Citrus Sinensis ID: 047360

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEKKEKAKNRNAPISNFELGALRIPKSNLLSLHLHQQTQKAKSTEKLRMGGSHSREDLDISDSEDEYETE
cccHHHHHHHHHHHHHHccccEEEcccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
cccHHHHHcccHHHHHHccccEEEEcccccEccccHHHHHHccccccccccEccccEccccHHHHHHHHHHHHHcccHHHHccccccccccccccccccccccc
KGGWYNFLkkripdianagtthvwlpppsqhaapqekkekaknrnapisnfelgalripksnllSLHLHQQTQKAksteklrmggshsredldisdsedeyete
KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEKKEKAKNRNAPISNFELGALRIPKSNLLSLHLHQQTQkaksteklrmggshsredldisdsedeyete
KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEKKEKAKNRNAPISNFELGALRIPKSNLLSLHLHQQTQKAKSTEKLRMGGSHSREDLDISDSEDEYETE
***WYNFLKKRIPDIANAGTTHVWL*******************************************************************************
*GGWYNFLKKRIPDIANAGTTHVWLPPP*******************ISNFELGALRIPKSNLLSL**************************************
KGGWYNFLKKRIPDIANAGTTHVWLPP****************RNAPISNFELGALRIPKSNLLSLHL************************************
*GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEK*****NRNAPISNFELGALRIPKSNLLSLHLHQQTQK******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEKKEKAKNRNAPISNFELGALRIPKSNLLSLHLHQQTQKAKSTEKLRMGGSHSREDLDISDSEDEYETE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
P17859 421 Alpha-amylase OS=Vigna mu N/A no 0.336 0.083 0.742 3e-10
P27933 436 Alpha-amylase isozyme 3D yes no 0.336 0.080 0.685 2e-09
P27932 440 Alpha-amylase isozyme 3A no no 0.336 0.079 0.628 5e-09
P27934 437 Alpha-amylase isozyme 3E no no 0.336 0.080 0.6 9e-09
P27939 437 Alpha-amylase isozyme 3C no no 0.336 0.080 0.657 1e-08
P27937 438 Alpha-amylase isozyme 3B no no 0.336 0.079 0.657 1e-08
P08117 413 Alpha-amylase AMY3 OS=Tri N/A no 0.336 0.084 0.542 5e-08
P04750 429 Alpha-amylase type B isoz N/A no 0.326 0.079 0.676 1e-07
P04063 427 Alpha-amylase type B isoz N/A no 0.326 0.079 0.676 1e-07
P04747 368 Alpha-amylase type B isoz N/A no 0.326 0.092 0.676 1e-07
>sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 Back     alignment and function desciption
 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (82%)

Query: 1  KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQ 35
          KGGWYN LK  IPD+ANAG THVWLPPPSQ  +P+
Sbjct: 37 KGGWYNSLKNSIPDLANAGITHVWLPPPSQSVSPE 71

Vigna mungo (taxid: 3915)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 Back     alignment and function description
>sp|P27932|AMY3A_ORYSJ Alpha-amylase isozyme 3A OS=Oryza sativa subsp. japonica GN=AMY1.2 PE=2 SV=2 Back     alignment and function description
>sp|P27934|AMY3E_ORYSJ Alpha-amylase isozyme 3E OS=Oryza sativa subsp. japonica GN=AMY1.4 PE=2 SV=1 Back     alignment and function description
>sp|P27939|AMY3C_ORYSJ Alpha-amylase isozyme 3C OS=Oryza sativa subsp. japonica GN=AMY1.7 PE=2 SV=2 Back     alignment and function description
>sp|P27937|AMY3B_ORYSJ Alpha-amylase isozyme 3B OS=Oryza sativa subsp. japonica GN=AMY1.6 PE=2 SV=1 Back     alignment and function description
>sp|P08117|AMY3_WHEAT Alpha-amylase AMY3 OS=Triticum aestivum GN=AMY1.1 PE=2 SV=1 Back     alignment and function description
>sp|P04750|AMY6_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.6 PE=2 SV=2 Back     alignment and function description
>sp|P04063|AMY2_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.2 PE=1 SV=3 Back     alignment and function description
>sp|P04747|AMY3_HORVU Alpha-amylase type B isozyme (Fragment) OS=Hordeum vulgare GN=AMY1.3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
255538308 1113 pentatricopeptide repeat-containing prot 0.326 0.030 0.764 4e-09
388508160 421 unknown [Medicago truncatula] 0.336 0.083 0.771 6e-09
357437821 421 Alpha-amylase [Medicago truncatula] gi|3 0.336 0.083 0.771 6e-09
3769330 420 alpha-amylase [Phaseolus vulgaris] 0.336 0.083 0.742 8e-09
67866502160 alpha-amylase [Manihot esculenta] 0.317 0.206 0.818 1e-08
30962522 421 alpha-amylase [Vigna angularis] 0.336 0.083 0.742 1e-08
228404 421 alpha amylase 0.336 0.083 0.742 1e-08
113781 421 RecName: Full=Alpha-amylase; AltName: Fu 0.336 0.083 0.742 1e-08
356564192 414 PREDICTED: alpha-amylase-like [Glycine m 0.336 0.084 0.742 2e-08
255636611 422 unknown [Glycine max] 0.336 0.082 0.742 2e-08
>gi|255538308|ref|XP_002510219.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550920|gb|EEF52406.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 65.5 bits (158), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 27/34 (79%)

Query: 2  GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQ 35
          GGWYN LK  I DIANAG THVWLPPPSQ  +PQ
Sbjct: 41 GGWYNLLKNSILDIANAGITHVWLPPPSQSVSPQ 74

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388508160|gb|AFK42146.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|357437821|ref|XP_003589186.1| Alpha-amylase [Medicago truncatula] gi|355478234|gb|AES59437.1| Alpha-amylase [Medicago truncatula] Back     alignment and taxonomy information
>gi|3769330|dbj|BAA33879.1| alpha-amylase [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|67866502|gb|AAY82266.1| alpha-amylase [Manihot esculenta] Back     alignment and taxonomy information
>gi|30962522|dbj|BAC76729.1| alpha-amylase [Vigna angularis] Back     alignment and taxonomy information
>gi|228404|prf||1803517A alpha amylase Back     alignment and taxonomy information
>gi|113781|sp|P17859.1|AMYA_VIGMU RecName: Full=Alpha-amylase; AltName: Full=1,4-alpha-D-glucan glucanohydrolase; Flags: Precursor gi|22060|emb|CAA37217.1| unnamed protein product [Vigna mungo] gi|437945|emb|CAA51734.1| alpha-amylase [Vigna mungo] gi|745990|prf||2016476A alpha amylase Back     alignment and taxonomy information
>gi|356564192|ref|XP_003550340.1| PREDICTED: alpha-amylase-like [Glycine max] Back     alignment and taxonomy information
>gi|255636611|gb|ACU18643.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
UNIPROTKB|P27934 437 AMY1.4 "Alpha-amylase isozyme 0.336 0.080 0.6 1.2e-09
UNIPROTKB|P27933 436 AMY1.3 "Alpha-amylase isozyme 0.336 0.080 0.685 3.8e-09
UNIPROTKB|P27939 437 AMY1.7 "Alpha-amylase isozyme 0.336 0.080 0.657 1.3e-08
UNIPROTKB|P27932 440 AMY1.2 "Alpha-amylase isozyme 0.336 0.079 0.628 1.3e-08
UNIPROTKB|P27937 438 AMY1.6 "Alpha-amylase isozyme 0.336 0.079 0.657 2.2e-08
TAIR|locus:2117398 423 AMY1 "alpha-amylase-like" [Ara 0.336 0.082 0.657 9.1e-08
UNIPROTKB|P17654 434 AMY1.1 "Alpha-amylase" [Oryza 0.326 0.078 0.647 1.6e-07
TAIR|locus:2199808 413 AMY2 "alpha-amylase-like 2" [A 0.336 0.084 0.514 7.4e-05
UNIPROTKB|P27934 AMY1.4 "Alpha-amylase isozyme 3E" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 137 (53.3 bits), Expect = 1.2e-09, Sum P(2) = 1.2e-09
 Identities = 21/35 (60%), Positives = 28/35 (80%)

Query:     1 KGGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQ 35
             +GGWYNFL +++ +IA+ G THVWLPPPS   +PQ
Sbjct:    40 QGGWYNFLHEKVEEIASTGATHVWLPPPSHSVSPQ 74
GO:0004556 "alpha-amylase activity" evidence=ISS
GO:0005575 "cellular_component" evidence=TAS
GO:0005983 "starch catabolic process" evidence=ISS
GO:0005987 "sucrose catabolic process" evidence=ISS
UNIPROTKB|P27933 AMY1.3 "Alpha-amylase isozyme 3D" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27939 AMY1.7 "Alpha-amylase isozyme 3C" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27932 AMY1.2 "Alpha-amylase isozyme 3A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27937 AMY1.6 "Alpha-amylase isozyme 3B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2117398 AMY1 "alpha-amylase-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P17654 AMY1.1 "Alpha-amylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2199808 AMY2 "alpha-amylase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
PLN00196 428 PLN00196, PLN00196, alpha-amylase; Provisional 2e-11
cd11314 302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 3e-10
PLN02361 401 PLN02361, PLN02361, alpha-amylase 3e-08
PRK09441 479 PRK09441, PRK09441, cytoplasmic alpha-amylase; Rev 1e-05
cd11318 391 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase cataly 9e-05
PLN02784 894 PLN02784, PLN02784, alpha-amylase 2e-04
smart00642166 smart00642, Aamy, Alpha-amylase domain 3e-04
>gnl|CDD|165762 PLN00196, PLN00196, alpha-amylase; Provisional Back     alignment and domain information 
 Score = 58.4 bits (141), Expect = 2e-11
 Identities = 22/34 (64%), Positives = 25/34 (73%)

Query: 2  GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQ 35
          GGWYNFL  ++ DIA AG THVWLPPPS   + Q
Sbjct: 40 GGWYNFLMGKVDDIAAAGITHVWLPPPSHSVSEQ 73

Length = 428
>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|177990 PLN02361, PLN02361, alpha-amylase Back     alignment and domain information
>gnl|CDD|236518 PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|200457 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase catalytic domain found in bacterial and fungal Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|215419 PLN02784, PLN02784, alpha-amylase Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
PLN00196 428 alpha-amylase; Provisional 99.84
PLN02361 401 alpha-amylase 99.83
PLN02784 894 alpha-amylase 99.8
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 99.79
PF00128 316 Alpha-amylase: Alpha amylase, catalytic domain; In 99.59
smart00642166 Aamy Alpha-amylase domain. 99.59
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 99.36
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 99.3
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 99.28
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 99.22
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 99.21
PRK10785 598 maltodextrin glucosidase; Provisional 99.17
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 99.15
PRK09505 683 malS alpha-amylase; Reviewed 99.14
KOG0471 545 consensus Alpha-amylase [Carbohydrate transport an 99.13
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.12
PRK14511 879 maltooligosyl trehalose synthase; Provisional 99.12
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 99.04
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 99.01
PRK12313 633 glycogen branching enzyme; Provisional 98.98
PRK03705 658 glycogen debranching enzyme; Provisional 98.98
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 98.95
PRK05402 726 glycogen branching enzyme; Provisional 98.94
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 98.83
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 98.81
PRK12568 730 glycogen branching enzyme; Provisional 98.77
PLN02447 758 1,4-alpha-glucan-branching enzyme 98.72
PRK14706 639 glycogen branching enzyme; Provisional 98.71
PRK14705 1224 glycogen branching enzyme; Provisional 98.69
PF02324 809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 98.68
PLN02960 897 alpha-amylase 98.64
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 98.54
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 98.35
PLN02877 970 alpha-amylase/limit dextrinase 98.22
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 98.03
TIGR03852 470 sucrose_gtfA sucrose phosphorylase. In the forward 97.92
PRK13840 495 sucrose phosphorylase; Provisional 97.84
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 97.68
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 97.63
KOG0470 757 consensus 1,4-alpha-glucan branching enzyme/starch 97.44
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 97.3
PF14701 423 hDGE_amylase: glucanotransferase domain of human g 94.02
TIGR03356 427 BGL beta-galactosidase. 90.37
PLN03244 872 alpha-amylase; Provisional 86.48
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information 
Probab=99.84  E-value=2.4e-21  Score=160.52  Aligned_cols=82  Identities=35%  Similarity=0.532  Sum_probs=74.2

Q ss_pred             CchhHHHHhhhhHHHHcCCCeEEcCCCCCCCCCCCCCccccccCCCCCccccCccccchhhHHHHHHhcccchhhhhhhh
Q 047360            2 GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQEKKEKAKNRNAPISNFELGALRIPKSNLLSLHLHQQTQKAKSTEKL   81 (104)
Q Consensus         2 g~wWk~Lk~~apeLa~aGITaVWLPPpsKg~s~~GY~pyDLyd~~~lgefdkgsvrt~k~~i~~l~~~~~~~~~d~v~~h   81 (104)
                      |.||+.|.++++.|+++|||+||||||+++.+.+||+|+|+|+   +++.-.||-..-|+-|+++|++||.|++|+|.||
T Consensus        40 gg~~~~i~~kldyL~~LGvtaIWL~P~~~s~s~hGY~~~D~y~---ld~~~fGt~~elk~Lv~~aH~~GIkVilDvV~NH  116 (428)
T PLN00196         40 GGWYNFLMGKVDDIAAAGITHVWLPPPSHSVSEQGYMPGRLYD---LDASKYGNEAQLKSLIEAFHGKGVQVIADIVINH  116 (428)
T ss_pred             CcCHHHHHHHHHHHHHcCCCEEEeCCCCCCCCCCCCCccccCC---CCcccCCCHHHHHHHHHHHHHCCCEEEEEECccC
Confidence            6799999999999999999999999999999999999999999   5544467777778889999999999999999999


Q ss_pred             hcCCCC
Q 047360           82 RMGGSH   87 (104)
Q Consensus        82 ~~g~d~   87 (104)
                      ++ ++|
T Consensus       117 ~~-~~~  121 (428)
T PLN00196        117 RT-AEH  121 (428)
T ss_pred             cc-ccc
Confidence            97 555

>PLN02361 alpha-amylase Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>KOG0471 consensus Alpha-amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
1ava_A 403 Amy2BASI PROTEIN-Protein Complex From Barley Seed L 9e-09
1rp8_A 405 Crystal Structure Of Barley Alpha-Amylase Isozyme 1 1e-07
1ht6_A 405 Crystal Structure At 1.5a Resolution Of The Barley 1e-07
3bsg_A 414 Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant 1e-07
2qpu_A 405 Sugar Tongs Mutant S378p In Complex With Acarbose L 1e-07
2qps_A 405 "sugar Tongs" Mutant Y380a In Complex With Acarbose 1e-07
3bsh_A 414 Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant 1e-07
>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed Length = 403 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 23/34 (67%), Positives = 25/34 (73%)
Query: 2  GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQ 35
          GGWYNFL  ++ DIA AG THVWLPP SQ  A Q
Sbjct: 16 GGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQ 49
>pdb|1RP8|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 (Amy1) Inactive Mutant D180a In Complex With Maltoheptaose Length = 405 Back     alignment and structure
>pdb|1HT6|A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- Amylase Isozyme 1 Length = 405 Back     alignment and structure
>pdb|3BSG|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant Length = 414 Back     alignment and structure
>pdb|2QPU|A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|2QPS|A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|3BSH|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant Y105aY380A IN COMPLEX WITH INHIBITOR ACARBOSE Length = 414 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 7e-08
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 1e-07
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 1e-07
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 4e-07
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 4e-07
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 1e-06
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 1e-06
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 5e-06
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 1e-05
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
 Score = 47.6 bits (113), Expect = 7e-08
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 2   GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAAPQE 36
              +N L +R P++A AG T VWLPP ++  A   
Sbjct: 146 ANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIH 180
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 99.75
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 99.74
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 99.74
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 99.73
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 99.73
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 99.7
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 99.69
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.65
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.61
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 99.59
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 99.53
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.53
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 99.52
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 99.51
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 99.51
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 99.49
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.47
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 99.47
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 99.45
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 99.45
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 99.43
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 99.43
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 99.43
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 99.42
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 99.42
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 99.42
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 99.41
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 99.4
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 99.4
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 99.4
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 99.4
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 99.39
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 99.39
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 99.39
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 99.38
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 99.38
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 99.38
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.37
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 99.37
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 99.36
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.35
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 99.35
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 99.34
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 99.34
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 99.34
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 99.29
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 99.28
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 99.27
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 99.27
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 99.26
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 99.25
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 99.25
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 99.25
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 99.24
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 99.24
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.23
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 99.22
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 99.18
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 99.16
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 99.15
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 99.13
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 99.09
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 98.99
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 98.88
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 98.88
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 98.69
1qnr_A 344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 88.09
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 84.58
1e4i_A 447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 81.98
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 81.65
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 81.48
3fj0_A 465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 80.64
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 80.56
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
Probab=99.75  E-value=4.9e-19  Score=140.82  Aligned_cols=82  Identities=22%  Similarity=0.438  Sum_probs=73.8

Q ss_pred             CchhHHHHhhhhHHHHcCCCeEEcCCCCCCCC---CCCCCccccccCCCCCccc-cCccccc-------hhhHHHHHHhc
Q 047360            2 GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAA---PQEKKEKAKNRNAPISNFE-LGALRIP-------KSNLLSLHLHQ   70 (104)
Q Consensus         2 g~wWk~Lk~~apeLa~aGITaVWLPPpsKg~s---~~GY~pyDLyd~~~lgefd-kgsvrt~-------k~~i~~l~~~~   70 (104)
                      |+||+-|.++++.|+++|||+|||+|++++.+   ..||.|.|+|+   +|+|+ +|+|..+       |.-|++||++|
T Consensus        24 G~~~~gi~~~Ldyl~~lGvt~I~l~Pi~~~~~~~~~~gY~~~dy~~---lg~~~~~~~id~~~Gt~~df~~lv~~~H~~G  100 (435)
T 1mxg_A           24 GIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFD---LGEYYQKGTVETRFGSKEELVRLIQTAHAYG  100 (435)
T ss_dssp             SCHHHHHHHHHHHHHHHTCCEEECCCCSEETTGGGCCSSSEEETTC---SSCSCBTTBSSCSSCCHHHHHHHHHHHHHTT
T ss_pred             CCHHHHHHHHHHHHHHcCCCEEEeCCcccCCCCCCCCCcCcccccc---cccccccCcCCCCCCCHHHHHHHHHHHHHCC
Confidence            56899999999999999999999999999874   46999999999   79999 8888876       33399999999


Q ss_pred             ccchhhhhhhhhcCCC
Q 047360           71 QTQKAKSTEKLRMGGS   86 (104)
Q Consensus        71 ~~~~~d~v~~h~~g~d   86 (104)
                      |.|++|+|.||.++++
T Consensus       101 i~VilD~V~NH~~~~~  116 (435)
T 1mxg_A          101 IKVIADVVINHRAGGD  116 (435)
T ss_dssp             CEEEEEECCSBCCCCE
T ss_pred             CEEEEEECcccccCCC
Confidence            9999999999987764
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1gcya2 357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 2e-07
d1mxga2 361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 3e-07
d2d3na2 394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 6e-07
d1ht6a2 347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 2e-06
d1e43a2 393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 4e-06
d1ud2a2 390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 4e-06
d1hvxa2 393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 4e-06
d1hx0a2 403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 9e-05
d1jaea2 378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 1e-04
d1ua7a2 344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 3e-04
d1g94a2 354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 3e-04
d2aaaa2 381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 0.004
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase)
species: Pseudomonas stutzeri [TaxId: 316]

 Score = 44.9 bits (105), Expect = 2e-07
 Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 1  KGGWYNFLKKRIPDIANAGTTHVWLPPPSQH 31
             WYN L+++   IA  G + +W+P P + 
Sbjct: 32 PNDWYNILRQQAATIAADGFSAIWMPVPWRD 62
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 99.82
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 99.81
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 99.76
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 99.76
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 99.75
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 99.75
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 99.74
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 99.7
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 99.69
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 99.67
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 99.63
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 99.6
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 99.58
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 99.54
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 99.53
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 99.51
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 99.51
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.49
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 99.47
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 99.47
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 99.46
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 99.42
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 99.41
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 99.4
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 99.39
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 99.39
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 99.39
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.37
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 99.36
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 99.35
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 99.34
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 99.27
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 99.27
d1ecea_ 358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 91.07
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 88.36
d1qnra_ 344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 87.98
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 86.88
d1vjza_ 325 Endoglucanase homologue TM1752 {Thermotoga maritim 85.5
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 84.13
d1e4ia_ 447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 82.52
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 81.29
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Bacterial alpha-amylase
species: Archaeon Pyrococcus woesei [TaxId: 2262]

Probab=99.82  E-value=1.9e-21  Score=145.50  Aligned_cols=83  Identities=23%  Similarity=0.462  Sum_probs=72.8

Q ss_pred             CchhHHHHhhhhHHHHcCCCeEEcCCCCCCCC---CCCCCccccccCCCCCccc-cCccccc---hhh----HHHHHHhc
Q 047360            2 GGWYNFLKKRIPDIANAGTTHVWLPPPSQHAA---PQEKKEKAKNRNAPISNFE-LGALRIP---KSN----LLSLHLHQ   70 (104)
Q Consensus         2 g~wWk~Lk~~apeLa~aGITaVWLPPpsKg~s---~~GY~pyDLyd~~~lgefd-kgsvrt~---k~~----i~~l~~~~   70 (104)
                      +.||+-|.++++.|+++|||+|||+|+.++.+   ..||.|+|+|+   +++|. +++|.++   +++    |+++|++|
T Consensus        24 ~~~~~gi~~kLdylk~LGv~~Iwl~Pv~~~~~~~~~~gY~~~dy~~---~~~~~~~~~vd~~~Gt~~d~~~LV~~aH~~G  100 (361)
T d1mxga2          24 GIWWDHIRSKIPEWYEAGISAIWLPPPSKGMSGGYSMGYDPYDYFD---LGEYYQKGTVETRFGSKEELVRLIQTAHAYG  100 (361)
T ss_dssp             SCHHHHHHHHHHHHHHHTCCEEECCCCSEETTGGGCCSSSEEETTC---SSCSCBTTBSSCSSCCHHHHHHHHHHHHHTT
T ss_pred             CchHHHHHHHHHHHHhcCCCEEEeCcCeeCCCCCCCCCCCcccccc---cCccccccCCCCCCCCHHHHHHHHHHHHHCC
Confidence            56899999999999999999999999998654   67999999999   88887 7788776   333    99999999


Q ss_pred             ccchhhhhhhhhcCCCC
Q 047360           71 QTQKAKSTEKLRMGGSH   87 (104)
Q Consensus        71 ~~~~~d~v~~h~~g~d~   87 (104)
                      |.|++|+|.||.++.++
T Consensus       101 ikVIlD~V~NH~~~~~~  117 (361)
T d1mxga2         101 IKVIADVVINHRAGGDL  117 (361)
T ss_dssp             CEEEEEECCSBCCCCEE
T ss_pred             CEEEEEeeeccccCCcc
Confidence            99999999999876543
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure