Citrus Sinensis ID: 047429


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
ccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccHHccccccccEEEcccccccccccccccccccccccccEEEcccccccccccHHHHHHcccccEEEcccccccccccHHHHHcccHHHHHccccccccccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEcccccccccccHHHHHHccccccccccEEEccccccEEEccccccccccccccccccccccEEEccccEEEccccccEEEccccccccccccEEEccccccccccccccHHHHHHHHcccccccccEEEEccccccEEEEEEEEEEEEcccccccccccccEEEEccccccccccHHHHHHcccccccHHHcccccccEEEcccccccccccccccccccccHHHcccccccccccccccccccHHHHHcHHcccccccc
ccccccHHHcccccccEEEcccccccccccHHHHHHHccccHHHEEEcccccccccccHHHcccccccEEEcccccccccccccccHHHcccccccEEEEccccccccccHHHHcccHHccEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEEccccccccccHHHccccHHccccccEEEEEccccccccccccccccccccHHHccccccEEEEEccccEEcccccccccccHHHcccccccEEEEccccccccccHHHccccccEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccccHHHcccccccEEEcccccccccccHHHccccHHcHHccccccccccccccccHHHHHHHHcccHHccccccc
mqiseagfhisLEDLQSINIGLNAIRVRKFDQWLSYHNKltslslqgldlreATDWLQVVITGLpslreldlsssappkinyrshslvnssssslTHLHLSLCGLSNSAYHCLSHISKSLVYLDlsnnqlqgptpdyafrnMTSLASLTSLNyitgiskcslpitlvrpkyafsnvtslmdldlsknqitgipksfgdmcclktLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLqnnmlsgslpgvteldgtfpkqfcrpsslveldlESNQLWLRFnhingsatpklcsspmlqvldfshnnisgmvPTCLNNLSAMVQNGSSNVIVEYRIQliddpefdyqdraLLVWKPIDSIYKitlglpksidlsdnnlsgkipeEITSLLIgkiprsfsqlshlgvvnlsnnnfsgkipssiplqtfeasaykNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRshslvnssssslthlhlslcglsNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
******GFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSL*****************************HLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKF******
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNG***V****RIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRL**
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
**ISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKM**F******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQISEAGFHISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGIPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKNWTHAYFQCLNNVEYKLYAWIAVKMAKFKRRLRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query466 2.2.26 [Sep-21-2011]
Q9LP24 1120 Probable leucine-rich rep no no 0.618 0.257 0.266 7e-18
Q9LHP4 1141 Receptor-like protein kin no no 0.587 0.240 0.281 2e-16
Q9SCT4 836 Probably inactive leucine no no 0.540 0.301 0.290 2e-16
Q9LVP0 1102 Probable leucine-rich rep no no 0.577 0.244 0.279 2e-15
Q9FL28 1173 LRR receptor-like serine/ no no 0.575 0.228 0.287 2e-15
Q6XAT2 967 LRR receptor-like serine/ no no 0.553 0.266 0.271 2e-15
Q9ZPS9 1143 Serine/threonine-protein no no 0.564 0.230 0.273 6e-15
O65440 992 Leucine-rich repeat recep no no 0.663 0.311 0.261 7e-15
O82318 960 Probably inactive leucine no no 0.542 0.263 0.282 9e-15
Q9LJM4 991 Receptor-like protein kin no no 0.521 0.245 0.292 1e-14
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function desciption
 Score = 92.4 bits (228), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 108/406 (26%), Positives = 172/406 (42%), Gaps = 118/406 (29%)

Query: 118 KSLVYLDLSNNQLQGPTPDYAFRNMTSLASLTSL-NYITGISKCSLPITLVRPKYAFSNV 176
           +S+  L LS N+L G  P  +  N+ +L  L+   NY+TG     +P     PK    N+
Sbjct: 270 ESMTNLALSQNKLTGSIPS-SLGNLKNLTLLSLFQNYLTG----GIP-----PK--LGNI 317

Query: 177 TSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSF 235
            S++DL+LS N++TG IP S G++  L  L +++N LT  +P    N       +S+   
Sbjct: 318 ESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNM------ESMIDL 371

Query: 236 MLQNNMLSGSLPG--------------VTELDGTFPKQFCRPSSLVELDLESNQL----- 276
            L NN L+GS+P               +  L G  P++     S++ LDL  N+L     
Sbjct: 372 QLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVP 431

Query: 277 ------------WLRFNHINGSATP------------------------KLCSSPMLQVL 300
                       +LR NH++G+  P                         +C    LQ +
Sbjct: 432 DSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNI 491

Query: 301 DFSHNNISGMVPTCLNNLSAMVQ-----NGSSNVIVEY-----RIQLIDDPEFDYQDRAL 350
              +N++ G +P  L +  ++++     N  +  I E       +  ID     +     
Sbjct: 492 SLDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHGEIS 551

Query: 351 LVWKP-------IDSIYKITLGLPKSI---------DLSDNNLSGKIPEEITSL------ 388
             W+        I S   IT  +P  I         DLS NNL G++PE I +L      
Sbjct: 552 SNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRL 611

Query: 389 ------LIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEA 428
                 L G++P   S L++L  ++LS+NNFS +IP     QTF++
Sbjct: 612 RLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIP-----QTFDS 652





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
147811986 1085 hypothetical protein VITISV_012666 [Viti 0.860 0.369 0.317 2e-37
302143722 750 unnamed protein product [Vitis vinifera] 0.896 0.557 0.308 3e-35
296084223 651 unnamed protein product [Vitis vinifera] 0.744 0.533 0.320 3e-34
302143729 641 unnamed protein product [Vitis vinifera] 0.665 0.483 0.310 1e-33
359490572 975 PREDICTED: probable LRR receptor-like se 0.665 0.317 0.310 2e-33
359490562 1412 PREDICTED: LRR receptor-like serine/thre 0.690 0.228 0.311 3e-32
296084228523 unnamed protein product [Vitis vinifera] 0.742 0.661 0.302 7e-32
147838406 700 hypothetical protein VITISV_044461 [Viti 0.813 0.541 0.301 1e-31
359490164 1198 PREDICTED: LRR receptor-like serine/thre 0.742 0.288 0.302 3e-31
359490560 1010 PREDICTED: LRR receptor-like serine/thre 0.680 0.313 0.309 3e-31
>gi|147811986|emb|CAN77037.1| hypothetical protein VITISV_012666 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  163 bits (412), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 186/585 (31%), Positives = 249/585 (42%), Gaps = 184/585 (31%)

Query: 11  SLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLREL 70
           +L +LQS+++  N     +  +WLSY   LT L L G+DL +A  W Q +     SL EL
Sbjct: 141 NLSNLQSLDLSDNFEMSCENLEWLSYLPSLTHLDLSGVDLSKAIHWPQAINKMSSSLTEL 200

Query: 71  DLS-SSAPPKINYRSHSLVNSS------------------------SSSLTHLHL----- 100
            LS +  P  I   S S  NSS                        SSSL HL L     
Sbjct: 201 YLSFTKLPWIIPTISISHTNSSTSLAVLDLSLNGLTSSINPWLFYFSSSLVHLDLFGNDL 260

Query: 101 ------SLCGLSNSAYHCLS----------HISKSLVYLDLSNNQLQGPTPDYAFRNMTS 144
                 +L  ++N AY  LS            S SL +LDLS NQL G  PD AF NMT+
Sbjct: 261 NGSILDALGNMTNLAYLDLSLNQLEGEIPKSFSISLAHLDLSWNQLHGSIPD-AFGNMTT 319

Query: 145 LASLT-SLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITGI-------PKSF 196
           LA L  S N++ G    S+P        A  N+T+L  L LS NQ+ G        P   
Sbjct: 320 LAYLDLSSNHLNG----SIP-------DALGNMTTLAHLYLSANQLEGTLPNLEATPSLG 368

Query: 197 GDMC--CLKT---------------------------------------LKIHDNILTAK 215
            DM   CLK                                        + + +N L+ +
Sbjct: 369 MDMSSNCLKGSIPQSVFNGQWLDLSKNMFSGSVSLSCGTTNQSSWGLLHVDLSNNQLSGE 428

Query: 216 LPE--------LFLNFS----AGCAKKS------LQSFMLQNNMLSGSLP---------- 247
           LP+        + LN +    +G  K S      +Q+  L+NN L+G+LP          
Sbjct: 429 LPKCWEQWKYLIVLNLTNNNFSGTIKNSIGMLHQMQTLHLRNNSLTGALPLSLKNCRDLR 488

Query: 248 ----GVTELDGTFPKQFCRP-SSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLDF 302
               G  +L G  P       S L+ ++L SN+        NGS    LC    +Q+LD 
Sbjct: 489 LIDLGKNKLSGKMPAWIGGXLSDLIVVNLRSNEF-------NGSIPLNLCQLKKVQMLDL 541

Query: 303 SHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKI 362
           S NN+SG++P CLNNL+AM QNGS  +  E R+  + D    Y D  ++ WK  +  YK 
Sbjct: 542 SSNNLSGIIPKCLNNLTAMGQNGSLVIAYEERL-FVFDSSISYIDNTVVQWKGKELEYKK 600

Query: 363 TLGLPKSIDLSDNNLSGKIPEEITSL---------------------------------- 388
           TL L KSID S+N L+G+IP E+T L                                  
Sbjct: 601 TLXLVKSIDFSNNKLNGEIPIEVTDLVELXSLNLSXNNLIGSIPLMIGQLKSLDFXBLSQ 660

Query: 389 --LIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAY 431
             L G IP S SQ++ L V++LS+N  SGKIPS   L +F AS Y
Sbjct: 661 NQLHGGIPVSLSQIAGLSVLDLSDNILSGKIPSGTQLHSFNASTY 705




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|302143722|emb|CBI22583.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084223|emb|CBI24611.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143729|emb|CBI22590.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490572|ref|XP_003634116.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At4g36180-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490562|ref|XP_003634112.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296084228|emb|CBI24616.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147838406|emb|CAN72124.1| hypothetical protein VITISV_044461 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490164|ref|XP_002268910.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359490560|ref|XP_002266431.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query466
TAIR|locus:2044767905 AT2G34930 "AT2G34930" [Arabido 0.611 0.314 0.293 5.3e-17
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.615 0.281 0.297 2e-16
TAIR|locus:2098267 836 IMK2 "inflorescence meristem r 0.583 0.325 0.313 2.3e-15
TAIR|locus:2025012 1083 RLP1 "AT1G07390" [Arabidopsis 0.489 0.210 0.304 2.5e-09
TAIR|locus:4515102753 598 AT1G73066 [Arabidopsis thalian 0.600 0.468 0.303 6e-15
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.590 0.240 0.286 2.1e-12
TAIR|locus:2180587811 RLP52 "receptor like protein 5 0.635 0.364 0.272 2.1e-10
TAIR|locus:2137296811 RLP46 "receptor like protein 4 0.579 0.332 0.314 3.7e-14
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.592 0.273 0.292 6.6e-14
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.605 0.282 0.301 1.1e-13
TAIR|locus:2044767 AT2G34930 "AT2G34930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 5.3e-17, Sum P(2) = 5.3e-17
 Identities = 102/348 (29%), Positives = 163/348 (46%)

Query:   123 LDLSNNQLQGPTPDYAFRNMTSLASLTSLNYITGISKCSLPITLVRPK--YAFSN----- 175
             +DLS+N  +G  P ++  N T L  L   N+ +G    ++ + + R +  Y FSN     
Sbjct:   550 IDLSSNNFEGTFPLWS-TNATELR-LYENNF-SGSLPQNIDVLMPRMEKIYLFSNSFTGN 606

Query:   176 -------VTSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGC 227
                    V+ L  L L KN  +G  PK +     L  + + +N L+ ++PE     S G 
Sbjct:   607 IPSSLCEVSGLQILSLRKNHFSGSFPKCWHRQFMLWGIDVSENNLSGEIPE-----SLGM 661

Query:   228 AKKSLQSFMLQNNMLSGSLP-------GVTELD-------GTFPKQFCRPSSLVELDLES 273
                SL   +L  N L G +P       G+T +D       G  P    + SSL  L L+S
Sbjct:   662 LP-SLSVLLLNQNSLEGKIPESLRNCSGLTNIDLGGNKLTGKLPSWVGKLSSLFMLRLQS 720

Query:   274 NQLWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEY 333
             N          G     LC+ P L++LD S N ISG +P C++NL+A+ + G++N + + 
Sbjct:   721 NSF-------TGQIPDDLCNVPNLRILDLSGNKISGPIPKCISNLTAIAR-GTNNEVFQN 772

Query:   334 RIQLIDDP-EFDYQDRAL-LVWKPIDS-IYKITLGLP--KSIDLSDNNLSGKIPEEITSL 388
              + ++    E++    ++ L    I   I +  LGL   + ++LS N+++G IPE+I+ L
Sbjct:   773 LVFIVTRAREYEAIANSINLSGNNISGEIPREILGLLYLRILNLSRNSMAGSIPEKISEL 832

Query:   389 ------------LIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQ 424
                           G IP+SF+ +S L  +NLS N   G IP  +  Q
Sbjct:   833 SRLETLDLSKNKFSGAIPQSFAAISSLQRLNLSFNKLEGSIPKLLKFQ 880


GO:0006952 "defense response" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0005618 "cell wall" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP;IMP
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098267 IMK2 "inflorescence meristem receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180587 RLP52 "receptor like protein 52" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137296 RLP46 "receptor like protein 46" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-22
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 3e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  101 bits (252), Expect = 1e-22
 Identities = 97/318 (30%), Positives = 138/318 (43%), Gaps = 82/318 (25%)

Query: 123 LDLSNNQLQGPTPDYAFRNMTSLASLT-SLNYITG-ISKCSLPITLVRPKYAFSNVTSLM 180
           ++LSNNQL GP PD  F   +SL  L  S N  TG I + S+P              +L 
Sbjct: 98  INLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIP--------------NLE 143

Query: 181 DLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQN 239
            LDLS N ++G IP   G    LK L +  N+L  K+P    N +      SL+   L +
Sbjct: 144 TLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLT------SLEFLTLAS 197

Query: 240 NMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLW--LRFNHINGSATPKLCSSPML 297
           N L G +P                    EL    +  W  L +N+++G    ++     L
Sbjct: 198 NQLVGQIP-------------------RELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSL 238

Query: 298 QVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPID 357
             LD  +NN++G +P+ L NL  +          +Y         F YQ+      K   
Sbjct: 239 NHLDLVYNNLTGPIPSSLGNLKNL----------QYL--------FLYQN------KLSG 274

Query: 358 SIYKITLGLPK--SIDLSDNNLSGKIPEEITSL------------LIGKIPRSFSQLSHL 403
            I      L K  S+DLSDN+LSG+IPE +  L              GKIP + + L  L
Sbjct: 275 PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRL 334

Query: 404 GVVNLSNNNFSGKIPSSI 421
            V+ L +N FSG+IP ++
Sbjct: 335 QVLQLWSNKFSGEIPKNL 352


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 466
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.98
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.96
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.94
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.91
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.85
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.83
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.39
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.33
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.24
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.2
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.2
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.15
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.03
PLN03150623 hypothetical protein; Provisional 98.98
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.9
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.8
PLN03150623 hypothetical protein; Provisional 98.75
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.68
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.67
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.59
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.57
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.54
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.51
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.3
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.16
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.09
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.96
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.84
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.81
PRK15386426 type III secretion protein GogB; Provisional 97.78
PRK15386426 type III secretion protein GogB; Provisional 97.63
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.57
KOG4341483 consensus F-box protein containing LRR [General fu 97.37
KOG4341483 consensus F-box protein containing LRR [General fu 97.34
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.13
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.59
KOG4308478 consensus LRR-containing protein [Function unknown 96.33
KOG4308478 consensus LRR-containing protein [Function unknown 96.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.37
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.91
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.79
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.02
smart0037026 LRR Leucine-rich repeats, outliers. 92.12
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.12
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.1
smart0037026 LRR Leucine-rich repeats, outliers. 91.33
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.33
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.92
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.75
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.03
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.54
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 86.91
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 84.24
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.51
KOG3763585 consensus mRNA export factor TAP/MEX67 [RNA proces 80.32
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.9e-38  Score=346.87  Aligned_cols=395  Identities=27%  Similarity=0.338  Sum_probs=237.3

Q ss_pred             cCCcCCcEEeCCCccccccchHHHhhcCCCCcEEEccCCCCCCccchHHHHhcCCCCCCEEEcCCCCCCCCCcccccccc
Q 047429           10 ISLEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVN   89 (466)
Q Consensus        10 ~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~   89 (466)
                      +.+++|++|++++|.+.+..| ..+..+++|++|++++|.+.+..  +..+.. +++|++|++++|.+.+..+  ..+..
T Consensus       137 ~~l~~L~~L~Ls~n~~~~~~p-~~~~~l~~L~~L~L~~n~l~~~~--p~~~~~-l~~L~~L~L~~n~l~~~~p--~~l~~  210 (968)
T PLN00113        137 GSIPNLETLDLSNNMLSGEIP-NDIGSFSSLKVLDLGGNVLVGKI--PNSLTN-LTSLEFLTLASNQLVGQIP--RELGQ  210 (968)
T ss_pred             cccCCCCEEECcCCcccccCC-hHHhcCCCCCEEECccCcccccC--Chhhhh-CcCCCeeeccCCCCcCcCC--hHHcC
Confidence            456777777777777776666 66777777777777777765442  445555 7777777777777766555  45556


Q ss_pred             CCCCCccEEEcCCCCCCchhhhhhhcccCCCcEEEccCCccccCCChhhhhcCCcccccc-cccccccccccCCCccccC
Q 047429           90 SSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLASLT-SLNYITGISKCSLPITLVR  168 (466)
Q Consensus        90 ~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~-~~n~l~~~~~~~l~~~~~~  168 (466)
                        +++|++|++++|.+.+..|..+..+ ++|++|++++|.+.+..|. .++++++|+.|+ +.|.+.+.    +|     
T Consensus       211 --l~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~L~~n~l~~~----~p-----  277 (968)
T PLN00113        211 --MKSLKWIYLGYNNLSGEIPYEIGGL-TSLNHLDLVYNNLTGPIPS-SLGNLKNLQYLFLYQNKLSGP----IP-----  277 (968)
T ss_pred             --cCCccEEECcCCccCCcCChhHhcC-CCCCEEECcCceeccccCh-hHhCCCCCCEEECcCCeeecc----Cc-----
Confidence              6777777777777776677777776 7777777777777666666 677777777777 66666554    44     


Q ss_pred             ccccccCCCccCEEecCCCcCCC-CCcccCCCCCcCEEEeeCCcCCCccchhhhhccccccccccceEecCCccccccCC
Q 047429          169 PKYAFSNVTSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSLQSFMLQNNMLSGSLP  247 (466)
Q Consensus       169 ~~~~l~~l~~L~~L~Ls~n~l~~-~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~  247 (466)
                        ..+..+++|++|++++|.+.+ +|..+..+++|++|++++|.+++..|..+..+      ++|+.|++++|.+++.+|
T Consensus       278 --~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l------~~L~~L~L~~n~l~~~~p  349 (968)
T PLN00113        278 --PSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSL------PRLQVLQLWSNKFSGEIP  349 (968)
T ss_pred             --hhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcC------CCCCEEECcCCCCcCcCC
Confidence              445555555555555555554 44455555555555555555555444443333      334444444444443322


Q ss_pred             CC--------------cccccccCcccCCCCCCcEEeCCCCee-----------------eeecccccccCCCCCCCCCC
Q 047429          248 GV--------------TELDGTFPKQFCRPSSLVELDLESNQL-----------------WLRFNHINGSATPKLCSSPM  296 (466)
Q Consensus       248 ~~--------------~~l~~~lp~~~~~l~~L~~L~L~~n~l-----------------~l~~n~~~~~~~~~~~~l~~  296 (466)
                      ..              ..+.+.+|..+..+++|+.|++++|.+                 ++++|++++..|..+..++.
T Consensus       350 ~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~  429 (968)
T PLN00113        350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPL  429 (968)
T ss_pred             hHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCC
Confidence            10              011223333333334444444443332                 23335556667777777777


Q ss_pred             ccEEEccCCCCCCCchhhhhhhhhhhhcCCCCce-eeeee-----------eccCCC-------------Ccccccceee
Q 047429          297 LQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVI-VEYRI-----------QLIDDP-------------EFDYQDRALL  351 (466)
Q Consensus       297 L~~L~Ls~N~l~~~~p~~~~~l~~L~~l~~~n~~-~~~~~-----------~~~~~~-------------~~~~~~~~~~  351 (466)
                      |+.|++++|.+++.+|..+..+++|+.|+++++- .+...           .+..+.             .+.......+
T Consensus       430 L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N  509 (968)
T PLN00113        430 VYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSEN  509 (968)
T ss_pred             CCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCC
Confidence            7777777777777777777777777777644332 11100           000000             0000111111


Q ss_pred             eeecccchhhhccCCCcEEECCCCcCCcCCcHHHHhh------------ccCCCcccccCCCCCCeeeccCCcCcccCCC
Q 047429          352 VWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSL------------LIGKIPRSFSQLSHLGVVNLSNNNFSGKIPS  419 (466)
Q Consensus       352 ~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~ip~~i~~l------------~~~~ip~~l~~l~~L~~L~Ls~N~l~~~ip~  419 (466)
                      .+.+..+..+..+++|++|+|++|.++|.+|..++.+            +.+.+|..+.+++.|+.|++++|+++|.+|+
T Consensus       510 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~  589 (968)
T PLN00113        510 KLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS  589 (968)
T ss_pred             cceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCC
Confidence            2223344455667788888888888888888777654            6778888888888888888888888888888


Q ss_pred             CCCccccccccc
Q 047429          420 SIPLQTFEASAY  431 (466)
Q Consensus       420 ~~~~~~~~~~~~  431 (466)
                      ..++.++....+
T Consensus       590 ~~~~~~~~~~~~  601 (968)
T PLN00113        590 TGAFLAINASAV  601 (968)
T ss_pred             cchhcccChhhh
Confidence            766665554443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 4e-13
3rgx_A768 Structural Insight Into Brassinosteroid Perception 7e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-07
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 72.8 bits (177), Expect = 4e-13, Method: Compositional matrix adjust. Identities = 104/405 (25%), Positives = 163/405 (40%), Gaps = 115/405 (28%) Query: 113 LSHISKSLVYLDLSNNQLQGPT-PDYAFRNMTSLASL-TSLNYITGISKCSLPITLVRPK 170 L+++S SL+ LDLS+N GP P+ +L L N TG +P TL Sbjct: 360 LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTG----KIPPTL---- 411 Query: 171 YAFSNVTSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAK 229 SN + L+ L LS N ++G IP S G + L+ LK+ N+L ++P+ + Sbjct: 412 ---SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYV------ 462 Query: 230 KSLQSFMLQNNMLSGSLP-GVT-------------ELDGTFPKQFCRPSSLVELDLESNQ 275 K+L++ +L N L+G +P G++ L G PK R +L L L +N Sbjct: 463 KTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS 522 Query: 276 LWLRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRI 335 +G+ +L L LD + N +G +P + S + ++N I R Sbjct: 523 F-------SGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKI---AANFIAGKRY 572 Query: 336 QLIDD---------------------------------------------PEFDYQDRAL 350 I + P FD + Sbjct: 573 VYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMM 632 Query: 351 LVWKPIDSIYKITLG-LPKSI---------DLSDNNLSGKIPEEITSL------------ 388 +D Y + G +PK I +L N++SG IP+E+ L Sbjct: 633 F----LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNK 688 Query: 389 LIGKIPRSFSQLSHLGVVNLSNNNFSGKIPSSIPLQTFEASAYKN 433 L G+IP++ S L+ L ++LSNNN SG IP +TF + + N Sbjct: 689 LDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLN 733
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query466
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-48
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-40
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-33
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-10
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-29
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-28
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-26
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-24
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-21
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-12
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-21
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-17
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-11
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-14
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-19
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-18
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-16
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-16
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-17
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-17
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-16
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-15
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 9e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-13
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-08
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 7e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-07
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 2e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 8e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  174 bits (444), Expect = 8e-48
 Identities = 92/381 (24%), Positives = 143/381 (37%), Gaps = 63/381 (16%)

Query: 61  ITGLPSLRELDLSS-----SAPPKINYRSHSLVNSSSSSLTHLHLSLCGLSNSAYHCLSH 115
           +  +  L+ LDLS        P        SL N S+S L  L LS    S      L  
Sbjct: 339 LLKMRGLKVLDLSFNEFSGELPE-------SLTNLSAS-LLTLDLSSNNFSGPILPNLCQ 390

Query: 116 ISK-SLVYLDLSNNQLQGPTPDYAFRNMTSLASLT-SLNYITGISKCSLPITLVRPKYAF 173
             K +L  L L NN   G  P     N + L SL  S NY++G    ++P +L       
Sbjct: 391 NPKNTLQELYLQNNGFTGKIPP-TLSNCSELVSLHLSFNYLSG----TIPSSL------- 438

Query: 174 SNVTSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFSAGCAKKSL 232
            +++ L DL L  N + G IP+    +  L+TL +  N LT ++P    N +      +L
Sbjct: 439 GSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT------NL 492

Query: 233 QSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLC 292
               L NN L+G            PK   R  +L  L L +N         +G+   +L 
Sbjct: 493 NWISLSNNRLTG----------EIPKWIGRLENLAILKLSNNSF-------SGNIPAELG 535

Query: 293 SSPMLQVLDFSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLV 352
               L  LD + N  +G +P  +   S  +            I+     +  +    LL 
Sbjct: 536 DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLE 595

Query: 353 WKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSL------------LIGKIPRSFSQL 400
           ++ I S     L      +++     G       +             L G IP+    +
Sbjct: 596 FQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSM 655

Query: 401 SHLGVVNLSNNNFSGKIPSSI 421
            +L ++NL +N+ SG IP  +
Sbjct: 656 PYLFILNLGHNDISGSIPDEV 676


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.97
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.8
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.77
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.69
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.63
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.56
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.49
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.44
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.38
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.37
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.33
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.32
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.27
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.1
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.09
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.97
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.75
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.69
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.6
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.55
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.42
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.33
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.01
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.86
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.66
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.09
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.92
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-42  Score=367.22  Aligned_cols=354  Identities=27%  Similarity=0.354  Sum_probs=245.1

Q ss_pred             CcCCcEEeCCCccccccchHHHhhcCCCCcEEEccCCCCCCccchHHHHhcCCCCCCEEEcCCCCCCCCCcccccccc--
Q 047429           12 LEDLQSINIGLNAIRVRKFDQWLSYHNKLTSLSLQGLDLREATDWLQVVITGLPSLRELDLSSSAPPKINYRSHSLVN--   89 (466)
Q Consensus        12 l~~L~~L~Ls~n~i~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~--   89 (466)
                      +++|++|++++|.+++..| ..+..+++|++|++++|.+++..  +...+..+++|++|++++|.+++..+  ..+..  
T Consensus       293 ~~~L~~L~Ls~n~l~~~~p-~~~~~l~~L~~L~L~~n~l~~~i--p~~~l~~l~~L~~L~Ls~n~l~~~~p--~~l~~l~  367 (768)
T 3rgz_A          293 CDTLTGLDLSGNHFYGAVP-PFFGSCSLLESLALSSNNFSGEL--PMDTLLKMRGLKVLDLSFNEFSGELP--ESLTNLS  367 (768)
T ss_dssp             CTTCSEEECCSSEEEECCC-GGGGGCTTCCEEECCSSEEEEEC--CHHHHTTCTTCCEEECCSSEEEECCC--TTHHHHT
T ss_pred             cCcCCEEECcCCcCCCccc-hHHhcCCCccEEECCCCcccCcC--CHHHHhcCCCCCEEeCcCCccCcccc--HHHHhhh
Confidence            3777777777777766666 66777777777777777665321  33322336777777777776653333  22332  


Q ss_pred             -----------------------CCCCCccEEEcCCCCCCchhhhhhhcccCCCcEEEccCCccccCCChhhhhcCCccc
Q 047429           90 -----------------------SSSSSLTHLHLSLCGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTSLA  146 (466)
Q Consensus        90 -----------------------~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~  146 (466)
                                             ..+++|++|++++|.+++..|..+..+ ++|++|++++|.+.+..|. .++.+++|+
T Consensus       368 ~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l-~~L~~L~Ls~N~l~~~~p~-~l~~l~~L~  445 (768)
T 3rgz_A          368 ASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNC-SELVSLHLSFNYLSGTIPS-SLGSLSKLR  445 (768)
T ss_dssp             TTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGC-TTCCEEECCSSEEESCCCG-GGGGCTTCC
T ss_pred             cCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcC-CCCCEEECcCCcccCcccH-HHhcCCCCC
Confidence                                   113345555555555555555555555 5666666666666555555 555666666


Q ss_pred             ccc-cccccccccccCCCccccCccccccCCCccCEEecCCCcCCC-CCcccCCCCCcCEEEeeCCcCCCccchhhhhcc
Q 047429          147 SLT-SLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITG-IPKSFGDMCCLKTLKIHDNILTAKLPELFLNFS  224 (466)
Q Consensus       147 ~L~-~~n~l~~~~~~~l~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~-~~~~l~~l~~L~~L~L~~n~l~~~~~~~~~~~~  224 (466)
                      .|+ +.|.+++.    +|       ..+..+++|++|++++|.+++ +|..+.++++|++|++++|++++.+|..+..+ 
T Consensus       446 ~L~L~~n~l~~~----~p-------~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l-  513 (768)
T 3rgz_A          446 DLKLWLNMLEGE----IP-------QELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRL-  513 (768)
T ss_dssp             EEECCSSCCCSC----CC-------GGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGC-
T ss_pred             EEECCCCcccCc----CC-------HHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcC-
Confidence            666 55555544    44       555666666666666666665 56666666666666666666666666655544 


Q ss_pred             ccccccccceEecCCccccccCCCCcccccccCcccCCCCCCcEEeCCCCeee---------------------------
Q 047429          225 AGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLW---------------------------  277 (466)
Q Consensus       225 ~~~~~~~L~~L~L~~n~l~~~~~~~~~l~~~lp~~~~~l~~L~~L~L~~n~l~---------------------------  277 (466)
                           ++|++|++++|+++|          .+|..+..+++|++|++++|.+.                           
T Consensus       514 -----~~L~~L~L~~N~l~~----------~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~  578 (768)
T 3rgz_A          514 -----ENLAILKLSNNSFSG----------NIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYI  578 (768)
T ss_dssp             -----TTCCEEECCSSCCEE----------ECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEE
T ss_pred             -----CCCCEEECCCCcccC----------cCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccc
Confidence                 456666666666663          55677888899999999988762                           


Q ss_pred             ------------------------------------eecccccccCCCCCCCCCCccEEEccCCCCCCCchhhhhhhhhh
Q 047429          278 ------------------------------------LRFNHINGSATPKLCSSPMLQVLDFSHNNISGMVPTCLNNLSAM  321 (466)
Q Consensus       278 ------------------------------------l~~n~~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L  321 (466)
                                                          ++.+.+.|.+|..+..+++|++|||++|+++|.+|..|++++.|
T Consensus       579 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L  658 (768)
T 3rgz_A          579 KNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYL  658 (768)
T ss_dssp             ECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTC
T ss_pred             ccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccC
Confidence                                                01145556677788889999999999999999999999999999


Q ss_pred             hhcCCCCceeeeeeeccCCCCcccccceeeeeecccchhhhccCCCcEEECCCCcCCcCCcHHHHhhccCCCcccccCCC
Q 047429          322 VQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLS  401 (466)
Q Consensus       322 ~~l~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~ip~~i~~l~~~~ip~~l~~l~  401 (466)
                      +.|+++++..                      .+..+..++.++.|+.|||++|+++|            .+|.++..++
T Consensus       659 ~~L~Ls~N~l----------------------~g~ip~~l~~L~~L~~LdLs~N~l~g------------~ip~~l~~l~  704 (768)
T 3rgz_A          659 FILNLGHNDI----------------------SGSIPDEVGDLRGLNILDLSSNKLDG------------RIPQAMSALT  704 (768)
T ss_dssp             CEEECCSSCC----------------------CSCCCGGGGGCTTCCEEECCSSCCEE------------CCCGGGGGCC
T ss_pred             CEEeCcCCcc----------------------CCCCChHHhCCCCCCEEECCCCcccC------------cCChHHhCCC
Confidence            9998655533                      34556677889999999999999997            5566789999


Q ss_pred             CCCeeeccCCcCcccCCCCCCccccccccccc
Q 047429          402 HLGVVNLSNNNFSGKIPSSIPLQTFEASAYKN  433 (466)
Q Consensus       402 ~L~~L~Ls~N~l~~~ip~~~~~~~~~~~~~~~  433 (466)
                      +|++||+++|+++|.||+..++.++...+|..
T Consensus       705 ~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~g  736 (768)
T 3rgz_A          705 MLTEIDLSNNNLSGPIPEMGQFETFPPAKFLN  736 (768)
T ss_dssp             CCSEEECCSSEEEEECCSSSSGGGSCGGGGCS
T ss_pred             CCCEEECcCCcccccCCCchhhccCCHHHhcC
Confidence            99999999999999999999999998888754



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 466
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 63.6 bits (153), Expect = 9e-12
 Identities = 48/266 (18%), Positives = 88/266 (33%), Gaps = 18/266 (6%)

Query: 174 SNVTSLMDLDLSKNQITG---IPKSFGDMCCLKT--LKIHDNILTAKLPELFLNFSAGCA 228
           +    + +LDLS   +     IP S  ++  L    +   +N++    P +         
Sbjct: 47  TQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYL 106

Query: 229 KKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSAT 288
             +  +           +  +  LD ++          +        +    N I+G+  
Sbjct: 107 YITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIP 166

Query: 289 PKLCSSPMLQVLDFSHNN-ISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQD 347
               S   L        N ++G +P    NL+    + S N++      L    +   + 
Sbjct: 167 DSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDKNTQKI 226

Query: 348 RALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKIPEEITSLLIGKIPRSFSQLSHLGVVN 407
                    D            +DL +N + G +P+              +QL  L  +N
Sbjct: 227 HLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQ------------GLTQLKFLHSLN 274

Query: 408 LSNNNFSGKIPSSIPLQTFEASAYKN 433
           +S NN  G+IP    LQ F+ SAY N
Sbjct: 275 VSFNNLCGEIPQGGNLQRFDVSAYAN 300


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query466
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.81
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.75
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.73
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.62
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.6
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.51
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.07
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.08
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.0
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.52
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.48
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.95  E-value=1.3e-28  Score=232.67  Aligned_cols=255  Identities=31%  Similarity=0.465  Sum_probs=188.2

Q ss_pred             CCCEEEcCCCCCCCCCccccccccCCCCCccEEEcCC-CCCCchhhhhhhcccCCCcEEEccCCccccCCChhhhhcCCc
Q 047429           66 SLRELDLSSSAPPKINYRSHSLVNSSSSSLTHLHLSL-CGLSNSAYHCLSHISKSLVYLDLSNNQLQGPTPDYAFRNMTS  144 (466)
Q Consensus        66 ~L~~L~Ls~n~l~~~~~~~~~~~~~~l~~L~~L~Ls~-n~l~~~~~~~l~~l~~~L~~L~Ls~n~l~~~~~~~~~~~l~~  144 (466)
                      +++.|+|++|.+.+..+....++.  +++|++|+|++ |.+++.+|..+.++ ++|++|+|++|++.+..+. .+..+..
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~~--L~~L~~L~Ls~~N~l~g~iP~~i~~L-~~L~~L~Ls~N~l~~~~~~-~~~~~~~  126 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLAN--LPYLNFLYIGGINNLVGPIPPAIAKL-TQLHYLYITHTNVSGAIPD-FLSQIKT  126 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGGG--CTTCSEEEEEEETTEESCCCGGGGGC-TTCSEEEEEEECCEEECCG-GGGGCTT
T ss_pred             EEEEEECCCCCCCCCCCCChHHhc--Cccccccccccccccccccccccccc-cccchhhhccccccccccc-cccchhh
Confidence            566777777776654222245666  77777777775 66766677777777 7777777777777766666 6777777


Q ss_pred             ccccc-cccccccccccCCCccccCccccccCCCccCEEecCCCcCCC-CCcccCCCCCc-CEEEeeCCcCCCccchhhh
Q 047429          145 LASLT-SLNYITGISKCSLPITLVRPKYAFSNVTSLMDLDLSKNQITG-IPKSFGDMCCL-KTLKIHDNILTAKLPELFL  221 (466)
Q Consensus       145 L~~L~-~~n~l~~~~~~~l~~~~~~~~~~l~~l~~L~~L~Ls~n~l~~-~~~~l~~l~~L-~~L~L~~n~l~~~~~~~~~  221 (466)
                      |+.++ +.|.+...    +|       ..+..+++++.+++++|.+.+ +|..+..+..+ +.+++++|++++..+..+.
T Consensus       127 L~~l~l~~N~~~~~----~p-------~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~  195 (313)
T d1ogqa_         127 LVTLDFSYNALSGT----LP-------PSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFA  195 (313)
T ss_dssp             CCEEECCSSEEESC----CC-------GGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGG
T ss_pred             hccccccccccccc----Cc-------hhhccCcccceeecccccccccccccccccccccccccccccccccccccccc
Confidence            77777 66666655    55       677888888888888888876 78777777665 7888888888887777654


Q ss_pred             hccccccccccceEecCCccccccCCCCcccccccCcccCCCCCCcEEeCCCCeeeeecccccccCCCCCCCCCCccEEE
Q 047429          222 NFSAGCAKKSLQSFMLQNNMLSGSLPGVTELDGTFPKQFCRPSSLVELDLESNQLWLRFNHINGSATPKLCSSPMLQVLD  301 (466)
Q Consensus       222 ~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~l~~~lp~~~~~l~~L~~L~L~~n~l~l~~n~~~~~~~~~~~~l~~L~~L~  301 (466)
                      ..       ....++++++...|          .+|..+..+++++.+++++|.+       .+. +..++.+++|++|+
T Consensus       196 ~l-------~~~~l~l~~~~~~~----------~~~~~~~~~~~l~~l~~~~~~l-------~~~-~~~~~~~~~L~~L~  250 (313)
T d1ogqa_         196 NL-------NLAFVDLSRNMLEG----------DASVLFGSDKNTQKIHLAKNSL-------AFD-LGKVGLSKNLNGLD  250 (313)
T ss_dssp             GC-------CCSEEECCSSEEEE----------CCGGGCCTTSCCSEEECCSSEE-------CCB-GGGCCCCTTCCEEE
T ss_pred             cc-------cccccccccccccc----------cccccccccccccccccccccc-------ccc-cccccccccccccc
Confidence            43       35678888887774          3455677888899999988654       333 44678888999999


Q ss_pred             ccCCCCCCCchhhhhhhhhhhhcCCCCceeeeeeeccCCCCcccccceeeeeecccchhhhccCCCcEEECCCCcCCcCC
Q 047429          302 FSHNNISGMVPTCLNNLSAMVQNGSSNVIVEYRIQLIDDPEFDYQDRALLVWKPIDSIYKITLGLPKSIDLSDNNLSGKI  381 (466)
Q Consensus       302 Ls~N~l~~~~p~~~~~l~~L~~l~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~N~l~~~i  381 (466)
                      |++|+++|.+|+.|+++++|                                              ++|||++|+|+|.+
T Consensus       251 Ls~N~l~g~iP~~l~~L~~L----------------------------------------------~~L~Ls~N~l~g~i  284 (313)
T d1ogqa_         251 LRNNRIYGTLPQGLTQLKFL----------------------------------------------HSLNVSFNNLCGEI  284 (313)
T ss_dssp             CCSSCCEECCCGGGGGCTTC----------------------------------------------CEEECCSSEEEEEC
T ss_pred             CccCeecccCChHHhCCCCC----------------------------------------------CEEECcCCcccccC
Confidence            99999998888888877666                                              88999999998755


Q ss_pred             cHHHHhhccCCCcccccCCCCCCeeeccCCc-Cccc-CCC
Q 047429          382 PEEITSLLIGKIPRSFSQLSHLGVVNLSNNN-FSGK-IPS  419 (466)
Q Consensus       382 p~~i~~l~~~~ip~~l~~l~~L~~L~Ls~N~-l~~~-ip~  419 (466)
                      |             .++++++|+.+++++|+ ++|. +|.
T Consensus       285 P-------------~~~~L~~L~~l~l~~N~~l~g~plp~  311 (313)
T d1ogqa_         285 P-------------QGGNLQRFDVSAYANNKCLCGSPLPA  311 (313)
T ss_dssp             C-------------CSTTGGGSCGGGTCSSSEEESTTSSC
T ss_pred             C-------------CcccCCCCCHHHhCCCccccCCCCCC
Confidence            5             25678889999999997 5553 553



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure