+ L  L +  N L G IP+  
Sbjct: 400 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQEL 459
Query: 396 KNLTSVERVLLNQNNLSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVS 455
             + ++E ++L+ N+L+G++     +  NL +++LS N   GEI         L    +S
Sbjct: 460 MYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLS 519
Query: 456 VNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPV----QLGKL---FSLNKLILNLNQLS 508
            N+ SG+IP E+GD   L  LDL++N   G IP     Q GK+   F   K  + +    
Sbjct: 520 NNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKN-- 577
Query: 509 GGMPLEL---GSLTELQYLDLSA-NKLKSSIPKSIGNLL-------------RLRYLDLS 551
            GM  E    G+L E Q +     N+L +  P +I + +              + +LD+S
Sbjct: 578 DGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMS 637
Query: 552 NNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLEKLNLCHNNLLGSFQQ 609
            N     IP E+  + +L  L+L +N +   IP ++ +++ L  L+L  N L G   Q
Sbjct: 638 YNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQ 695
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query614
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-141
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-134
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-63
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-93
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-78
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-93
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-88
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-72
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-63
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-44
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-34
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-81
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-74
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-62
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-60
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-55
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-48
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-78
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-70
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-38
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-77
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 9e-71
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-59
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-57
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-40
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-77
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-69
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 6e-56
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-68
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-61
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-38
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-52
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-45
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-21
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-21
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-13
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-52
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-48
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-47
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-48
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-44
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-44
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-30
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-42
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-38
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-41
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-37
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-33
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-36
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-30
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-35
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-34
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-33
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-29
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-34
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-33
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-32
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-17
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-33
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-33
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-32
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-32
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-32
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-31
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-30
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-28
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-27
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-24
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-30
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-28
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-26
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-27
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-23
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-20
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-27
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-25
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-25
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-25
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-24
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 6e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-25
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-20
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-15
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-25
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-23
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-22
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-20
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-24
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-21
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-17
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-20
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-18
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-17
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-19
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-17
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-16
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-14
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-12
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-19
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-17
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-10
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-18
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-10
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-12
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 8e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-15
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-14
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-13
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-08
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-07
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-11
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 9e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-12
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-08
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 5e-08
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 6e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 6e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 2e-06
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 1e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  427 bits (1101), Expect = e-141
 Identities = 180/617 (29%), Positives = 263/617 (42%), Gaps = 56/617 (9%)

Query: 2   ASDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQA 61
           +    +E   L+ +K  L +KN  LL  W+              S  +PC + G++C   
Sbjct: 7   SQSLYREIHQLISFKDVLPDKN--LLPDWS--------------SNKNPCTFDGVTCRD- 49

Query: 62  GRVISINLSSMALNGTLQEF--AFSSFPHLVQLNLSFNIFFGIIPPQIGNLSKLQYLDLG 119
            +V SI+LSS  LN        +  S   L  L LS +   G +       + L  LDL 
Sbjct: 50  DKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSG-FKCSASLTSLDLS 108

Query: 120 SNQLSGVIPP--EIGHLNQLRILYFDVNQLHGSIP-PEIGQLSLINVLALCHNNLYGSIP 176
            N LSG +     +G  + L+ L    N L          +L+ + VL L  N++ G+  
Sbjct: 109 RNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANV 168

Query: 177 SSL---GNLSNLANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNL 233
                      L +   + N +   + +      +L  +D+S N FS  IP  LG+ S L
Sbjct: 169 VGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIP-FLGDCSAL 225

Query: 234 GILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSG 293
             L +  N  SG     I     L  L++S NQ +G IP     L  L  +SL  N  +G
Sbjct: 226 QHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL--PLKSLQYLSLAENKFTG 283

Query: 294 SLPP-ILGNLKSLSALGLHINQLSGVIPSSIGNLSSLRALYLYNNGLCGFVPEE-IRYLK 351
            +P  + G   +L+ L L  N   G +P   G+ S L +L L +N   G +P + +  ++
Sbjct: 284 EIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMR 343

Query: 352 SLSELELCKNHLSGVIPHSIGNLTG-LLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNN 410
            L  L+L  N  SG +P S+ NL+  LL L++  N+ SGPI  +                
Sbjct: 344 GLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPK---------- 393

Query: 411 LSGKVYEAFGDHPNLTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDS 470
                         L  L L  N F G+I     N  +L +  +S N +SG+IP  +G  
Sbjct: 394 ------------NTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSL 441

Query: 471 PKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNLNQLSGGMPLELGSLTELQYLDLSANK 530
            KL+ L L  N + GEIP +L  + +L  LIL+ N L+G +P  L + T L ++ LS N+
Sbjct: 442 SKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNR 501

Query: 531 LKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNV 590
           L   IPK IG L  L  L LSNN F   IP EL     L  LDL+ N     IP  +   
Sbjct: 502 LTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQ 561

Query: 591 KSLEKLNLCHNNLLGSF 607
                 N          
Sbjct: 562 SGKIAANFIAGKRYVYI 578
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query614
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.9
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.75
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.67
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.66
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.62
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.47
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.28
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.27
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.23
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.22
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.12
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.88
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.59
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.34
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.33
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.29
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.24
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.34
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.67
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.37
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.3e-81  Score=697.69  Aligned_cols=590  Identities=32%  Similarity=0.476  Sum_probs=465.0

Q ss_pred             CCchHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccccceeeCCCCCEEEEEcCCCCCCcc---cC
Q 047332            3 SDSSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCNQAGRVISINLSSMALNGT---LQ   79 (614)
Q Consensus         3 ~~~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~c~w~~~~c~~~~~v~~l~l~~~~l~~~---~~   79 (614)
                      ++.++||+||++||+++.+ |. .+++|+  .            +.+||.|.||.|+ .++|++|+|+++++.|.   ++
T Consensus         8 ~~~~~~~~all~~k~~~~~-~~-~l~~W~--~------------~~~~C~w~gv~C~-~~~v~~L~L~~~~l~g~~~~l~   70 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPD-KN-LLPDWS--S------------NKNPCTFDGVTCR-DDKVTSIDLSSKPLNVGFSAVS   70 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSC-TT-SSTTCC--T------------TSCGGGSTTEEEE-TTEEEEEECTTSCCCEEHHHHH
T ss_pred             cCCHHHHHHHHHHHhhCCC-cc-cccCCC--C------------CCCCcCCcceEEC-CCcEEEEECCCCCcCCccCccC
Confidence            4477899999999999985 66 899997  3            6789999999998 78999999999999886   43


Q ss_pred             c----------------------ccccCCCCCcEEECCCCCCCccCcc--cccCCCCCCEEeCCCCCCCCCCCcCC-CCC
Q 047332           80 E----------------------FAFSSFPHLVQLNLSFNIFFGIIPP--QIGNLSKLQYLDLGSNQLSGVIPPEI-GHL  134 (614)
Q Consensus        80 ~----------------------~~~~~l~~L~~L~Ls~~~~~~~~~~--~l~~l~~L~~L~Ls~n~l~~~~~~~l-~~l  134 (614)
                      +                      ..++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+.+.+|..+ .++
T Consensus        71 ~~l~~L~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l  150 (768)
T 3rgz_A           71 SSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKL  150 (768)
T ss_dssp             HHTTTCTTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCC
T ss_pred             hhHhccCcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccC
Confidence            2                      2678889999999999999888887  88999999999999998887777665 778


Q ss_pred             CCCCEEEcccccCCCCCCcc---ccCCCCCcEEEeccccCCCCCCcccCCCCCCcEEEeecCCCcccCCccccCCCCCCe
Q 047332          135 NQLRILYFDVNQLHGSIPPE---IGQLSLINVLALCHNNLYGSIPSSLGNLSNLANFYFNNNSLFDSIPLVLGNLNSLST  211 (614)
Q Consensus       135 ~~L~~L~l~~n~~~~~~~~~---~~~l~~L~~L~l~~~~l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~  211 (614)
                      ++|++|++++|.+++..|..   +.++++|++|++++|.+++..+.  ..+++|++|++++|.+.+.+|. ++++++|++
T Consensus       151 ~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~  227 (768)
T 3rgz_A          151 NSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQH  227 (768)
T ss_dssp             TTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCE
T ss_pred             CCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc-cccCCCCCE
Confidence            88888888888877666554   55555555555555555543332  4455555555555555554443 555555555


Q ss_pred             eeccCccCCccCCccccCCCCCCeEEcccC----------------------ccccccchhccCC-CCCCEEeccCCcCc
Q 047332          212 MDLSQNQFSGSIPLSLGNLSNLGILYLYSN----------------------SFSGSIPSIIGNL-KSLLQLDLSENQLI  268 (614)
Q Consensus       212 L~l~~~~~~~~~~~~l~~l~~L~~L~L~~~----------------------~~~~~~~~~l~~l-~~L~~L~L~~n~~~  268 (614)
                      |++++|.+++..|..+..+++|++|++++|                      .+++.+|..+... ++|++|++++|.+.
T Consensus       228 L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~  307 (768)
T 3rgz_A          228 LDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFY  307 (768)
T ss_dssp             EECCSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEE
T ss_pred             EECcCCcCCCcccHHHhcCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCC
Confidence            555555555444445555555555555444                      4444455444443 55666666666665


Q ss_pred             cccCccccCCCCCCEEecCCCcccccCCcc-CCCCCCCCEeecCCCcccccCCccccCCC-CCCEEEccCCcccccCccc
Q 047332          269 GSIPLSFGNLSRLTLMSLFNNLLSGSLPPI-LGNLKSLSALGLHINQLSGVIPSSIGNLS-SLRALYLYNNGLCGFVPEE  346 (614)
Q Consensus       269 ~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~-l~~l~~L~~L~L~~n~l~~~~~~~l~~~~-~L~~L~l~~n~~~~~~~~~  346 (614)
                      +..|..+..+++|++|++++|.+.+.+|.. +..+++|++|++++|.+++.+|..+..++ +|+.|++++|.+.+..|..
T Consensus       308 ~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~  387 (768)
T 3rgz_A          308 GAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPN  387 (768)
T ss_dssp             ECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTT
T ss_pred             CccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCcChh
Confidence            555656666666666666666665555543 55666666666666666655665555554 6666666666666665555


Q ss_pred             ccC--CCCCcEEEcccccCCccCCccccCCCCCCEEECcCCCCCCCCCccccCCCCCcEEEccCCcCCcccccccCCCCC
Q 047332          347 IRY--LKSLSELELCKNHLSGVIPHSIGNLTGLLLLNMCENHLSGPIPKSFKNLTSVERVLLNQNNLSGKVYEAFGDHPN  424 (614)
Q Consensus       347 ~~~--~~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~~~  424 (614)
                      +..  +++|++|++++|.+++.+|..+..+++|+.|++++|.+++.+|..+..+++|+.|++++|.+.+..+..+..+++
T Consensus       388 ~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~  467 (768)
T 3rgz_A          388 LCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKT  467 (768)
T ss_dssp             TTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTT
T ss_pred             hhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCC
Confidence            554  677888888888888888888999999999999999999899999999999999999999999889999999999


Q ss_pred             CCEEECcCcccccccCccccCCCCCcEEEcccCcccccCCccCCCCCCCCEEeCCCCcCccccchhccCCCCCCEeeccC
Q 047332          425 LTFLNLSQNNFCGEISFNWRNFPKLGTFIVSVNNISGSIPPEIGDSPKLQVLDLSSNSIVGEIPVQLGKLFSLNKLILNL  504 (614)
Q Consensus       425 L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~  504 (614)
                      |++|++++|.+.+.+|..+..+++|+.|++++|++++.+|.++..+++|++|++++|++.+.+|..+..+++|+.|++++
T Consensus       468 L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~  547 (768)
T 3rgz_A          468 LETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNT  547 (768)
T ss_dssp             CCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCS
T ss_pred             ceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCccccc---------------------------------------------------------------------
Q 047332          505 NQLSGGMPLEL---------------------------------------------------------------------  515 (614)
Q Consensus       505 n~~~~~~~~~~---------------------------------------------------------------------  515 (614)
                      |.++|.+|..+                                                                     
T Consensus       548 N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~  627 (768)
T 3rgz_A          548 NLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPT  627 (768)
T ss_dssp             SEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCS
T ss_pred             CccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchh
Confidence            99887666543                                                                     


Q ss_pred             -cCCCCCCEEeCCCCcCcccCCccccccCCCCEEeCCCCcCCcCCChhhhcCCCCCeeeCCCCCCCCCCCccccCCCCCC
Q 047332          516 -GSLTELQYLDLSANKLKSSIPKSIGNLLRLRYLDLSNNQFGHKIPIELEKLIHLSELDLSYNFLGEEIPFQICNVKSLE  594 (614)
Q Consensus       516 -~~l~~L~~L~ls~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~p~~l~~l~~L~~L~L~~n~~~~~~p~~l~~l~sL~  594 (614)
                       ..+++|+.||+++|.+++.+|..++.+++|+.|++++|+++|.+|..++++++|++|||++|+++|.+|..+..+++|+
T Consensus       628 ~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~  707 (768)
T 3rgz_A          628 FDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLT  707 (768)
T ss_dssp             CSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCS
T ss_pred             hhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCC
Confidence             3457899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEECcCCCCcccCCCCCC
Q 047332          595 KLNLCHNNLLGSFQQKKD  612 (614)
Q Consensus       595 ~L~l~~n~l~~~ip~~~~  612 (614)
                      +|++++|+++|.||+.++
T Consensus       708 ~L~ls~N~l~g~iP~~~~  725 (768)
T 3rgz_A          708 EIDLSNNNLSGPIPEMGQ  725 (768)
T ss_dssp             EEECCSSEEEEECCSSSS
T ss_pred             EEECcCCcccccCCCchh
Confidence            999999999999998764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 614
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-22
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-17
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-14
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-20
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-18
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-10
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-17
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-11
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.001
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-09
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-06
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 7e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.003
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 8e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 96.0 bits (237), Expect = 2e-22
 Identities = 87/317 (27%), Positives = 128/317 (40%), Gaps = 45/317 (14%)

Query: 11  ALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCAWLGISCN---QAGRVISI 67
           ALL+ K+ L N     LSSW    D                 WLG+ C+   Q  RV ++
Sbjct: 10  ALLQIKKDLGNPTT--LSSWLPTTD------------CCNRTWLGVLCDTDTQTYRVNNL 55

Query: 68  NLSSMALNGTLQEFA-FSSFPHLVQLNLSFNIFF-GIIPPQIGNLSKLQYLDLGSNQLSG 125
           +LS + L       +  ++ P+L  L +       G IPP I  L++L YL +    +SG
Sbjct: 56  DLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSG 115

Query: 126 VIPPEIGHLNQLRILYFDVNQLHGSIPPEIGQLSLINVLALCHNNLYGSIPSSLGNLSNL 185
            IP  +  +  L  L F  N L G++PP I  L  +  +    N + G+IP S G+ S L
Sbjct: 116 AIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKL 175

Query: 186 ANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQN-----------------------QFSGS 222
                 + +             +L+ +DLS+N                            
Sbjct: 176 FTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235

Query: 223 IPLSLGNLSNLGILYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLT 282
               +G   NL  L L +N   G++P  +  LK L  L++S N L G IP   GNL R  
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIP-QGGNLQRFD 294

Query: 283 LMSLFNN--LLSGSLPP 297
           + +  NN  L    LP 
Sbjct: 295 VSAYANNKCLCGSPLPA 311
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query614
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.63
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.61
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.46
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.25
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.19
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.33
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.89
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.39
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.37
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=7.3e-39  Score=316.01  Aligned_cols=291  Identities=32%  Similarity=0.522  Sum_probs=237.2

Q ss_pred             chHHHHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcc--ccceeeCCC---CCEEEEEcCCCCCCcc--
Q 047332            5 SSKETFALLKWKRSLQNKNISLLSSWTLHPDNASNVPSYSKSKISPCA--WLGISCNQA---GRVISINLSSMALNGT--   77 (614)
Q Consensus         5 ~~~~~~~l~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~c~--w~~~~c~~~---~~v~~l~l~~~~l~~~--   77 (614)
                      .++||+||++||+++.++  ..+++|.  .            +.|||.  |.||.|+..   +||++|+|+++.+.|.  
T Consensus         4 ~~~e~~aLl~~k~~~~~~--~~l~sW~--~------------~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~   67 (313)
T d1ogqa_           4 NPQDKQALLQIKKDLGNP--TTLSSWL--P------------TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYP   67 (313)
T ss_dssp             CHHHHHHHHHHHHHTTCC--GGGTTCC--T------------TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEE
T ss_pred             CHHHHHHHHHHHHHCCCC--CcCCCCC--C------------CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCC
Confidence            478999999999999873  3589997  4            678994  999999864   3899999999999884  


Q ss_pred             cCcccccCCCCCcEEECCC-CCCCccCcccccCCCCCCEEeCCCCCCCCCCCcCCCCCCCCCEEEcccccCCCCCCcccc
Q 047332           78 LQEFAFSSFPHLVQLNLSF-NIFFGIIPPQIGNLSKLQYLDLGSNQLSGVIPPEIGHLNQLRILYFDVNQLHGSIPPEIG  156 (614)
Q Consensus        78 ~~~~~~~~l~~L~~L~Ls~-~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~  156 (614)
                      +|+ .++++++|++|+|++ |.++|.+|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.
T Consensus        68 lp~-~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~  146 (313)
T d1ogqa_          68 IPS-SLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSIS  146 (313)
T ss_dssp             CCG-GGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             CCh-HHhcCccccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhc
Confidence            666 899999999999986 788888899999999999999999999888888888899999999999988888888899


Q ss_pred             CCCCCcEEEeccccCCCCCCcccCCCCCC-cEEEeecCCCcccCCccccCCCCCCeeeccCccCCccCCccccCCCCCCe
Q 047332          157 QLSLINVLALCHNNLYGSIPSSLGNLSNL-ANFYFNNNSLFDSIPLVLGNLNSLSTMDLSQNQFSGSIPLSLGNLSNLGI  235 (614)
Q Consensus       157 ~l~~L~~L~l~~~~l~~~~~~~l~~l~~L-~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~  235 (614)
                      ++++|+++++++|.+.+.+|..+..+.++ +.+.+++|++++..+..+..+..+ .+++..+...+..+..+..++++++
T Consensus       147 ~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~~~~~~~~~~~~l~~  225 (313)
T d1ogqa_         147 SLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEGDASVLFGSDKNTQK  225 (313)
T ss_dssp             GCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEECCGGGCCTTSCCSE
T ss_pred             cCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccccccccccccccccccccc
Confidence            99999999999988888888888777765 778888888888777777665443 6778777777777777777788888


Q ss_pred             EEcccCccccccchhccCCCCCCEEeccCCcCccccCccccCCCCCCEEecCCCcccccCCccCCCCCCCCEeecCCCcc
Q 047332          236 LYLYSNSFSGSIPSIIGNLKSLLQLDLSENQLIGSIPLSFGNLSRLTLMSLFNNLLSGSLPPILGNLKSLSALGLHINQL  315 (614)
Q Consensus       236 L~L~~~~~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~l~~l~~L~~L~L~~~~~~~~~~~~l~~l~~L~~L~L~~n~l  315 (614)
                      +++.++.+.+.++ .+..+++|++|++++|++++.+|..+.++++|++|+|++|+++|.+|. +.++++|+.+++++|+.
T Consensus       226 l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~  303 (313)
T d1ogqa_         226 IHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKC  303 (313)
T ss_dssp             EECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSE
T ss_pred             ccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCcc
Confidence            8888887775544 466777888888888888777777777788888888888887777765 46677777777777763
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure