Citrus Sinensis ID: 047404

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH
ccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHcccc
ccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccEEEEEEEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccEcccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHccc
mnggpsgfnnapVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSgfafssapELMFGLYLLYYFRVFErqigsnkySVFILFSITVSFLFEVLTLALLkdpamkltsgpyglifasfvpfyfdipvstrfrvfgvhfsdKSFIYLAGLQLLISSLNrsllpgmcgilagslyrpnffrirkakfpefITSFFsrlslpsmgnppaapsrnvlgsipshagrqaesnyplpvpstieppedSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH
MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH
MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH
**********APVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRL************************************************************************************
**GGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATN*LLE****
MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH
*******FNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGN**********************************PPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQ**
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPAAPSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAMLVSMGFDxxxxxxxxxxxxxxxxxxxxxLLEAQPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query291 2.2.26 [Sep-21-2011]
Q5ZJQ8344 Ubiquitin-associated doma yes no 0.965 0.816 0.269 2e-20
Q4R910345 Ubiquitin-associated doma N/A no 0.810 0.684 0.270 6e-20
Q8NBM4344 Ubiquitin-associated doma yes no 0.807 0.683 0.267 1e-19
Q8R1K1345 Ubiquitin-associated doma yes no 0.931 0.785 0.247 9e-16
Q9UTK7372 DSC E3 ubiquitin ligase c yes no 0.484 0.379 0.239 1e-06
>sp|Q5ZJQ8|UBAC2_CHICK Ubiquitin-associated domain-containing protein 2 OS=Gallus gallus GN=UBAC2 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/341 (26%), Positives = 147/341 (43%), Gaps = 60/341 (17%)

Query: 4   GPSGFNNAPVTRAFVIA----CALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFA 59
           G +G   AP++++ ++       L T+ F    +F    L  Q I ++F++WRL+     
Sbjct: 6   GSNGLYKAPLSKSLLLVPSAISILLTLLFQHYQKFFAYNL--QAIKEDFQIWRLVCGRVI 63

Query: 60  FSSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLA----LLKDPAM 115
                +      L+Y FR+FER+ GS K+S F+L + T+S LF++L +     +      
Sbjct: 64  CLDLKDTFCSSLLIYNFRIFERRYGSRKFSSFLLGAWTLSALFDLLLVEAAQYVFGITIN 123

Query: 116 KLTSGPYGLIFASFVPFYFDIPVSTRFRVFGV-HFSDKSFIYLAGLQLLISSLNRSLLPG 174
            L SG  G +FA FVPFY  IP     +V G    ++K+ +Y+ GLQLL S     +L  
Sbjct: 124 SLPSGFLGPVFALFVPFYCSIPRVQVTQVLGYFSITNKTLVYILGLQLLTSGSYIWIL-A 182

Query: 175 MCGILAGSLYRPNFFRI-RKAKFPEFITSFFSRLSLPSMGN-PPAAPSRNVLGSIPSHAG 232
           + G+++G  Y  +  ++ R    P ++   FS    P   +  P    R  +G+      
Sbjct: 183 LSGLISGICYNSSILKVHRILCVPSWVAKIFSWTLEPIFSSAEPTNEIRVGMGATVDIQR 242

Query: 233 RQ----------------------------------------AESNYPLPVPSTIEPP-- 250
           +Q                                           NY    PS  + P  
Sbjct: 243 QQRMELLDRQIMMSQVAQMRRQRQQQGGMINWNRLFPPLRHRHNENYQDHHPSDQDTPPP 302

Query: 251 ----EDSIAMLVSMGFDRNSARQALVQARNDINAATNILLE 287
               E+ +A L+ MGF R  A +AL  + ND+N ATN LL+
Sbjct: 303 TEVSEEQVARLMEMGFSRGDALEALRASNNDLNVATNFLLQ 343

Gallus gallus (taxid: 9031)
>sp|Q4R910|UBAC2_MACFA Ubiquitin-associated domain-containing protein 2 OS=Macaca fascicularis GN=UBAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8NBM4|UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens GN=UBAC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R1K1|UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus GN=Ubac2 PE=2 SV=1 Back     alignment and function description
>sp|Q9UTK7|DSC2_SCHPO DSC E3 ubiquitin ligase complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
225440077294 PREDICTED: ubiquitin-associated domain-c 1.0 0.989 0.785 1e-129
217073424292 unknown [Medicago truncatula] 1.0 0.996 0.770 1e-127
449446724291 PREDICTED: ubiquitin-associated domain-c 0.996 0.996 0.794 1e-127
357509361292 Ubiquitin-associated domain-containing p 1.0 0.996 0.767 1e-127
449523371291 PREDICTED: uncharacterized protein LOC10 0.996 0.996 0.791 1e-126
87241170298 UBA-like [Medicago truncatula] 1.0 0.976 0.751 1e-125
224086841290 predicted protein [Populus trichocarpa] 0.993 0.996 0.767 1e-122
15228999293 Ubiquitin-associated (UBA) protein [Arab 1.0 0.993 0.767 1e-119
356571923293 PREDICTED: uncharacterized protein LOC10 1.0 0.993 0.767 1e-118
145952330289 putative ubiquitin associated/TS-N domai 0.986 0.993 0.740 1e-118
>gi|225440077|ref|XP_002282506.1| PREDICTED: ubiquitin-associated domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297741648|emb|CBI32780.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/294 (78%), Positives = 260/294 (88%), Gaps = 3/294 (1%)

Query: 1   MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAF 60
           MNGGPSGF+NA VTRAFVIACALFT+FFGIQGR NKLGLSYQD+F+  +LW+LIVS FAF
Sbjct: 1   MNGGPSGFHNASVTRAFVIACALFTIFFGIQGRPNKLGLSYQDVFKKLQLWKLIVSVFAF 60

Query: 61  SSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDPAMK-LTS 119
           SS PELMFGLYLLYYFRVFERQIGSNKYSVFI+FSI VS LFE+L L+L K+P +  LTS
Sbjct: 61  SSTPELMFGLYLLYYFRVFERQIGSNKYSVFIMFSIIVSLLFEILALSLFKEPTLNLLTS 120

Query: 120 GPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGIL 179
           GPYGLIF+SFVPFYFDIP+STR+RVFG+ F+DKSFIYLAGLQLL+SS  RS+LPG+CGIL
Sbjct: 121 GPYGLIFSSFVPFYFDIPISTRYRVFGIQFTDKSFIYLAGLQLLLSSWKRSILPGICGIL 180

Query: 180 AGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMG-NPPAAPSRNVLGSIPSHAGRQAESN 238
           AGSLYR NFF IRK KFPEFI+SFFSRLS P+ G +  AAPSRN+LG+ PS+AGRQ E N
Sbjct: 181 AGSLYRLNFFHIRKMKFPEFISSFFSRLSSPATGSSSTAAPSRNILGNAPSYAGRQVEGN 240

Query: 239 YPLPV-PSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH 291
           YP  +  +TIEPPED+IA LVSMGFDRNSARQALV ARND+NAATNILLEAQ H
Sbjct: 241 YPSSMGAATIEPPEDAIATLVSMGFDRNSARQALVHARNDVNAATNILLEAQSH 294

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|217073424|gb|ACJ85071.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446724|ref|XP_004141121.1| PREDICTED: ubiquitin-associated domain-containing protein 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357509361|ref|XP_003624969.1| Ubiquitin-associated domain-containing protein [Medicago truncatula] gi|355499984|gb|AES81187.1| Ubiquitin-associated domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449523371|ref|XP_004168697.1| PREDICTED: uncharacterized protein LOC101228515 [Cucumis sativus] Back     alignment and taxonomy information
>gi|87241170|gb|ABD33028.1| UBA-like [Medicago truncatula] Back     alignment and taxonomy information
>gi|224086841|ref|XP_002307981.1| predicted protein [Populus trichocarpa] gi|222853957|gb|EEE91504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15228999|ref|NP_191233.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] gi|9662993|emb|CAC00737.1| putative protein [Arabidopsis thaliana] gi|21553945|gb|AAM63026.1| unknown [Arabidopsis thaliana] gi|28950711|gb|AAO63279.1| At3g56740 [Arabidopsis thaliana] gi|110735889|dbj|BAE99920.1| hypothetical protein [Arabidopsis thaliana] gi|332646039|gb|AEE79560.1| Ubiquitin-associated (UBA) protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356571923|ref|XP_003554120.1| PREDICTED: uncharacterized protein LOC100805217 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|145952330|gb|ABP98986.1| putative ubiquitin associated/TS-N domain-containing protein [Hieracium piloselloides] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query291
TAIR|locus:2103625293 AT3G56740 "AT3G56740" [Arabido 1.0 0.993 0.767 1.8e-117
TAIR|locus:2063182287 AT2G41160 "AT2G41160" [Arabido 0.982 0.996 0.691 1.4e-101
UNIPROTKB|Q8NBM4344 UBAC2 "Ubiquitin-associated do 0.762 0.645 0.270 2.2e-28
UNIPROTKB|Q5ZJQ8344 UBAC2 "Ubiquitin-associated do 0.687 0.581 0.289 3.2e-28
ZFIN|ZDB-GENE-070112-2122350 zgc:158645 "zgc:158645" [Danio 0.642 0.534 0.336 4.4e-24
MGI|MGI:1916139345 Ubac2 "ubiquitin associated do 0.762 0.643 0.261 2.9e-21
POMBASE|SPAC1486.02c372 dsc2 "Golgi Dsc E3 ligase comp 0.601 0.470 0.215 6.3e-09
TAIR|locus:2103625 AT3G56740 "AT3G56740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1157 (412.3 bits), Expect = 1.8e-117, P = 1.8e-117
 Identities = 225/293 (76%), Positives = 255/293 (87%)

Query:     1 MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQNFRLWRLIVSGFAF 60
             MNGGPSGF+NAPVT+AFVI  ALFTVFFGIQGR +KLGLSYQDIF+ FR+W+LI+S FAF
Sbjct:     1 MNGGPSGFHNAPVTKAFVITSALFTVFFGIQGRSSKLGLSYQDIFEKFRIWKLIMSTFAF 60

Query:    61 SSAPELMFGLYLLYYFRVFERQIGSNKYSVFILFSITVSFLFEVLTLALLKDP-AMKLTS 119
             SS PELMFGLYLLYYFRVFERQIGSNKYSVFILFS TVS L EV+ L+LLKD  A  LTS
Sbjct:    61 SSTPELMFGLYLLYYFRVFERQIGSNKYSVFILFSGTVSLLLEVILLSLLKDTTANLLTS 120

Query:   120 GPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLISSLNRSLLPGMCGIL 179
             GPYGLIFASF+PFY DIPVSTRFRVFGV+FSDKSFIYLAG+QLL+SS  RS+ PG+CGI+
Sbjct:   121 GPYGLIFASFIPFYLDIPVSTRFRVFGVNFSDKSFIYLAGVQLLLSSWKRSIFPGICGII 180

Query:   180 AGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGN-PPAAPSRNVLGSIPSHAGRQAESN 238
             AGSLYR N   IRKAKFPEF+ SFFSRLS PS GN PP APSRN++G+I  + GR+AE +
Sbjct:   181 AGSLYRLNILGIRKAKFPEFVASFFSRLSFPSFGNSPPPAPSRNIVGTISPNTGRRAERS 240

Query:   239 YPLPVPSTIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAATNILLEAQPH 291
              P P+PS++EP E++I  LVSMGFDRN+ARQALV ARND+NAATNILLEAQ H
Sbjct:   241 QPAPLPSSVEPSEEAITTLVSMGFDRNAARQALVHARNDVNAATNILLEAQSH 293
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2063182 AT2G41160 "AT2G41160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NBM4 UBAC2 "Ubiquitin-associated domain-containing protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJQ8 UBAC2 "Ubiquitin-associated domain-containing protein 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-2122 zgc:158645 "zgc:158645" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1916139 Ubac2 "ubiquitin associated domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
POMBASE|SPAC1486.02c dsc2 "Golgi Dsc E3 ligase complex subunit Dsc2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
cd0019438 cd00194, UBA, Ubiquitin Associated domain 7e-11
pfam0062737 pfam00627, UBA, UBA/TS-N domain 3e-09
smart0016537 smart00165, UBA, Ubiquitin associated domain 3e-09
COG0705228 COG0705, COG0705, Membrane associated serine prote 0.001
pfam04511192 pfam04511, DER1, Der1-like family 0.004
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information 
 Score = 55.9 bits (136), Expect = 7e-11
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 251 EDSIAMLVSMGFDRNSARQALVQARNDINAATNILLE 287
           E+ +  L+ MGF R  AR+AL    N++  A   LLE
Sbjct: 2   EEKLEQLLEMGFSREEARKALRATNNNVERAVEWLLE 38

The UBA domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. Although its specific role is so far unknown, it has been suggested that UBA domains are involved in conferring protein target specificity. The domain, a compact three helix bundle, has a conserved GFP-loop and the proline is thought to be critical for binding. The UBA domain is distinct from the conserved three helical domain seen in the N-terminus of EF-TS and eukaryotic NAC proteins. Length = 38
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information
>gnl|CDD|223777 COG0705, COG0705, Membrane associated serine protease [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|218120 pfam04511, DER1, Der1-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 291
KOG4463323 consensus Uncharacterized conserved protein [Funct 100.0
KOG0858239 consensus Predicted membrane protein [Function unk 99.94
PF04511197 DER1: Der1-like family; InterPro: IPR007599 The en 99.91
KOG2632258 consensus Rhomboid family proteins [Function unkno 99.81
PRK10907276 intramembrane serine protease GlpG; Provisional 99.78
PTZ00101278 rhomboid-1 protease; Provisional 99.72
COG0705228 Membrane associated serine protease [Amino acid tr 99.69
COG5291313 Predicted membrane protein [Function unknown] 99.68
PF01694145 Rhomboid: Rhomboid family; InterPro: IPR022764 In 99.61
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 99.4
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 99.31
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 99.31
KOG2289316 consensus Rhomboid family proteins [Signal transdu 99.17
PF0855199 DUF1751: Eukaryotic integral membrane protein (DUF 98.85
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 98.7
KOG2890326 consensus Predicted membrane protein [Function unk 98.53
KOG0011 340 consensus Nucleotide excision repair factor NEF2, 98.35
KOG0944763 consensus Ubiquitin-specific protease UBP14 [Postt 98.33
KOG2290652 consensus Rhomboid family proteins [Signal transdu 98.33
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 98.14
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 97.91
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 97.84
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 97.7
KOG0011340 consensus Nucleotide excision repair factor NEF2, 97.7
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 97.68
smart0054643 CUE Domain that may be involved in binding ubiquit 97.58
KOG0944 763 consensus Ubiquitin-specific protease UBP14 [Postt 97.55
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 97.46
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 97.37
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 97.02
PRK06369115 nac nascent polypeptide-associated complex protein 96.88
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 96.86
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 96.74
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 96.72
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 96.23
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 95.97
KOG2980310 consensus Integral membrane protease of the rhombo 95.59
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 93.85
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 93.59
COG4008153 Predicted metal-binding transcription factor [Tran 93.53
PF0858746 UBA_2: Ubiquitin associated domain (UBA) ; InterPr 92.68
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 92.21
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 89.74
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 88.83
KOG1071 340 consensus Mitochondrial translation elongation fac 88.0
PF0347439 DMA: DMRTA motif; InterPro: IPR005173 This region 87.58
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 87.39
PF07223358 DUF1421: Protein of unknown function (DUF1421); In 86.45
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 81.58
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 80.52
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 80.41
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 80.36
>KOG4463 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1e-35  Score=257.73  Aligned_cols=290  Identities=67%  Similarity=1.089  Sum_probs=235.5

Q ss_pred             CCCCCCCCcccchHHHHHHHHHHHHHHHhhhccccccccchHHHhh-hccchhhhhhhcccCChhHHHHHHHHHHHHHHH
Q 047404            1 MNGGPSGFNNAPVTRAFVIACALFTVFFGIQGRFNKLGLSYQDIFQ-NFRLWRLIVSGFAFSSAPELMFGLYLLYYFRVF   79 (291)
Q Consensus         1 ~~~~~~gf~~~PVTk~li~~~~~~sl~~~~~~~~~~l~l~~~~i~~-~~q~WRLlT~~f~h~~~~~ll~n~~~ly~~r~l   79 (291)
                      |+++|.|+.|.||||..++.+.++++..++...++.+.++++.+++ ++||||++-++|++.+..++++.++.+|++|.+
T Consensus         1 Ms~~p~g~~nmpVTK~~~iT~~~~~vvagI~~~k~~f~l~y~~~l~~y~qywrlL~~qF~~~n~~e~~~~l~I~Y~fR~~   80 (323)
T KOG4463|consen    1 MSGGPSGFHNMPVTKAFVITSALFTVVAGIQGRKSKFGLSYQDILEKYFQYWRLLMSQFAFSNTPELMFGLYILYYFRVF   80 (323)
T ss_pred             CCCCCCcccccchHHHHHHHHHHHHHHHHhhhcccccccchhHHHHHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHH
Confidence            8999999999999999999999999999988888899999987775 489999999999999999999999999999999


Q ss_pred             hhhccchhHHHHHHHHHHHHHHHHHHHHHHhcC--cccccCCChHHHHHHHHHHHHhhcCccceEEEeeeecchh--HHH
Q 047404           80 ERQIGSNKYSVFILFSITVSFLFEVLTLALLKD--PAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDK--SFI  155 (291)
Q Consensus        80 Er~~Gs~kf~~~~l~~~~~s~ll~~~~~~~~~~--~~~~~~~G~sg~ifal~~~~~~~~P~~~~~~i~g~~~~~k--~~~  155 (291)
                      ||..||-||+.|+++++.++.++..++..+..+  .+ ....+++|++||.++.|..++|.+..++.++++++||  .+.
T Consensus        81 ERlLGShky~~fiv~s~~~~~l~~~il~~l~~~~~~n-l~~~qp~~liFa~~~~~y~~ip~~~f~r~f~~~f~dkni~~i  159 (323)
T KOG4463|consen   81 ERLLGSHKYSVFIVFSGTVSLLLEVILLSLLKDTTAN-LLTSQPYGLIFASFIPFYLDIPVSTFFRVFGVNFSDKNISFI  159 (323)
T ss_pred             HHHhccccceeehhHHHHHHHHHHHHHHHHHHHHHhh-hhhcCCCceeeeeccceEEEecceeEEEeecccccccceeee
Confidence            999999999999999999998887765444321  11 4567778899999999999999998899999999999  677


Q ss_pred             HHHHHHHHhcC----------CCchHHHHHHHHHhhHhhcccccCCCCCCccHHHHHHHhhccCCCCCCCCC--------
Q 047404          156 YLAGLQLLISS----------LNRSLLPGMCGILAGSLYRPNFFRIRKAKFPEFITSFFSRLSLPSMGNPPA--------  217 (291)
Q Consensus       156 ~l~~l~ll~~~----------~~~s~~~~l~Gil~G~ly~~~~~~~~~~~~P~~i~~~~~~~~~p~~~~~~~--------  217 (291)
                      ++.+.++.-+.          ...+....+||++.|++|..+..++.+-++|..+..++++..-|-++....        
T Consensus       160 ~~~G~a~sh~~NkredksaveWk~~i~f~~~gLi~~~~~~~~~agi~~~~~~~~~~~f~d~~~~p~~~~~~~PVSyfisq  239 (323)
T KOG4463|consen  160 YLAGVALSHSSNKREDKSAVEWKRSIFFGICGLIAGSLYRLNIAGIRKAKFPEFVASFFDRLSFPSFGNSPPPVSYFISQ  239 (323)
T ss_pred             cccchhhhcCcccccccccceeecccccccchhhhhhHhhcccccccccccHHHHHhhhccccCCCCCCCCCchhhhccc
Confidence            77777666543          345677889999999999988777777788999999998887665544322        


Q ss_pred             -CCCCCcCCCCCCccccccccCCCCCCCCCCCCCHHHHHH-HHcCCCCHHHHHHHHHHhCCCHHH---HHHHHHhcCCC
Q 047404          218 -APSRNVLGSIPSHAGRQAESNYPLPVPSTIEPPEDSIAM-LVSMGFDRNSARQALVQARNDINA---ATNILLEAQPH  291 (291)
Q Consensus       218 -~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~v~~-l~~mGf~~~~~~~aL~~~~~~~~~---A~~~l~~~~~~  291 (291)
                       .|.|.+.+.+....+|...++++.+.+.+.++++|.+.. .++||++.+.++.+|-...||.+.   +++.+++-|.|
T Consensus       240 ~pPTR~nv~~~A~at~~~aaas~~~~~~~s~~p~g~t~~SGp~S~~l~g~S~rp~l~~~r~dd~~gad~t~r~l~~Q~l  318 (323)
T KOG4463|consen  240 APPTRNNVGTIAPATGRRAAASQPAPLPSSVEPSGETITSGPVSMGLDGNSARPALVHARNDDNAGADATNRLLEAQSL  318 (323)
T ss_pred             CCcchhhhhhccccccchhhhcCCCCCccccCCCCcccCCCccccccCCCcCCcccccccccccccccccchhhhhhhH
Confidence             233433332222234545555555555666777888887 999999999999999999888887   77788887765

>KOG0858 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF04511 DER1: Der1-like family; InterPro: IPR007599 The endoplasmic reticulum (ER) of the yeast Saccharomyces cerevisiae (Baker's yeast) contains a proteolytic system able to selectively degrade misfolded lumenal secretory proteins Back     alignment and domain information
>KOG2632 consensus Rhomboid family proteins [Function unknown] Back     alignment and domain information
>PRK10907 intramembrane serine protease GlpG; Provisional Back     alignment and domain information
>PTZ00101 rhomboid-1 protease; Provisional Back     alignment and domain information
>COG0705 Membrane associated serine protease [Amino acid transport and metabolism] Back     alignment and domain information
>COG5291 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF01694 Rhomboid: Rhomboid family; InterPro: IPR022764 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>KOG2289 consensus Rhomboid family proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08551 DUF1751: Eukaryotic integral membrane protein (DUF1751); InterPro: IPR013861 This entry is found in eukaryotic integral membrane proteins Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG2890 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2290 consensus Rhomboid family proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>KOG2980 consensus Integral membrane protease of the rhomboid family involved in different forms of regulated intramembrane proteolysis [Signal transduction mechanisms] Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>COG4008 Predicted metal-binding transcription factor [Transcription] Back     alignment and domain information
>PF08587 UBA_2: Ubiquitin associated domain (UBA) ; InterPro: IPR013896 This is a UBA (ubiquitin associated) protein [] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information
>KOG1071 consensus Mitochondrial translation elongation factor EF-Tsmt, catalyzes nucleotide exchange on EF-Tumt [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>PF07223 DUF1421: Protein of unknown function (DUF1421); InterPro: IPR010820 This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query291
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 3e-18
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 1e-12
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 4e-11
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 3e-10
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 4e-10
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 5e-08
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 2e-07
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 6e-07
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 1e-06
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 5e-06
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 9e-06
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 7e-06
2xov_A181 Rhomboid protease GLPG; membrane protein, hydrolas 2e-05
1wji_A63 Tudor domain containing protein 3; UBA domain, str 3e-05
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 4e-05
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 4e-05
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 9e-05
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 5e-05
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 6e-05
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 1e-04
2nr9_A196 Protein GLPG homolog; intramembrane peptidase, rho 2e-04
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 8e-04
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
 Score = 76.4 bits (187), Expect = 3e-18
 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 225 GSIPSHAGRQAESNYPLPVPST---IEPPEDSIAMLVSMGFDRNSARQALVQARNDINAA 281
           GS  S   RQA       +P +   +   E+ I  LV+MGFDR     AL  A +D+  A
Sbjct: 1   GSSGSSGSRQAPIANAAVLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVA 60

Query: 282 TNILLEAQ 289
             IL+   
Sbjct: 61  VEILMSQS 68
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Length = 43 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 84 Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Length = 83 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 64 Back     alignment and structure
>2xov_A Rhomboid protease GLPG; membrane protein, hydrolase, intramembrane protease; HET: BNG; 1.65A {Escherichia coli} PDB: 2ic8_A* 2nrf_A 2xtu_A* 2irv_A* 3b45_A* 2o7l_A* 2xow_A* 3txt_A* 2xtv_A* 3b44_A* Length = 181 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 63 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Length = 53 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Length = 58 Back     alignment and structure
>2nr9_A Protein GLPG homolog; intramembrane peptidase, rhomboid protease, membrane protein; HET: PA6 PQE; 2.20A {Haemophilus influenzae} SCOP: f.51.1.1 PDB: 3odj_A Length = 196 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
2xov_A181 Rhomboid protease GLPG; membrane protein, hydrolas 99.85
2nr9_A196 Protein GLPG homolog; intramembrane peptidase, rho 99.83
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.54
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.52
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.49
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.47
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.47
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.47
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.47
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.47
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 99.43
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.42
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.42
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.42
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.42
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.4
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.39
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 99.39
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 99.39
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.38
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 99.38
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.37
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 99.37
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.36
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 99.36
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.34
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 99.3
2dna_A67 Unnamed protein product; ubiquitin associated doma 99.27
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.26
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 99.23
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 99.22
2cwb_A108 Chimera of immunoglobulin G binding protein G and 99.12
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.02
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.0
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.93
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 98.9
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 98.84
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 98.83
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.81
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.78
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 98.72
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 98.68
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 98.48
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.47
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 98.08
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 97.96
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.72
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 97.69
2dhy_A67 CUE domain-containing protein 1; structural genomi 97.65
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.63
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 97.3
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 97.18
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 97.06
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 96.94
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 96.78
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 96.48
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 96.42
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 96.16
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 96.02
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 95.98
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 95.87
2di0_A71 Activating signal cointegrator 1 complex subunit 2 95.58
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 94.27
1ixs_A62 Holliday junction DNA helicase RUVA; heterodimeric 92.31
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 89.38
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 88.89
2ejs_A58 Autocrine motility factor receptor, isoform 2; CUE 86.27
3k6g_A111 Telomeric repeat-binding factor 2-interacting Pro; 85.69
4g3o_A58 E3 ubiquitin-protein ligase AMFR; all-helical stru 84.73
2ekf_A61 Ancient ubiquitous protein 1; CUE, ubiquitin ligas 82.76
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 81.77
2lva_A129 Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubi 82.11
>2xov_A Rhomboid protease GLPG; membrane protein, hydrolase, intramembrane protease; HET: BNG; 1.65A {Escherichia coli} PDB: 2ic8_A* 2nrf_A 2xtu_A* 2irv_A* 3b45_A* 2o7l_A* 2xow_A* 3txt_A* 2xtv_A* 3b44_A* Back     alignment and structure
Probab=99.85  E-value=1.9e-20  Score=158.89  Aligned_cols=163  Identities=20%  Similarity=0.276  Sum_probs=119.9

Q ss_pred             cccchHHHHHHHHHHHHHHHhhhccc---cccccchHHHhhhccchhhhhhhcccCChhHHHHHHHHHHHH-HHHhhhcc
Q 047404            9 NNAPVTRAFVIACALFTVFFGIQGRF---NKLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYF-RVFERQIG   84 (291)
Q Consensus         9 ~~~PVTk~li~~~~~~sl~~~~~~~~---~~l~l~~~~i~~~~q~WRLlT~~f~h~~~~~ll~n~~~ly~~-r~lEr~~G   84 (291)
                      +.+|||+.++++|++++++....+..   .++.++++ ..+++|+||++|+.|.|.+..|+++||+.+|.+ +.+||.+|
T Consensus         2 ~~~pvt~~li~~~v~vf~~~~~~~~~~~~~~~~~~p~-~~~~~~~wrl~T~~f~H~~~~Hl~~Nm~~l~~~g~~~E~~~G   80 (181)
T 2xov_A            2 RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPFD-PTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLG   80 (181)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHSSCCS-GGGTTCTTHHHHGGGCCCSHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCcHHHHHHHHHHHHHHHHHHhCcHHHHHhhcCChh-hccCCCCHHHHHHHHHccCHHHHHHHHHHHHHHHHHHHHHhC
Confidence            46899999999999999876543221   23344433 356789999999999999999999999999986 89999999


Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHhcCcccccCCChHHHHHHHHHHHH---hhcCccceEEEeeeecchhHHHHH---H
Q 047404           85 SNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFY---FDIPVSTRFRVFGVHFSDKSFIYL---A  158 (291)
Q Consensus        85 s~kf~~~~l~~~~~s~ll~~~~~~~~~~~~~~~~~G~sg~ifal~~~~~---~~~P~~~~~~i~g~~~~~k~~~~l---~  158 (291)
                      ++||+.+++.+++.+++.+...    . +.  ...|+||.+|+++..+.   +..|+...      .++.+...++   +
T Consensus        81 ~~~fl~~yl~~~i~~~l~~~~~----~-~~--~~vGaSGai~gl~g~~~~~~~~~p~~~~------~l~~~~~~~~~~~~  147 (181)
T 2xov_A           81 SGKLIVITLISALLSGYVQQKF----S-GP--WFGGLSGVVYALMGYVWLRGERDPQSGI------YLQRGLIIFALIWI  147 (181)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH----H-CS--CCCCSHHHHHHHHHHHHHHHHHCGGGSC------CCCHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHh----c-CC--CceeHHHHHHHHHHHHHHHHhhCcCcee------eeHHHHHHHHHHHH
Confidence            9999999999999998876542    2 22  27899999999998653   35565431      1222222211   2


Q ss_pred             HHHHHh-cCCCchHHHHHHHHHhhHhhc
Q 047404          159 GLQLLI-SSLNRSLLPGMCGILAGSLYR  185 (291)
Q Consensus       159 ~l~ll~-~~~~~s~~~~l~Gil~G~ly~  185 (291)
                      +.++.. .+++.+..+|++|+++|.++.
T Consensus       148 ~~~~~~~~~~~v~~~aHlgG~l~G~l~~  175 (181)
T 2xov_A          148 VAGWFDLFGMSMANGAHIAGLAVGLAMA  175 (181)
T ss_dssp             HHHHTTSSCCSSCHHHHHHHHHHHHHHH
T ss_pred             HHHHHHhccccchHHHHHHHHHHHHHHH
Confidence            233321 134799999999999999986
>2nr9_A Protein GLPG homolog; intramembrane peptidase, rhomboid protease, membrane protein; HET: PA6 PQE; 2.20A {Haemophilus influenzae} SCOP: f.51.1.1 PDB: 3odj_A Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k6g_A Telomeric repeat-binding factor 2-interacting Pro; helix, chromosomal protein, nucleus, phosphoprotein, telomer cycle, DNA-binding, protein binding; 1.95A {Homo sapiens} Back     alignment and structure
>4g3o_A E3 ubiquitin-protein ligase AMFR; all-helical structure, BAG6; 1.60A {Homo sapiens} Back     alignment and structure
>2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>2lva_A Ubiquitin carboxyl-terminal hydrolase 28; UIM, ubiquitin interacting motif, UBA domain, NESG, northeas structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 291
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 6e-14
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 3e-10
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 4e-10
d2g3qa143 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL0 1e-09
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 2e-09
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 2e-09
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 3e-09
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 3e-09
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 1e-07
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 3e-07
d1veja161 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculu 4e-06
d1vega_83 a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse 3e-05
d2dnaa150 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {M 4e-05
d3b45a1180 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 7e-04
d2bwba144 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharom 0.002
d1z96a138 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schiz 0.003
d2nr9a1189 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilu 0.004
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: Rhomboid family protein At3g58460
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 63.4 bits (154), Expect = 6e-14
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 225 GSIPSHAGRQAESNYPLPVPS---TIEPPEDSIAMLVSMGFDRNSARQALVQARNDINAA 281
           GS  S   RQA       +P     +   E+ I  LV+MGFDR     AL  A +D+  A
Sbjct: 1   GSSGSSGSRQAPIANAAVLPQSQGRVAASEEQIQKLVAMGFDRTQVEVALAAADDDLTVA 60

Query: 282 TNILLEAQPH 291
             IL+     
Sbjct: 61  VEILMSQSGP 70
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Length = 43 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 61 Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d3b45a1 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 562]} Length = 180 Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 44 Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Length = 38 Back     information, alignment and structure
>d2nr9a1 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilus influenzae [TaxId: 727]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query291
d3b45a1180 GlpG {Escherichia coli [TaxId: 562]} 99.82
d2nr9a1189 GlpG homolog HI0618 {Haemophilus influenzae [TaxId 99.81
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.61
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.57
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.51
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.5
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.5
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.49
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.49
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.4
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.32
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.26
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 99.22
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.15
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.09
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 98.95
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 98.82
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 98.7
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 98.62
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 98.02
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 97.63
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.62
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 97.53
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 97.48
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 97.47
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 97.43
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 97.3
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 97.01
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 97.01
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 96.45
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 95.71
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 91.74
d1cuka148 DNA helicase RuvA subunit, C-terminal domain {Esch 89.78
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 88.81
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 88.47
d2di0a163 Activating signal cointegrator 1 complex subunit 2 83.29
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 82.61
>d3b45a1 f.51.1.1 (A:91-270) GlpG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Rhomboid-like
superfamily: Rhomboid-like
family: Rhomboid-like
domain: GlpG
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=2.8e-20  Score=155.38  Aligned_cols=168  Identities=18%  Similarity=0.259  Sum_probs=117.5

Q ss_pred             cccchHHHHHHHHHHHHHHHhhhcccc---ccccchHHHhhhccchhhhhhhcccCChhHHHHHHHHHHHH-HHHhhhcc
Q 047404            9 NNAPVTRAFVIACALFTVFFGIQGRFN---KLGLSYQDIFQNFRLWRLIVSGFAFSSAPELMFGLYLLYYF-RVFERQIG   84 (291)
Q Consensus         9 ~~~PVTk~li~~~~~~sl~~~~~~~~~---~l~l~~~~i~~~~q~WRLlT~~f~h~~~~~ll~n~~~ly~~-r~lEr~~G   84 (291)
                      +-+|||..++++|+++++.........   .+.++. ...+++|+||++|+.|.|.|..|+++||+.+|.+ +.+||.+|
T Consensus         2 r~~pvT~~li~i~~~vf~~~~~~~~~~~~~~~~~~~-~~~~~g~~wrl~T~~f~H~~~~Hl~~N~~~l~~~G~~lE~~~G   80 (180)
T d3b45a1           2 RAGPVTWVMMIACVVVFIAMQILGDQEVMLWLAWPF-DPTLKFEFWRYFTHALMHFSLMHILFNLLWWWYLGGAVEKRLG   80 (180)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHSSCC-SGGGTTCGGGGTGGGGCCCSHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             CCCcHHHHHHHHHHHHHHHHHHhCcHHHHHHHcCCC-cccccCchHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHhcc
Confidence            358999999999999888754322111   222222 3456789999999999999999999999998886 89999999


Q ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHhcCcccccCCChHHHHHHHHHHHHhhcCccceEEEeeeecchhHHHHHHHHHHHh
Q 047404           85 SNKYSVFILFSITVSFLFEVLTLALLKDPAMKLTSGPYGLIFASFVPFYFDIPVSTRFRVFGVHFSDKSFIYLAGLQLLI  164 (291)
Q Consensus        85 s~kf~~~~l~~~~~s~ll~~~~~~~~~~~~~~~~~G~sg~ifal~~~~~~~~P~~~~~~i~g~~~~~k~~~~l~~l~ll~  164 (291)
                      ++|+..++++++++++++....    .+   ....|.+|++++++.......+...... ...+.....+.++.......
T Consensus        81 ~~~~~~~~~~~~~~g~l~~~~~----~~---~~~~G~sg~i~~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~  152 (180)
T d3b45a1          81 SGKLIVITLISALLSGYVQQKF----SG---PWFGGLSGVVYALMGYVWLRGERDPQSG-IYLQRGLIIFALIWIVAGWF  152 (180)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH----HC---SCCCCSHHHHHHHHHHHHHHHHHCGGGS-CCCCHHHHHHHHHHHHHHHT
T ss_pred             chhheeeeeHHHHHHHHHHHHH----hc---cccccccchHHHHHHHHHHHhhhcchhH-HhhHHHHHHHHHHHHHHHHH
Confidence            9999999999999998875532    22   3468999999998887765444332111 11111111111122111111


Q ss_pred             --cCCCchHHHHHHHHHhhHhhc
Q 047404          165 --SSLNRSLLPGMCGILAGSLYR  185 (291)
Q Consensus       165 --~~~~~s~~~~l~Gil~G~ly~  185 (291)
                        ..++.+..+|++|+++|.++.
T Consensus       153 ~~~~~~v~~~aHlgG~l~G~~~~  175 (180)
T d3b45a1         153 DLFGMSMANGAHIAGLAVGLAMA  175 (180)
T ss_dssp             TSSCCSSCHHHHHHHHHHHHHHH
T ss_pred             HhccCchHHHHHHHHHHHHHHHH
Confidence              245689999999999999976
>d2nr9a1 f.51.1.1 (A:4-192) GlpG homolog HI0618 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure