Citrus Sinensis ID: 047447


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKILN
ccccccEEEcccccccccccccccccccccccccccccHHHHHccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccccccHHHHccccccEEEccccccccccHHccccccccEEEcccccccccccccc
ccHHHHEEccccccHHHccccccccHHcccHHHHHHHHHHHHHccccccccccHHHHHHHcccEEEcccccHHHHccHHHHcHHHccEEEccccccHcccHHHHHHccccEEEccccccccccHHHHHHHcccEEEcccccHHcccHHcc
MLKSLQSIEISNCSILKRFleipscnidggigiERLASCKLVLEKCLslqslpsslcmfksltsleiidcqnfkilpyelGNLKALETLIVdgtlirevpeslgqlssLKILVLTNNGLKRLPESLNQLSSLKRlvlsdnplkilpkiln
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQlsslkrlvlsdnplkilpkiln
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKClslqslpsslCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKILN
*******IEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLP********LKRLVL*************
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKILN
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKILN
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKIL*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILPKILN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q6DHL5238 Leucine-rich repeat-conta yes no 0.646 0.407 0.387 4e-12
Q96CX6 371 Leucine-rich repeat-conta yes no 0.673 0.272 0.407 3e-11
Q3UGP9 366 Leucine-rich repeat-conta yes no 0.673 0.275 0.407 6e-11
Q6UWE0 723 E3 ubiquitin-protein liga no no 0.853 0.177 0.326 2e-10
Q9ERV7 915 p53-induced protein with no no 0.686 0.112 0.367 2e-09
Q6ZVD8 1323 PH domain leucine-rich re no no 0.62 0.070 0.372 2e-09
Q80ZI6 727 E3 ubiquitin-protein liga no no 0.853 0.176 0.318 2e-09
Q96NW7 1537 Leucine-rich repeat-conta no no 0.653 0.063 0.333 3e-09
F1MCA7 1536 Leucine-rich repeat-conta no no 0.653 0.063 0.333 3e-09
Q80TE7 1490 Leucine-rich repeat-conta no no 0.653 0.065 0.333 5e-09
>sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 Back     alignment and function desciption
 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 1/98 (1%)

Query: 49  LQSLPSSLCMFKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSS 108
           ++ LP+ +  F+ L S   I C     LP ++G LK LETLI++G  ++++P S+GQL S
Sbjct: 50  IEELPAFIGSFQHLKSF-TISCNKLTSLPNDIGKLKKLETLILNGNQLKQLPSSIGQLKS 108

Query: 109 LKILVLTNNGLKRLPESLNQLSSLKRLVLSDNPLKILP 146
           L+ L L+ N  K  P  L  L  L  L LS N ++++P
Sbjct: 109 LRTLSLSGNQFKEFPSGLGTLRQLDVLDLSKNQIRVVP 146





Danio rerio (taxid: 7955)
>sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 Back     alignment and function description
>sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 Back     alignment and function description
>sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 Back     alignment and function description
>sp|Q9ERV7|PIDD_MOUSE p53-induced protein with a death domain OS=Mus musculus GN=Pidd PE=1 SV=1 Back     alignment and function description
>sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 Back     alignment and function description
>sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=2 SV=1 Back     alignment and function description
>sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 Back     alignment and function description
>sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 Back     alignment and function description
>sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
225448269 1256 PREDICTED: TMV resistance protein N-like 0.9 0.107 0.335 4e-13
359486100 1535 PREDICTED: TMV resistance protein N-like 0.9 0.087 0.335 6e-12
298204612 1384 unnamed protein product [Vitis vinifera] 0.893 0.096 0.361 2e-11
124003930 383 leucine Rich Repeat domain protein [Micr 0.646 0.253 0.428 2e-11
359486120 1218 PREDICTED: TMV resistance protein N-like 0.9 0.110 0.342 3e-11
359486106 1320 PREDICTED: TMV resistance protein N-like 0.706 0.080 0.392 3e-11
298204609 1176 unnamed protein product [Vitis vinifera] 0.906 0.115 0.314 4e-11
443652792 875 small GTP-binding domain protein [Microc 0.673 0.115 0.362 5e-11
359486092 919 PREDICTED: TMV resistance protein N-like 0.906 0.147 0.314 5e-11
379731535 526 putative lipoprotein [Saprospira grandis 0.78 0.222 0.409 5e-11
>gi|225448269|ref|XP_002270337.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 82/146 (56%), Gaps = 11/146 (7%)

Query: 2    LKSLQSIEISNCSILKRFLEIPSCNIDGGIGIERLASCKLVLEKCLSLQSLPSSLCMFKS 61
             +SL+++++S CS  ++F EI             + S K +L    +++ LP S+   KS
Sbjct: 924  WESLRTLDLSKCSKFEKFPEIQG----------NMTSLKKLLLNNTAIKGLPDSIGYLKS 973

Query: 62   LTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTN-NGLK 120
            L  L + DC  F+  P + GN+K+L+ L +  T I+++P+S+G L SL  L LTN +  +
Sbjct: 974  LEILNVSDCSKFENFPEKGGNMKSLKELSLKNTAIKDLPDSIGDLESLWFLDLTNCSKFE 1033

Query: 121  RLPESLNQLSSLKRLVLSDNPLKILP 146
            + PE    + SL+ L L+D  +K LP
Sbjct: 1034 KFPEKGGNMKSLRVLYLNDTAIKDLP 1059




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359486100|ref|XP_002274578.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204612|emb|CBI23887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|124003930|ref|ZP_01688777.1| leucine Rich Repeat domain protein [Microscilla marina ATCC 23134] gi|123990509|gb|EAY29989.1| leucine Rich Repeat domain protein [Microscilla marina ATCC 23134] Back     alignment and taxonomy information
>gi|359486120|ref|XP_003633392.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486106|ref|XP_002274951.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298204609|emb|CBI23884.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|443652792|ref|ZP_21130908.1| small GTP-binding domain protein [Microcystis aeruginosa DIANCHI905] gi|443334234|gb|ELS48757.1| small GTP-binding domain protein [Microcystis aeruginosa DIANCHI905] Back     alignment and taxonomy information
>gi|359486092|ref|XP_002274052.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|379731535|ref|YP_005323731.1| putative lipoprotein [Saprospira grandis str. Lewin] gi|378577146|gb|AFC26147.1| putative lipoprotein [Saprospira grandis str. Lewin] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
ZFIN|ZDB-GENE-040718-372238 lrrc57 "leucine rich repeat co 0.58 0.365 0.409 9.1e-13
UNIPROTKB|F1RS16 723 LRSAM1 "Uncharacterized protei 0.893 0.185 0.312 1.9e-12
UNIPROTKB|Q6UWE0 723 LRSAM1 "E3 ubiquitin-protein l 0.86 0.178 0.299 2.8e-11
UNIPROTKB|I3LED7354 LOC100737964 "Uncharacterized 0.586 0.248 0.359 5.6e-11
UNIPROTKB|E2RR59 728 LRSAM1 "Uncharacterized protei 0.86 0.177 0.291 7.7e-11
UNIPROTKB|J9P525 728 LRSAM1 "Uncharacterized protei 0.86 0.177 0.291 7.7e-11
UNIPROTKB|Q08E63 724 LRSAM1 "Uncharacterized protei 0.86 0.178 0.291 9.7e-11
UNIPROTKB|I3L187 723 PHLPP2 "PH domain leucine-rich 0.586 0.121 0.370 1.2e-10
MGI|MGI:2684789 727 Lrsam1 "leucine rich repeat an 0.86 0.177 0.291 1.3e-10
UNIPROTKB|E1BRU6 728 LRSAM1 "Uncharacterized protei 0.893 0.184 0.270 1.6e-10
ZFIN|ZDB-GENE-040718-372 lrrc57 "leucine rich repeat containing 57" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 169 (64.5 bits), Expect = 9.1e-13, P = 9.1e-13
 Identities = 36/88 (40%), Positives = 52/88 (59%)

Query:    59 FKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNG 118
             F+ L S  I  C     LP ++G LK LETLI++G  ++++P S+GQL SL+ L L+ N 
Sbjct:    60 FQHLKSFTI-SCNKLTSLPNDIGKLKKLETLILNGNQLKQLPSSIGQLKSLRTLSLSGNQ 118

Query:   119 LKRLPESLNQLSSLKRLVLSDNPLKILP 146
              K  P  L  L  L  L LS N ++++P
Sbjct:   119 FKEFPSGLGTLRQLDVLDLSKNQIRVVP 146


GO:0008150 "biological_process" evidence=ND
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1RS16 LRSAM1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UWE0 LRSAM1 "E3 ubiquitin-protein ligase LRSAM1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LED7 LOC100737964 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR59 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P525 LRSAM1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E63 LRSAM1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3L187 PHLPP2 "PH domain leucine-rich repeat-containing protein phosphatase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2684789 Lrsam1 "leucine rich repeat and sterile alpha motif containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BRU6 LRSAM1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00011213001
SubName- Full=Chromosome undetermined scaffold_2324, whole genome shotgun sequence; Flags- Fragment; (811 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-09
PLN03210 1153 PLN03210, PLN03210, Resistant to P 7e-06
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
COG4886 394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
PLN03210 1153 PLN03210, PLN03210, Resistant to P 8e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-04
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.003
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
 Score = 53.7 bits (129), Expect = 4e-09
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 57  CMFKSLTSLEIIDCQNFK------ILPYELGNLKALETLIVDGTLIR-EVPESLGQLSSL 109
           C F S      ID            +P ++  L+ L+++ + G  IR  +P SLG ++SL
Sbjct: 409 CQFDSTKGKWFIDGLGLDNQGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSL 468

Query: 110 KILVLTNNGLK-RLPESLNQLSSLKRLVLSDNPL 142
           ++L L+ N     +PESL QL+SL+ L L+ N L
Sbjct: 469 EVLDLSYNSFNGSIPESLGQLTSLRILNLNGNSL 502


Length = 623

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.76
KOG0617264 consensus Ras suppressor protein (contains leucine 99.74
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.56
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.54
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.54
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.52
KOG0617264 consensus Ras suppressor protein (contains leucine 99.48
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.47
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.42
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.4
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.39
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.38
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.37
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.33
PLN03150623 hypothetical protein; Provisional 99.29
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.27
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.21
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.21
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.2
PLN03150 623 hypothetical protein; Provisional 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.05
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.04
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.75
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.71
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.7
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.65
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.59
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.57
PRK15386 426 type III secretion protein GogB; Provisional 98.53
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.46
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.41
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.37
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.25
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.08
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.99
PRK15386 426 type III secretion protein GogB; Provisional 97.84
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.82
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.66
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 97.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.5
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 97.5
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.36
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.17
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.02
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.96
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 96.95
KOG2982 418 consensus Uncharacterized conserved protein [Funct 96.82
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.75
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.71
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.52
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 96.52
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.46
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.29
smart0037026 LRR Leucine-rich repeats, outliers. 96.29
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.17
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.55
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.4
KOG0473 326 consensus Leucine-rich repeat protein [Function un 94.36
KOG3864221 consensus Uncharacterized conserved protein [Funct 94.12
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 93.89
KOG1947 482 consensus Leucine rich repeat proteins, some prote 93.66
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.82
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.47
KOG1947 482 consensus Leucine rich repeat proteins, some prote 92.4
KOG4341483 consensus F-box protein containing LRR [General fu 91.23
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 90.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.53
KOG4341483 consensus F-box protein containing LRR [General fu 87.45
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.32
KOG0473 326 consensus Leucine-rich repeat protein [Function un 82.27
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.77  E-value=1.5e-18  Score=138.26  Aligned_cols=146  Identities=26%  Similarity=0.319  Sum_probs=88.9

Q ss_pred             CCCCcEEecccCCCccccccCCcc-------ccCCCcCccc-ccc------cceecccccCCCcCcccccCCCCccEEEe
Q 047447            2 LKSLQSIEISNCSILKRFLEIPSC-------NIDGGIGIER-LAS------CKLVLEKCLSLQSLPSSLCMFKSLTSLEI   67 (150)
Q Consensus         2 l~~L~~L~l~~~~~~~~~p~~~~~-------l~l~~~~l~~-l~~------~~L~l~~~~~~~~~~~~~~~l~~L~~L~l   67 (150)
                      ++.|++|+|++|.+.+.+|...+.       +++++|.+.. +|.      ++|++++|.+.+..|..++.+++|++|++
T Consensus        92 l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L  171 (968)
T PLN00113         92 LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDL  171 (968)
T ss_pred             CCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEEC
Confidence            677888888887777666665431       6666666642 222      56666666555566666666666666666


Q ss_pred             ecCcccCCCchhhcCcCcCceEEecCCCCC-ccchhhcCCCCCCEEEccCCcCcc-cCccccCCCCCCEEEccCCCCC-C
Q 047447           68 IDCQNFKILPYELGNLKALETLIVDGTLIR-EVPESLGQLSSLKILVLTNNGLKR-LPESLNQLSSLKRLVLSDNPLK-I  144 (150)
Q Consensus        68 ~~~~~~~~~~~~~~~l~~L~~l~l~~n~l~-~l~~~~~~~~~L~~l~l~~n~i~~-lp~~~~~~~~L~~l~l~~n~l~-~  144 (150)
                      ++|.+.+..|..+..+++|+.|++++|.+. .+|..++.+++|+++++++|.+.+ +|..++.+++|++|++++|.+. .
T Consensus       172 ~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~  251 (968)
T PLN00113        172 GGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGP  251 (968)
T ss_pred             ccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccc
Confidence            666666666666666666666666666554 445555566666666666666554 5555555556666666555554 4


Q ss_pred             CCC
Q 047447          145 LPK  147 (150)
Q Consensus       145 ~p~  147 (150)
                      +|.
T Consensus       252 ~p~  254 (968)
T PLN00113        252 IPS  254 (968)
T ss_pred             cCh
Confidence            443



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-15
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 9e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 9e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-05
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 6e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 9e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 9e-09
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-07
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 6e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 9e-05
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-05
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-05
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-05
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 3e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.84
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.83
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.8
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.79
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.79
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.79
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.78
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.78
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.78
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.78
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.78
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.78
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.78
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.77
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.77
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.77
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.77
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.77
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.76
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.76
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.76
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.76
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.75
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.75
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.75
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.75
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.74
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.74
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.73
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.73
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.72
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.72
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.71
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.71
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.7
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.7
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.7
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.7
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.7
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.7
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.69
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.69
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.68
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.67
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.67
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.67
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.67
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.67
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.67
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.66
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.66
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.65
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.65
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.64
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.63
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.63
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.63
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.62
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.53
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.51
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.49
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.49
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.49
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.42
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.4
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.38
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.25
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.25
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.01
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.99
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.96
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.91
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.71
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.71
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.61
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.55
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.42
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.4
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.3
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.85
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.54
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.37
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.3
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.1
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.09
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.06
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 97.05
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 96.8
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.55
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=99.87  E-value=9.3e-22  Score=138.84  Aligned_cols=144  Identities=24%  Similarity=0.311  Sum_probs=83.6

Q ss_pred             CCCCcEEecccCCCccccccCCcc------ccCCCcCcccccc--------cceecccccCCCcCcccccC---------
Q 047447            2 LKSLQSIEISNCSILKRFLEIPSC------NIDGGIGIERLAS--------CKLVLEKCLSLQSLPSSLCM---------   58 (150)
Q Consensus         2 l~~L~~L~l~~~~~~~~~p~~~~~------l~l~~~~l~~l~~--------~~L~l~~~~~~~~~~~~~~~---------   58 (150)
                      +++|++|+|++|.+. .+|..+..      +++++|.++.+|.        ++|++++|+..+.+|..+..         
T Consensus       103 l~~L~~L~L~~n~l~-~lp~~~~~l~~L~~L~Ls~n~l~~lp~~l~~l~~L~~L~L~~n~~~~~~p~~~~~~~~~~~~~~  181 (328)
T 4fcg_A          103 LSHLQHMTIDAAGLM-ELPDTMQQFAGLETLTLARNPLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQG  181 (328)
T ss_dssp             GTTCSEEEEESSCCC-CCCSCGGGGTTCSEEEEESCCCCCCCGGGGGCTTCCEEEEEEETTCCCCCSCSEEEC-CCCEEE
T ss_pred             CCCCCEEECCCCCcc-chhHHHhccCCCCEEECCCCccccCcHHHhcCcCCCEEECCCCCCccccChhHhhccchhhhcc
Confidence            456677777776655 55654433      6666666666654        66667766666666654433         


Q ss_pred             CCCccEEEeecCcccCCCchhhcCcCcCceEEecCCCCCccchhhcCCCCCCEEEccCCcCcc-cCccccCCCCCCEEEc
Q 047447           59 FKSLTSLEIIDCQNFKILPYELGNLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKR-LPESLNQLSSLKRLVL  137 (150)
Q Consensus        59 l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~l~l~~n~l~~l~~~~~~~~~L~~l~l~~n~i~~-lp~~~~~~~~L~~l~l  137 (150)
                      +++|++|++++|.+. .+|..+..+++|+.|++++|.++.+|+.+..+++|++|++++|.+.+ +|..+..+++|+.|++
T Consensus       182 l~~L~~L~L~~n~l~-~lp~~l~~l~~L~~L~L~~N~l~~l~~~l~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L  260 (328)
T 4fcg_A          182 LVNLQSLRLEWTGIR-SLPASIANLQNLKSLKIRNSPLSALGPAIHHLPKLEELDLRGCTALRNYPPIFGGRAPLKRLIL  260 (328)
T ss_dssp             STTCCEEEEEEECCC-CCCGGGGGCTTCCEEEEESSCCCCCCGGGGGCTTCCEEECTTCTTCCBCCCCTTCCCCCCEEEC
T ss_pred             CCCCCEEECcCCCcC-cchHhhcCCCCCCEEEccCCCCCcCchhhccCCCCCEEECcCCcchhhhHHHhcCCCCCCEEEC
Confidence            666666666665555 44555556666666666666666555555555666666666655444 5555555555555555


Q ss_pred             cCCCCC-CCCC
Q 047447          138 SDNPLK-ILPK  147 (150)
Q Consensus       138 ~~n~l~-~~p~  147 (150)
                      ++|.+. .+|.
T Consensus       261 ~~n~~~~~~p~  271 (328)
T 4fcg_A          261 KDCSNLLTLPL  271 (328)
T ss_dssp             TTCTTCCBCCT
T ss_pred             CCCCchhhcch
Confidence            554433 4443



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Leucine rich effector protein YopM
domain: Leucine rich effector protein YopM
species: Yersinia pestis [TaxId: 632]
 Score = 47.1 bits (110), Expect = 1e-07
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)

Query: 82  NLKALETLIVDGTLIREVPESLGQLSSLKILVLTNNGLKRLPESLNQLSSLKRLVLSDNP 141
              +LE L V    + E+P        L+ L+ + N L  +PE      +LK+L +  NP
Sbjct: 282 LPPSLEELNVSNNKLIELPALPP---RLERLIASFNHLAEVPELP---QNLKQLHVEYNP 335

Query: 142 LKILPKIL 149
           L+  P I 
Sbjct: 336 LREFPDIP 343


>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.7
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.58
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.58
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.56
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.54
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.46
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.43
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.09
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.02
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.99
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.96
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.89
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.78
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.73
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.53
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.5
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.12
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.68
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.98
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: von Willebrand factor binding domain of glycoprotein Ib alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=8.9e-19  Score=118.61  Aligned_cols=144  Identities=26%  Similarity=0.265  Sum_probs=103.7

Q ss_pred             CCcEEecccCCCccccccC-Ccc------ccCCCcCcccccc-------cceecccccCCCcCcccccCCCCccEEEeec
Q 047447            4 SLQSIEISNCSILKRFLEI-PSC------NIDGGIGIERLAS-------CKLVLEKCLSLQSLPSSLCMFKSLTSLEIID   69 (150)
Q Consensus         4 ~L~~L~l~~~~~~~~~p~~-~~~------l~l~~~~l~~l~~-------~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~   69 (150)
                      .+++|+|++|.+.+ +|.. +..      +++++|.|+.++.       ++|++++|++ ...+..+..+++|+.|++++
T Consensus        32 ~l~~L~Ls~N~i~~-l~~~~f~~l~~L~~L~L~~N~l~~l~~~~~l~~L~~L~Ls~N~l-~~~~~~~~~l~~L~~L~l~~  109 (266)
T d1p9ag_          32 DTTILHLSENLLYT-FSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQL-QSLPLLGQTLPALTVLDVSF  109 (266)
T ss_dssp             TCCEEECTTSCCSE-EEGGGGTTCTTCCEEECTTSCCCEEECCSCCTTCCEEECCSSCC-SSCCCCTTTCTTCCEEECCS
T ss_pred             CCCEEECcCCcCCC-cCHHHhhccccccccccccccccccccccccccccccccccccc-cccccccccccccccccccc
Confidence            57888888876553 3432 222      7778888776665       7788888643 44555677788888888888


Q ss_pred             CcccCCCchhhcCcCcCceEEecCCCCCccch-hhcCCCCCCEEEccCCcCcccCc-cccCCCCCCEEEccCCCCCCCCC
Q 047447           70 CQNFKILPYELGNLKALETLIVDGTLIREVPE-SLGQLSSLKILVLTNNGLKRLPE-SLNQLSSLKRLVLSDNPLKILPK  147 (150)
Q Consensus        70 ~~~~~~~~~~~~~l~~L~~l~l~~n~l~~l~~-~~~~~~~L~~l~l~~n~i~~lp~-~~~~~~~L~~l~l~~n~l~~~p~  147 (150)
                      |...+..+..+..+.+++.+++.+|.+..+++ .+..++.++.+++++|.++.++. .+..+++|++|++++|+|+.+|+
T Consensus       110 ~~~~~~~~~~~~~l~~l~~L~l~~n~l~~l~~~~~~~l~~l~~l~l~~N~l~~~~~~~~~~l~~L~~L~Ls~N~L~~lp~  189 (266)
T d1p9ag_         110 NRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPK  189 (266)
T ss_dssp             SCCCCCCSSTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECTTSCCSCCCTTTTTTCTTCCEEECCSSCCCCCCT
T ss_pred             cccceeeccccccccccccccccccccceeccccccccccchhcccccccccccCccccccccccceeecccCCCcccCh
Confidence            77777666666777778888888887777765 44667788888888888887553 46778888888888888888876


Q ss_pred             CC
Q 047447          148 IL  149 (150)
Q Consensus       148 ~~  149 (150)
                      .+
T Consensus       190 ~~  191 (266)
T d1p9ag_         190 GF  191 (266)
T ss_dssp             TT
T ss_pred             hH
Confidence            54



>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure