Citrus Sinensis ID: 047451

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVGSRVSRNGSGESVTIVI
cccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEccccccEEEEEccccccEEEEcccccccccccccEEEccccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccHHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccccccccccccEEEcccccccEEcccccccccccccEEEcccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccEEcccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccEEEEEccccEEEccHHccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEcccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEccccEEEEEccccccccccccccEEEcccccccccccHHHHHHHHHHHHcccccccEEcccccccccccccccccEEEEEEEEEEccccHHHHHHHHHHcEEEcccccccccccHHHHccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEc
ccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccEEEEEEEccccccccccccccHcccccccEEEccccccccccccHHHccccccEEEEcccccccccccHHHHcccccEEEEcccccccccccccccccccHHHcccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHHccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHcccccEEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEEcccccccccccHHHcccccccEEEEcccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEEcccccccccccccHHccccccEEEEcccccccccccHHHHHHHHHEEcccccccccccHHHccccccEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEcccccccccccccHHccccccEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHEEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHHHHcHcccccccccccccccccccHHHHcccHEEEEEcccHHcccccccHEEEEc
PLCHDHERSALLNFKESLVINrtasgypsaypkvaswkldeknsdcclwdgvkcnedtghVVELDLAssclygsvnstsSLFQLVHLQrlslfdnnfnfseipseiLNFSRlthlnlsrsyfsgqipaellelsnlevldlsfNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFlslsgcrlqgefpqeifqlpnlqflgvmknpnltgylpqfqksspledlrlsytrfsgkipsslgnltkledlylsggngfsnelppsignlaslktleissfnfsgtlqaslgnltqldsltisdsnfsgpmssslswltnlnqltslnfpncnlnepllvpntqkfeiiglrscnlsefpsflhnqdqlisldlssnmiagkipewlfsagtnsLQYLNLSYNLLMHfehnlpvlpwnnlgaldlrfnklqgplpipisvltssylvsnnqltgeippsicslnglYALDLSynnlsgmlpaclGNFSVQLWVLKLQgnkfhgfipetfnkgtnlrmidfsnnllvpkslancvklkfldlgdnqitdffpswlgtlpeLEVLILKsnnfhgvieepnaCFEFVKLRIIDlshnrfagnlpskhfECWNAMKDVNANNLTYlqdsllgpvsypaythygfsdysltlsnkgteMEYEKLSNLITATilsnnsfvgeiptsisnlkglrtlnlsnnnlqvflspffidffffysrcphvlvcpsshlfrvvaaphGTLTVALWASVgsrvsrngsgesvtivi
PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFsgkipsslgnlTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWasvgsrvsrngsgesvtivi
PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAellelsnlevldlSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTnslqylnlsynllMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVflspffidffffYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWAsvgsrvsrngsgesvTIVI
**********LLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQK***LEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTI************LSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVG****************
PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDV******YLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVGSRVSRNGSGESVTIVI
********SALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVGS***************
PLCHDHERSALLNFKESLVI****SG*PSAYPKVASW*LDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVGSRVSRNGSGESVTIVI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLLVPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPFFIDFFFFYSRCPHVLVCPSSHLFRVVAAPHGTLTVALWASVGSRVSRNGSGESVTIVI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query778 2.2.26 [Sep-21-2011]
Q9C9H7847 Receptor-like protein 12 no no 0.811 0.744 0.324 2e-78
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.766 0.476 0.320 2e-54
C0LGQ5 1249 LRR receptor-like serine/ no no 0.795 0.495 0.326 2e-52
Q9M2Z1 1002 Leucine-rich repeat recep no no 0.715 0.555 0.313 2e-50
Q9FL28 1173 LRR receptor-like serine/ no no 0.813 0.539 0.299 8e-49
O49545 1003 Leucine-rich repeat recep no no 0.715 0.555 0.304 1e-47
C0LGR3 1091 Probable LRR receptor-lik no no 0.771 0.549 0.275 2e-46
Q9SSL9 1123 Leucine-rich repeat recep no no 0.740 0.512 0.313 2e-46
Q9LP24 1120 Probable leucine-rich rep no no 0.805 0.559 0.284 2e-46
P93194 1109 Receptor-like protein kin N/A no 0.746 0.523 0.312 5e-46
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score =  294 bits (752), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 240/739 (32%), Positives = 351/739 (47%), Gaps = 108/739 (14%)

Query: 2   LCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLD-EKNSDCCLWDGVKCNEDTGH 60
            C D +R ALL F+    IN       +++  +  W+    K++DCCLW+GV CN+ +G 
Sbjct: 33  FCRDDQRDALLEFRGEFPIN-------ASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQ 85

Query: 61  VVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRS 120
           V+ LD+ ++ L   + + SSLF+L +L+ L L + N  + EIPS + N S LT +NL  +
Sbjct: 86  VISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNL-YGEIPSSLGNLSHLTLVNLYFN 144

Query: 121 YFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISS 180
            F G+IPA +                                 NL  L+ L L N  ++ 
Sbjct: 145 KFVGEIPASI--------------------------------GNLNQLRHLILANNVLTG 172

Query: 181 TVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLP-QFQKSSP 239
            +P +L NLS L  L L   RL G+ P  I  L  L+ L +  N NL G +P      S 
Sbjct: 173 EIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASN-NLIGEIPSSLGNLSN 231

Query: 240 LEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNF 299
           L  L L++ +  G++P+S+GNL +L  +     N  S  +P S  NL  L    +SS NF
Sbjct: 232 LVHLVLTHNQLVGEVPASIGNLIELRVMSFE-NNSLSGNIPISFANLTKLSIFVLSSNNF 290

Query: 300 SGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNT 359
           + T    +     L+   +S ++FSGP   SL                      LL+P+ 
Sbjct: 291 TSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSL----------------------LLIPSL 328

Query: 360 QKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYN 419
           +   +   +     EF +   +  +L  L L  N + G IPE +  +   +L+ L++S+N
Sbjct: 329 ESIYLQENQFTGPIEFAN-TSSSTKLQDLILGRNRLHGPIPESI--SRLLNLEELDISHN 385

Query: 420 LLMHFEHNLP--VLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSN------------ 465
              +F   +P  +    NL  LDL  N L+G +P  +  L +  L  N            
Sbjct: 386 ---NFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEE 442

Query: 466 ----------NQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGN 515
                     N   G IP  IC L+ L  LDLS N  SG +P+C+ NFS  +  L L  N
Sbjct: 443 ALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDN 502

Query: 516 KFHGFIPETFNKGTNLRMIDFSNNLL---VPKSLANCVKLKFLDLGDNQITDFFPSWLGT 572
            F G +P+ F+K T L  +D S+N L    PKSL NC  L+ +++  N+I D FPSWL +
Sbjct: 503 NFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLES 562

Query: 573 LPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNA 632
           LP L VL L+SN F+G +   +A   F  LRIID+SHN F+G LP  +F  W  M     
Sbjct: 563 LPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMT---- 618

Query: 633 NNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGE 692
             LT   D  +      A ++Y    + + + NKG +M +E++     A   S N   G 
Sbjct: 619 -TLTEEMDQYMTEFWRYADSYY----HEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGN 673

Query: 693 IPTSISNLKGLRTLNLSNN 711
           IP S+  LK LR LNLS N
Sbjct: 674 IPESLGYLKELRVLNLSGN 692
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query778
359490156 886 PREDICTED: receptor-like protein 12-like 0.898 0.788 0.502 1e-179
147782974 1719 hypothetical protein VITISV_036826 [Viti 0.903 0.408 0.478 1e-177
224140509 961 predicted protein [Populus trichocarpa] 0.910 0.736 0.470 1e-177
224140511 894 predicted protein [Populus trichocarpa] 0.910 0.791 0.502 1e-172
224140505 993 predicted protein [Populus trichocarpa] 0.903 0.707 0.439 1e-154
224140513 947 predicted protein [Populus trichocarpa] 0.926 0.761 0.437 1e-151
359485824 973 PREDICTED: receptor-like protein 12-like 0.897 0.717 0.451 1e-149
255548694 984 serine/threonine-protein kinase bri1, pu 0.906 0.716 0.441 1e-149
224128143 923 predicted protein [Populus trichocarpa] 0.908 0.765 0.442 1e-146
255548700 932 serine-threonine protein kinase, plant-t 0.867 0.724 0.438 1e-146
>gi|359490156|ref|XP_003634044.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  636 bits (1641), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 370/736 (50%), Positives = 480/736 (65%), Gaps = 37/736 (5%)

Query: 1   PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWK---LDEKNSDCCLWDGVKCNED 57
           PLCHD ERSALL FK+S +I+  ASG PSAYPKVA WK     E+ SDCC WDGV+C+ +
Sbjct: 12  PLCHDSERSALLQFKQSFLIDGHASGDPSAYPKVAMWKSHGEGEEGSDCCSWDGVECDRE 71

Query: 58  TGHVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNL 117
           TGHV+ L LASSCLYGS+NS S+LF LVHL+RL L DN+FN+S+IP  +   SRL  L+L
Sbjct: 72  TGHVIGLHLASSCLYGSINSNSTLFSLVHLRRLDLSDNDFNYSQIPFGVGQLSRLRSLDL 131

Query: 118 SRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVH 177
           S   F+GQIP+ELL LS L  L+LS N      L+LQKPGL  L +NLT+LK L L  V+
Sbjct: 132 SSDRFAGQIPSELLALSKLVFLNLSANPM----LQLQKPGLRYLVQNLTHLKELHLRQVN 187

Query: 178 ISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKS 237
           ISST+PH LANLSSL  L L  C L GEFP  IFQLP+LQFL V  NP+L GYLP+FQ++
Sbjct: 188 ISSTIPHELANLSSLRTLFLRECGLHGEFPMNIFQLPSLQFLSVRYNPDLIGYLPEFQET 247

Query: 238 SPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSF 297
           SPL+ L LS T FSG++P+S+G L  L  L +S  N F+  +P  +G+L+ L  L++S+ 
Sbjct: 248 SPLKLLYLSGTSFSGELPTSIGRLGSLTKLDISSCN-FTGLVPSPLGHLSQLSYLDLSNN 306

Query: 298 NFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNL----------------NQLT 341
            FSG + +S+ NLT+L  L +S +N  G + +SL  L NL                N+L+
Sbjct: 307 FFSGQIPSSMANLTRLTFLDLSLNNLEGGIPTSLFELVNLQYLSVADNSLNGTVELNRLS 366

Query: 342 SLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPE 401
            L +   N+  P       KF+++GL SCNL+EFP FL NQD+L  L LS N I G IP+
Sbjct: 367 LLGYTRTNVTLP-------KFKLLGLDSCNLTEFPDFLQNQDELEVLFLSDNKIHGPIPK 419

Query: 402 WLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSY 461
           W+++    +L+ L+LS NLL  F  +  VLPW+ L  L+L  N LQGPLPIP       Y
Sbjct: 420 WMWNISQENLESLDLSGNLLTGFNQHPVVLPWSKLSILELDSNMLQGPLPIPPPSTIEYY 479

Query: 462 LVSNNQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFI 521
            VS N+L GEI P IC+++ L  LDLS NNLSG +P CL N S  L++L L  N   G I
Sbjct: 480 SVSRNKLIGEISPLICNMSSLILLDLSSNNLSGRIPQCLANLSKSLFILDLGSNNLDGPI 539

Query: 522 PETFNKGTNLRMIDFSNNLL---VPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEV 578
           P+T     NLR+ID   N     +P+S ANC+ L+ L LG+NQI D FP WLG LP+L+V
Sbjct: 540 PQTCTVPNNLRVIDLGENQFQGQIPRSFANCMMLEHLVLGNNQIDDIFPFWLGALPQLQV 599

Query: 579 LILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVN-ANNLTY 637
           LIL+SN FHG I   ++ F F KLRI+DLS N+F G+LPS++F+ W+AMK  + AN+L Y
Sbjct: 600 LILRSNRFHGAIGSWHSNFRFPKLRIVDLSDNKFIGDLPSEYFQNWDAMKLTDIANDLRY 659

Query: 638 LQDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSI 697
           +Q         P Y       YS+T++N+G +  YEK+ ++  A   S N+F G+IPTSI
Sbjct: 660 MQAR--PKFQIPGYGWTAHYMYSMTMTNRGMQRFYEKIPDVFIAIDFSGNNFKGQIPTSI 717

Query: 698 SNLKGLRTLNLSNNNL 713
            NL G   LNL +NNL
Sbjct: 718 GNLNGFHLLNLGSNNL 733

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147782974|emb|CAN66148.1| hypothetical protein VITISV_036826 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140509|ref|XP_002323625.1| predicted protein [Populus trichocarpa] gi|222868255|gb|EEF05386.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140511|ref|XP_002323626.1| predicted protein [Populus trichocarpa] gi|222868256|gb|EEF05387.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140505|ref|XP_002323623.1| predicted protein [Populus trichocarpa] gi|222868253|gb|EEF05384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224140513|ref|XP_002323627.1| predicted protein [Populus trichocarpa] gi|222868257|gb|EEF05388.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359485824|ref|XP_003633343.1| PREDICTED: receptor-like protein 12-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255548694|ref|XP_002515403.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] gi|223545347|gb|EEF46852.1| serine/threonine-protein kinase bri1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224128143|ref|XP_002329092.1| predicted protein [Populus trichocarpa] gi|222869761|gb|EEF06892.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255548700|ref|XP_002515406.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223545350|gb|EEF46855.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query778
TAIR|locus:2119445719 AT4G13820 [Arabidopsis thalian 0.872 0.944 0.342 6.9e-86
TAIR|locus:2046357890 RLP23 "receptor like protein 2 0.830 0.725 0.341 6.4e-85
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.469 0.387 0.352 7.5e-84
TAIR|locus:22050051019 RLP7 "AT1G47890" [Arabidopsis 0.769 0.587 0.341 1.9e-83
TAIR|locus:2087253884 RLP39 "AT3G24900" [Arabidopsis 0.825 0.726 0.359 2.2e-82
TAIR|locus:2078102875 RLP33 "receptor like protein 3 0.867 0.771 0.322 3.8e-78
TAIR|locus:2825762994 RLP6 "AT1G45616" [Arabidopsis 0.688 0.539 0.346 5.9e-78
TAIR|locus:2086979890 RLP42 "receptor like protein 4 0.814 0.712 0.350 2.1e-77
TAIR|locus:2086974881 RLP41 "AT3G25010" [Arabidopsis 0.826 0.729 0.343 5.5e-77
TAIR|locus:2046515864 RLP24 "receptor like protein 2 0.827 0.745 0.338 5e-76
TAIR|locus:2119445 AT4G13820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 859 (307.4 bits), Expect = 6.9e-86, P = 6.9e-86
 Identities = 247/722 (34%), Positives = 346/722 (47%)

Query:     2 LCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHV 61
             LC   +++ALL FK    ++   S       K   W+    N+DCC WDG+ C+  TG V
Sbjct:    28 LCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWR---NNTDCCSWDGISCDPKTGKV 84

Query:    62 VELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSY 121
             VELDL +S L G +   SSLF+L HL  L L  NNF+   +P  I +   L  L+L    
Sbjct:    85 VELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFS-GILPDSIGSLKYLRVLSLGDCN 143

Query:   122 FSGQIPAXXXXXXXXXXXXXSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISST 181
               G+IP+             S N F           L +   +L  L  L L +  +S  
Sbjct:   144 LFGKIPSSLGNLTYLTNLDLSVNDFTG--------ELPDSMGHLNKLTELHLGSAKLSGN 195

Query:   182 VPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSP-L 240
              P  L NLS L  + L   +  G  P  +  L  L + G+ +N + +G +P      P L
Sbjct:   196 FPSMLLNLSELTLIDLGSNQFGGMLPSNMSSLSKLVYFGIDRN-SFSGSIPSSLFMLPSL 254

Query:   241 EDLRLSYTRFSGKIPSSLGNLTKLEDLYLSG--GNGFSNELPPSIGNLASLKTLEISSFN 298
               L L    F+G  P   GN++   +L +     N F+  +P SI  L  L  L++S +N
Sbjct:   255 TSLVLGRNDFNG--PLDFGNISSPSNLGVLSLLENNFNGPIPESISKLVGLFYLDLSLWN 312

Query:   299 FSGTLQASLGNLTQLDSLTISDSNFSGPMSS-SLSWLTNLNQLTSLNFPNCNL--NEPLL 355
                 +         L SLT  D ++    S   +S  + L  L  L+    NL  +  L 
Sbjct:   313 TKRGM-VDFNTFLHLKSLTFLDLSYINTRSMVDISIFSPLLSLGYLDLSGINLKISSTLS 371

Query:   356 VPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTXXXXXXX 415
             +P+     I  L SCN+ EFP+FL NQ  L  LD+S+N I G++P+WL+S          
Sbjct:   372 LPSPMGTLI--LSSCNIPEFPNFLENQTTLYYLDISANKIGGQVPQWLWSLPELQYVNIS 429

Query:   416 XXXXXXMHFEHNLPVLP-WNNLGALDLRFNKLQGPLPI-PISVLTSSYLVSNNQLTGEIP 473
                     FE    V+     L  LD+  N  Q P P+ P S  T+ +L S+N+ +GEIP
Sbjct:   430 QNSFSG--FEGPADVIQRCGELLMLDISSNTFQDPFPLLPNS--TTIFLGSDNRFSGEIP 485

Query:   474 PSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRM 533
              +IC L  L  L LS NN +G +P C   F+  L VL L+ N   G  PE  +   +LR 
Sbjct:   486 KTICKLVSLDTLVLSNNNFNGSIPRCFEKFNTTLSVLHLRNNNLSGEFPEE-SISDHLRS 544

Query:   534 IDFSNNLL---VPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVI 590
             +D   N L   +PKSL NC +L+FL++ DN I D FP WL  LP+L++ +L+SN FHG I
Sbjct:   545 LDVGRNRLSGELPKSLINCTRLEFLNVEDNIINDKFPFWLRMLPKLQIFVLRSNEFHGPI 604

Query:   591 EEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPA 650
                     F KLRI D+S NRF G L S  F  W+AM   +A ++  +      P  Y  
Sbjct:   605 SSLGDSLSFPKLRIFDISENRFNGVLRSDFFAGWSAMS--SAVDIVDIM-----PSRYAG 657

Query:   651 YTHYGFSDYSLTLSNKGTEMEYEKLSNLITATI-LSNNSFVGEIPTSISNLKGLRTLNLS 709
                  + + S+T++ KG+ +E       I  TI +S N F G IP SI  LK L  LN+S
Sbjct:   658 RDSGNYYN-SVTMTVKGSIIELVGSVFTIYKTIDVSGNRFEGRIPESIGLLKELIVLNMS 716

Query:   710 NN 711
             NN
Sbjct:   717 NN 718
GO:0005886 "plasma membrane" evidence=ISM
GO:0016301 "kinase activity" evidence=ISS
GO:0007165 "signal transduction" evidence=IC
GO:0000303 "response to superoxide" evidence=RCA
GO:0008219 "cell death" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
TAIR|locus:2046357 RLP23 "receptor like protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205005 RLP7 "AT1G47890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087253 RLP39 "AT3G24900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078102 RLP33 "receptor like protein 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825762 RLP6 "AT1G45616" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086979 RLP42 "receptor like protein 42" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086974 RLP41 "AT3G25010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046515 RLP24 "receptor like protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030831001
SubName- Full=Chromosome undetermined scaffold_52, whole genome shotgun sequence; (799 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query778
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-36
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-29
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-23
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  221 bits (564), Expect = 9e-61
 Identities = 199/625 (31%), Positives = 305/625 (48%), Gaps = 72/625 (11%)

Query: 4   HDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVE 63
           H  E   LL+FK S+         P  Y  +++W     ++D CLW G+ CN ++  VV 
Sbjct: 27  HAEELELLLSFKSSI-------NDPLKY--LSNWN---SSADVCLWQGITCN-NSSRVVS 73

Query: 64  LDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFS-RLTHLNLSRSYF 122
           +DL+   + G +  +S++F+L ++Q ++L +N  +   IP +I   S  L +LNLS + F
Sbjct: 74  IDLSGKNISGKI--SSAIFRLPYIQTINLSNNQLSG-PIPDDIFTTSSSLRYLNLSNNNF 130

Query: 123 SGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTV 182
           +G IP     + NLE LDLS N             + N   + ++LK LDL    +   +
Sbjct: 131 TGSIPRG--SIPNLETLDLSNNMLSG--------EIPNDIGSFSSLKVLDLGGNVLVGKI 180

Query: 183 PHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLP-QFQKSSPLE 241
           P++L NL+SL FL+L+  +L G+ P+E+ Q+ +L+++ +  N NL+G +P +    + L 
Sbjct: 181 PNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN-NLSGEIPYEIGGLTSLN 239

Query: 242 DLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSG 301
            L L Y   +G IPSSLGNL  L+ L+L   N  S  +PPSI +L  L +L++S  + SG
Sbjct: 240 HLDLVYNNLTGPIPSSLGNLKNLQYLFLYQ-NKLSGPIPPSIFSLQKLISLDLSDNSLSG 298

Query: 302 TLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQK 361
            +   +  L  L+ L +  +NF+G +  +L+ L  L                        
Sbjct: 299 EIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRL------------------------ 334

Query: 362 FEIIGLRSCNLS-EFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNL 420
            +++ L S   S E P  L   + L  LDLS+N + G+IPE L S+G  +L  L L  N 
Sbjct: 335 -QVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSG--NLFKLILFSNS 391

Query: 421 LMHFEHNLP--VLPWNNLGALDLRFNKLQGPLPIPISVLTSSYL--VSNNQLTGEIPPSI 476
           L   E  +P  +    +L  + L+ N   G LP   + L   Y   +SNN L G I    
Sbjct: 392 L---EGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRK 448

Query: 477 CSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDF 536
             +  L  L L+ N   G LP   G  S +L  L L  N+F G +P      + L  +  
Sbjct: 449 WDMPSLQMLSLARNKFFGGLPDSFG--SKRLENLDLSRNQFSGAVPRKLGSLSELMQLKL 506

Query: 537 SNNLL---VPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEP 593
           S N L   +P  L++C KL  LDL  NQ++   P+    +P L  L L  N   G I  P
Sbjct: 507 SENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI--P 564

Query: 594 NACFEFVKLRIIDLSHNRFAGNLPS 618
                   L  +++SHN   G+LPS
Sbjct: 565 KNLGNVESLVQVNISHNHLHGSLPS 589

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 778
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
PLN032101153 Resistant to P. syringae 6; Provisional 99.88
KOG4237498 consensus Extracellular matrix protein slit, conta 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.78
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.67
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.55
PLN03150623 hypothetical protein; Provisional 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.32
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.18
PLN03150623 hypothetical protein; Provisional 99.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.15
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.05
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.03
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.03
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.02
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.95
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.87
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.79
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.78
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.7
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.69
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.65
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.63
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.42
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.41
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.39
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.29
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.09
KOG4341483 consensus F-box protein containing LRR [General fu 98.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.83
PRK15386426 type III secretion protein GogB; Provisional 97.77
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.62
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.57
PRK15386426 type III secretion protein GogB; Provisional 97.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.52
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.92
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.91
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.9
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.62
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.49
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.45
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.96
KOG4308478 consensus LRR-containing protein [Function unknown 95.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
KOG4308478 consensus LRR-containing protein [Function unknown 94.61
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.48
smart0037026 LRR Leucine-rich repeats, outliers. 92.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.68
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.25
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.96
smart0037026 LRR Leucine-rich repeats, outliers. 90.49
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.49
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.11
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.91
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.67
KOG0473326 consensus Leucine-rich repeat protein [Function un 83.31
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 80.09
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.4e-64  Score=610.82  Aligned_cols=559  Identities=35%  Similarity=0.554  Sum_probs=397.8

Q ss_pred             cHHhHHHHHHHHhcCccCCCCCCCCCCCCCCCCCCCCCCCCCCCccCceeeCCCCCcEEEEEcCCCCCccccCCcccccc
Q 047451            4 HDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGSVNSTSSLFQ   83 (778)
Q Consensus         4 ~~~~~~~l~~~k~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~~v~c~~~~~~v~~L~Ls~~~l~~~~~~~~~l~~   83 (778)
                      +++|++||++||+++.++.+         .+.+|+.   ..+||.|.||.|++ .++|+.|+|+++.+.|..+.  .+..
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~---------~~~~w~~---~~~~c~w~gv~c~~-~~~v~~L~L~~~~i~~~~~~--~~~~   91 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLK---------YLSNWNS---SADVCLWQGITCNN-SSRVVSIDLSGKNISGKISS--AIFR   91 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcc---------cCCCCCC---CCCCCcCcceecCC-CCcEEEEEecCCCccccCCh--HHhC
Confidence            56899999999999965432         6789976   67899999999986 47999999999999988876  8999


Q ss_pred             CCCCCEEeCCCCCCCCCCCchhhc-CCCCCCEEECCCCCCCccCchhhhCCCCCCEEECcCCCCCcccccccCCchhHHh
Q 047451           84 LVHLQRLSLFDNNFNFSEIPSEIL-NFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLA  162 (778)
Q Consensus        84 l~~L~~L~Ls~n~l~~~~~~~~~~-~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~i~~~~~~~~~~~l~~~~  162 (778)
                      +++|++|+|++|.+.+. +|..+. .+++|++|+|++|.+++.+|.  +.+++|++|++++|.++        +.+|..+
T Consensus        92 l~~L~~L~Ls~n~~~~~-ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n~~~--------~~~p~~~  160 (968)
T PLN00113         92 LPYIQTINLSNNQLSGP-IPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNNMLS--------GEIPNDI  160 (968)
T ss_pred             CCCCCEEECCCCccCCc-CChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCCccc--------ccCChHH
Confidence            99999999999998765 776654 899999999999999888775  56889999999999653        3567778


Q ss_pred             hcCCCCCEEEccCccCCCCcchhhcCCCCCCEEEcccCcCCCCCChhhcCCCCCCEEecccCCCCcccCC-CCCCCCCCC
Q 047451          163 ENLTNLKALDLINVHISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLP-QFQKSSPLE  241 (778)
Q Consensus       163 ~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~-~~~~l~~L~  241 (778)
                      +++++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+.++++|++|++++| .+.+..+ .+.++++|+
T Consensus       161 ~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n-~l~~~~p~~l~~l~~L~  239 (968)
T PLN00113        161 GSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYN-NLSGEIPYEIGGLTSLN  239 (968)
T ss_pred             hcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCC-ccCCcCChhHhcCCCCC
Confidence            88999999999999888888888889999999999999888888888888888888888887 5554444 667777777


Q ss_pred             EEeccCCcCCccCcccccCCCCCCeEeccCCCCCcccCCccccCCCCCCeecccccccCCchhhhccCCCCCCccccccc
Q 047451          242 DLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDS  321 (778)
Q Consensus       242 ~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n  321 (778)
                      +|++++|.+++.+|..+.++++|++|++++ |.+.+..|..+..+++|+.|++++|.+.+.+|..+.++++|+.|++++|
T Consensus       240 ~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n  318 (968)
T PLN00113        240 HLDLVYNNLTGPIPSSLGNLKNLQYLFLYQ-NKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN  318 (968)
T ss_pred             EEECcCceeccccChhHhCCCCCCEEECcC-CeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCC
Confidence            777777777777777777777777777776 6666666666666777777777777766666666666666666666666


Q ss_pred             ccCCCCCcchhhhcCCCCCcEEecCCCCCCcCCCCCCCcccceeeccccCCCCCCchhcccccccEEeccCCcCCCCCch
Q 047451          322 NFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPE  401 (778)
Q Consensus       322 ~l~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~~~~~~~L~~L~L~~n~l~~lp~~l~~l~~L~~L~Ls~n~l~~~~~~  401 (778)
                      .+.+..|.   .+..+++|+.|++++|.+.+                     .+|..+..+++|+.|++++|++.+.+|.
T Consensus       319 ~~~~~~~~---~~~~l~~L~~L~L~~n~l~~---------------------~~p~~l~~~~~L~~L~Ls~n~l~~~~p~  374 (968)
T PLN00113        319 NFTGKIPV---ALTSLPRLQVLQLWSNKFSG---------------------EIPKNLGKHNNLTVLDLSTNNLTGEIPE  374 (968)
T ss_pred             ccCCcCCh---hHhcCCCCCEEECcCCCCcC---------------------cCChHHhCCCCCcEEECCCCeeEeeCCh
Confidence            66655554   44444555555544444332                     2333455555566666666655555554


Q ss_pred             hHHhcCCCCccEEeccCCccccccCCCCCCCCCCCCEEEcCCCcCcCCCCchhhcccceeEecCCccccCCchhhhcCCc
Q 047451          402 WLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNG  481 (778)
Q Consensus       402 ~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~l~~L~l~~n~l~~~~~~~~~~l~~  481 (778)
                      .+.  .+                         ++|+.|++++|++.                      +.+|..+..+++
T Consensus       375 ~~~--~~-------------------------~~L~~L~l~~n~l~----------------------~~~p~~~~~~~~  405 (968)
T PLN00113        375 GLC--SS-------------------------GNLFKLILFSNSLE----------------------GEIPKSLGACRS  405 (968)
T ss_pred             hHh--Cc-------------------------CCCCEEECcCCEec----------------------ccCCHHHhCCCC
Confidence            443  22                         33444444444433                      344555555666


Q ss_pred             ccccccccccccccCChhhccccccccEEECCCCcccccCcccccCCCCccEEECCCCcc---ChhhhhCCCCCCEEeCC
Q 047451          482 LYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLL---VPKSLANCVKLKFLDLG  558 (778)
Q Consensus       482 L~~L~Ls~N~l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l---~~~~l~~l~~L~~L~Ls  558 (778)
                      |+.|++++|++++.+|..+..++ +|+.|++++|.+++.++..+..+++|+.|++++|++   .|..+ ..++|+.|+++
T Consensus       406 L~~L~L~~n~l~~~~p~~~~~l~-~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls  483 (968)
T PLN00113        406 LRRVRLQDNSFSGELPSEFTKLP-LVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLS  483 (968)
T ss_pred             CCEEECcCCEeeeECChhHhcCC-CCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECc
Confidence            66666666666655665555555 466666666666666555555666666666666665   33333 34677777777


Q ss_pred             CCcCCCCCcccccCCCCCCEEEccCccccccCCCCccccccCcCcEEEcCCCcCCCCCChHHHhccccccccccCCcccc
Q 047451          559 DNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYL  638 (778)
Q Consensus       559 ~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~~~l~~L~~L~ls~N~l~~~ip~~~~~~~~~l~~l~~~~~~~l  638 (778)
                      +|++++..|..+.++++|+.|++++|++.+.+|..+  ..+++|++|++++|.++|.+|.. |..               
T Consensus       484 ~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~--~~l~~L~~L~Ls~N~l~~~~p~~-~~~---------------  545 (968)
T PLN00113        484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL--SSCKKLVSLDLSHNQLSGQIPAS-FSE---------------  545 (968)
T ss_pred             CCccCCccChhhhhhhccCEEECcCCcceeeCChHH--cCccCCCEEECCCCcccccCChh-HhC---------------
Confidence            777777777777777777777777777777766655  56777777777777777777743 221               


Q ss_pred             cccCCCCCCCCCccccccccceeeeecCCchhhHhhhcccccEEEccCCcccccCchhccCCCCCCeecCCCCccccccc
Q 047451          639 QDSLLGPVSYPAYTHYGFSDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLS  718 (778)
Q Consensus       639 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~ls~n~l~~~~p~~~~~l~~l~~l~ls~n~l~~~~p  718 (778)
                                                           ++.|+.||+++|+++|.+|..++.++.|+.+++++|++.|.+|
T Consensus       546 -------------------------------------l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        546 -------------------------------------MPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             -------------------------------------cccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCC
Confidence                                                 2356677777777777777777777777777777777777777


Q ss_pred             hh
Q 047451          719 PF  720 (778)
Q Consensus       719 ~~  720 (778)
                      ..
T Consensus       589 ~~  590 (968)
T PLN00113        589 ST  590 (968)
T ss_pred             Cc
Confidence            53

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query778
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-29
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-29
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 8e-08
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-07
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure 
Iteration: 1

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 174/640 (27%), Positives = 269/640 (42%), Gaps = 137/640 (21%)
Query: 166 TNLKALDLINVHISSTVPH--TLANLSSLHFLSLSGCRLQGEFPQEI---FQLPNLQFLG 220
            +L +LDL    +S  V    +L + S L FL++S   L  +FP ++    +L +L+ L 
Sbjct: 97  ASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTL--DFPGKVSGGLKLNSLEVLD 154
Query: 221 VMKN----PNLTGYLPQFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFS 276
           +  N     N+ G++        L+ L +S  + SG +  S      LE L +S  N FS
Sbjct: 155 LSANSISGANVVGWVLS-DGCGELKHLAISGNKISGDVDVS--RCVNLEFLDVSSNN-FS 210
Query: 277 NELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQLDSLTISDSNFSGPMSSSLSWLTN 336
             +P  +G+ ++L+ L+IS    SG    ++   T+L  L IS + F GP+         
Sbjct: 211 TGIP-FLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPI--------- 260
Query: 337 LNQLTSLNFPNCNLNEPLLVPNTQKFEIIGLRSCNLSEFPSFLHNQ-DQLISLDLSSNMI 395
                           PL + + Q   +   +     E P FL    D L  LDLS N  
Sbjct: 261 ---------------PPLPLKSLQYLSLAENKFT--GEIPDFLSGACDTLTGLDLSGNHF 303
Query: 396 AGKIPEWLFSAGTXXXXXXXXXXXXXMHFEHNLPV---LPWNNLGALDLRFNKLQGPLPI 452
            G +P +  S                 +F   LP+   L    L  LDL FN+  G LP 
Sbjct: 304 YGAVPPFFGSCSLLESLALSSN-----NFSGELPMDTLLKMRGLKVLDLSFNEFSGELPE 358
Query: 453 PISVLTSSYL-----------------------------VSNNQLTGEIPPSICSLNGLY 483
            ++ L++S L                             + NN  TG+IPP++ + + L 
Sbjct: 359 SLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELV 418
Query: 484 ALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPE--TFNKGTNLRMIDFSNNLL 541
           +L LS+N LSG +P+ LG+ S +L  LKL  N   G IP+   + K     ++DF N+L 
Sbjct: 419 SLHLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDF-NDLT 476
Query: 542 --VPKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEF 599
             +P  L+NC  L ++ L +N++T   P W+G L  L +L L +N+F G I  P    + 
Sbjct: 477 GEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAELGDC 534
Query: 600 VKLRIIDLSHNRFAGNLPSKHF--------------------------ECWNA-----MK 628
             L  +DL+ N F G +P+  F                          EC  A      +
Sbjct: 535 RSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQ 594
Query: 629 DVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLTLSNKGT----EMEYEKLSNLITATI- 683
            + +  L  L  S   P +  +  + G +  S T  N G+    +M Y  LS  I   I 
Sbjct: 595 GIRSEQLNRL--STRNPCNITSRVYGGHT--SPTFDNNGSMMFLDMSYNMLSGYIPKEIG 650
Query: 684 ---------LSNNSFVGEIPTSISNLKGLRTLNLSNNNLQ 714
                    L +N   G IP  + +L+GL  L+LS+N L 
Sbjct: 651 SMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD 690
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query778
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-123
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-94
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-68
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-73
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-70
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-65
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-65
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-61
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-53
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-20
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-62
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-53
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-38
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-43
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-40
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-30
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-45
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-46
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-41
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-35
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-40
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-34
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-37
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-22
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-17
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-16
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-24
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-15
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-29
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-18
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-12
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-25
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-21
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-10
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-25
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 8e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-13
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-23
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-18
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-15
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-21
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-11
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-19
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-18
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-10
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-16
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-16
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 9e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-15
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-14
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-11
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-10
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 1e-05
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  387 bits (996), Expect = e-123
 Identities = 180/771 (23%), Positives = 280/771 (36%), Gaps = 191/771 (24%)

Query: 1   PLCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGH 60
                 E   L++FK+ L                  W     N + C +DGV C      
Sbjct: 7   SQSLYREIHQLISFKDVLPDKNLLP----------DWS---SNKNPCTFDGVTC--RDDK 51

Query: 61  VVE--------------------------------------------------LDLASSC 70
           V                                                    LDL+ + 
Sbjct: 52  VTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNS 111

Query: 71  LYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAEL 130
           L G V + +SL     L+ L++  N  +F    S  L  + L  L+LS +  SG      
Sbjct: 112 LSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGW 171

Query: 131 LE---LSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVHISSTVPHTLA 187
           +       L+ L +S N                      NL+ LD+ + + S+ +P  L 
Sbjct: 172 VLSDGCGELKHLAISGNKISGDV-----D-----VSRCVNLEFLDVSSNNFSTGIP-FLG 220

Query: 188 NLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKSSPLEDLRLSY 247
           + S+L  L +SG +L G+F + I     L+ L +  N    G +P     S L+ L L+ 
Sbjct: 221 DCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSN-QFVGPIPPLPLKS-LQYLSLAE 278

Query: 248 TRFSGKIPSSL-GNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTL-QA 305
            +F+G+IP  L G    L  L LS GN F   +PP  G+ + L++L +SS NFSG L   
Sbjct: 279 NKFTGEIPDFLSGACDTLTGLDLS-GNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD 337

Query: 306 SLGNLTQLDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLLVPNTQKFEII 365
           +L  +  L  L +S + FSG +  SL+ L+                              
Sbjct: 338 TLLKMRGLKVLDLSFNEFSGELPESLTNLSA----------------------------- 368

Query: 366 GLRSCNLSEFPSFLHNQDQLISLDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFE 425
                              L++LDLSSN  +G I   L     N+LQ L L         
Sbjct: 369 ------------------SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYL--------- 401

Query: 426 HNLPVLPWNNLGALDLRFNKLQGPLPIPISVLTSSYLVSNNQLTGEIPPSICSLNGLYAL 485
                                                  NN  TG+IPP++ + + L +L
Sbjct: 402 --------------------------------------QNNGFTGKIPPTLSNCSELVSL 423

Query: 486 DLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLL---V 542
            LS+N LSG +P+ LG+ S +L  LKL  N   G IP+       L  +    N L   +
Sbjct: 424 HLSFNYLSGTIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI 482

Query: 543 PKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEVLILKSNNFHGVIEEPNACFEFVKL 602
           P  L+NC  L ++ L +N++T   P W+G L  L +L L +N+F G I  P    +   L
Sbjct: 483 PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI--PAELGDCRSL 540

Query: 603 RIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGFSDYSLT 662
             +DL+ N F G +P+  F+    +     N +   +   +         H   +     
Sbjct: 541 IWLDLNTNLFNGTIPAAMFKQSGKIAA---NFIAGKRYVYIKNDGMKKECHGAGNLLEFQ 597

Query: 663 LSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNL 713
               G   E     +      +++  + G    +  N   +  L++S N L
Sbjct: 598 ----GIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNML 644
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query778
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.74
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.74
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.67
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.53
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.5
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.49
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.48
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.41
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.29
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.21
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.03
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.9
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.45
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.98
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.83
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.41
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.38
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.62
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=4.2e-77  Score=704.55  Aligned_cols=649  Identities=28%  Similarity=0.379  Sum_probs=569.8

Q ss_pred             CcHHhHHHHHHHHhcCccCCCCCCCCCCCCCCCCCCCCCCCCCCCccCceeeCCCCCcEEEEEcCCCCCccc---cCCcc
Q 047451            3 CHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCLWDGVKCNEDTGHVVELDLASSCLYGS---VNSTS   79 (778)
Q Consensus         3 c~~~~~~~l~~~k~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~c~w~~v~c~~~~~~v~~L~Ls~~~l~~~---~~~~~   79 (778)
                      +.++||+||++||+++.++.          ++++|..   +.|||.|+||.|+  +++|++|+|+++.+.|.   +++  
T Consensus         9 ~~~~~~~all~~k~~~~~~~----------~l~~W~~---~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~--   71 (768)
T 3rgz_A            9 SLYREIHQLISFKDVLPDKN----------LLPDWSS---NKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSS--   71 (768)
T ss_dssp             CHHHHHHHHHHHHTTCSCTT----------SSTTCCT---TSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHH--
T ss_pred             CCHHHHHHHHHHHhhCCCcc----------cccCCCC---CCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccCh--
Confidence            46789999999999997531          5899985   6799999999998  68999999999999987   765  


Q ss_pred             ccccCCCCCEEeCCCCCCCCCCCchhhcCCCCCCEEECCCCCCCccCch--hhhCCCCCCEEECcCCCCCcccccccCCc
Q 047451           80 SLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPA--ELLELSNLEVLDLSFNTFDNFFLKLQKPG  157 (778)
Q Consensus        80 ~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~--~l~~l~~L~~L~Ls~n~i~~~~~~~~~~~  157 (778)
                      .+.++++|+.++++.+.+.  .+|+.++.+++|++|+|++|.+.+.+|.  .++++++|++|++++|.++        ..
T Consensus        72 ~l~~L~~L~~l~~~~~~~~--~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~--------~~  141 (768)
T 3rgz_A           72 SLLSLTGLESLFLSNSHIN--GSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLD--------FP  141 (768)
T ss_dssp             HTTTCTTCCEEECTTSCEE--ECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEE--------CC
T ss_pred             hHhccCcccccCCcCCCcC--CCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccC--------Cc
Confidence            8999999999999999763  2568899999999999999999998888  8999999999999999653        22


Q ss_pred             hhHH-hhcCCCCCEEEccCccCCCCcchh---hcCCCCCCEEEcccCcCCCCCChhhcCCCCCCEEecccCCCCcccCCC
Q 047451          158 LANL-AENLTNLKALDLINVHISSTVPHT---LANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQ  233 (778)
Q Consensus       158 l~~~-~~~l~~L~~L~L~~n~l~~~~~~~---~~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~  233 (778)
                      .+.. +.++++|++|++++|++++..+..   +.++++|++|++++|.+++..+.  ..+++|++|++++| .+.+..+.
T Consensus       142 ~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n-~l~~~~~~  218 (768)
T 3rgz_A          142 GKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSN-NFSTGIPF  218 (768)
T ss_dssp             SSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSS-CCCSCCCB
T ss_pred             CCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCC-cCCCCCcc
Confidence            3333 378999999999999999988877   88999999999999999876553  88999999999999 77777777


Q ss_pred             CCCCCCCCEEeccCCcCCccCcccccCCCCCCeEeccCCCCCcccCCccccCCCCCCeecccccccCCchhhhccCC-CC
Q 047451          234 FQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNL-TQ  312 (778)
Q Consensus       234 ~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l-~~  312 (778)
                      +..+++|++|++++|.+++.+|..+..+++|++|++++ |.+.+..|..  .+++|++|++++|.+++.+|..+... ++
T Consensus       219 l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~-n~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~~~~~  295 (768)
T 3rgz_A          219 LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISS-NQFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDT  295 (768)
T ss_dssp             CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEEECCS-SCCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCTTCTT
T ss_pred             cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEEECCC-CcccCccCcc--ccCCCCEEECcCCccCCccCHHHHhhcCc
Confidence            99999999999999999999999999999999999998 8888877765  88999999999999998888888775 99


Q ss_pred             CCcccccccccCCCCCcchhhhcCCCCCcEEecCCCCCCcCCC---CCCCcccceeeccccCCC-CCCchhcccc-cccE
Q 047451          313 LDSLTISDSNFSGPMSSSLSWLTNLNQLTSLNFPNCNLNEPLL---VPNTQKFEIIGLRSCNLS-EFPSFLHNQD-QLIS  387 (778)
Q Consensus       313 L~~L~L~~n~l~~~~~~~~~~l~~l~~L~~L~l~~n~l~~~~~---~~~~~~L~~L~L~~n~l~-~lp~~l~~l~-~L~~  387 (778)
                      |++|++++|.+.+..|.   .+..+++|++|++++|.+.+.++   +..+++|++|++++|.+. .+|..+..++ +|++
T Consensus       296 L~~L~Ls~n~l~~~~p~---~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~  372 (768)
T 3rgz_A          296 LTGLDLSGNHFYGAVPP---FFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT  372 (768)
T ss_dssp             CSEEECCSSEEEECCCG---GGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSE
T ss_pred             CCEEECcCCcCCCccch---HHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcE
Confidence            99999999999998888   78899999999999999986555   457899999999999998 8898888887 9999


Q ss_pred             EeccCCcCCCCCchhHHhcCCCCccEEeccCCccccccCCCCCCCCCCCCEEEcCCCcCcCCCCchh--hcccceeEecC
Q 047451          388 LDLSSNMIAGKIPEWLFSAGTNSLQYLNLSYNLLMHFEHNLPVLPWNNLGALDLRFNKLQGPLPIPI--SVLTSSYLVSN  465 (778)
Q Consensus       388 L~Ls~n~l~~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~~~~~L~~L~L~~n~l~~~~~~~~--~~~l~~L~l~~  465 (778)
                      |++++|.+++.+|..+....+++|++|++++|.+++..+. .+..+++|+.|++++|++++..|..+  .++|++|++++
T Consensus       373 L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~-~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~  451 (768)
T 3rgz_A          373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPP-TLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWL  451 (768)
T ss_dssp             EECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCG-GGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCS
T ss_pred             EEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCH-HHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCC
Confidence            9999999998888877633478999999999999876554 46678999999999999999998877  78999999999


Q ss_pred             CccccCCchhhhcCCcccccccccccccccCChhhccccccccEEECCCCcccccCcccccCCCCccEEECCCCcc---C
Q 047451          466 NQLTGEIPPSICSLNGLYALDLSYNNLSGMLPACLGNFSVQLWVLKLQGNKFHGFIPETFNKGTNLRMIDFSNNLL---V  542 (778)
Q Consensus       466 n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l---~  542 (778)
                      |.+++.+|..+..+++|++|++++|++++.+|..+..++ +|++|++++|++++.+|..+..+++|++|++++|++   +
T Consensus       452 n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~-~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~  530 (768)
T 3rgz_A          452 NMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCT-NLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNI  530 (768)
T ss_dssp             SCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCT-TCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEEC
T ss_pred             CcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCC-CCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcC
Confidence            999999999999999999999999999999999999998 799999999999999999999999999999999999   8


Q ss_pred             hhhhhCCCCCCEEeCCCCcCCCCCcccccCCCCCCE--------------------------------------------
Q 047451          543 PKSLANCVKLKFLDLGDNQITDFFPSWLGTLPELEV--------------------------------------------  578 (778)
Q Consensus       543 ~~~l~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~--------------------------------------------  578 (778)
                      |..+..+++|++|++++|++++.+|..+.....+..                                            
T Consensus       531 p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  610 (768)
T 3rgz_A          531 PAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTR  610 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGT
T ss_pred             CHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccc
Confidence            999999999999999999999888887765444333                                            


Q ss_pred             --EEccCccccccCCCCccccccCcCcEEEcCCCcCCCCCChHHHhccccccccccCCcccccccCCCCCCCCCcccccc
Q 047451          579 --LILKSNNFHGVIEEPNACFEFVKLRIIDLSHNRFAGNLPSKHFECWNAMKDVNANNLTYLQDSLLGPVSYPAYTHYGF  656 (778)
Q Consensus       579 --L~Ls~N~l~~~~~~~~~~~~l~~L~~L~ls~N~l~~~ip~~~~~~~~~l~~l~~~~~~~l~~~~~~~~~~~~~~~~~~  656 (778)
                        ++++.|.+.|.+|..+  ..+++|+.||+++|+++|.+|.. +++++.|+.|+++++..-..                
T Consensus       611 ~~~~l~~~~~~g~~~~~~--~~l~~L~~LdLs~N~l~g~ip~~-l~~l~~L~~L~Ls~N~l~g~----------------  671 (768)
T 3rgz_A          611 NPCNITSRVYGGHTSPTF--DNNGSMMFLDMSYNMLSGYIPKE-IGSMPYLFILNLGHNDISGS----------------  671 (768)
T ss_dssp             CCSCTTSCEEEEECCCSC--SSSBCCCEEECCSSCCBSCCCGG-GGGCTTCCEEECCSSCCCSC----------------
T ss_pred             cccccccceecccCchhh--hccccccEEECcCCcccccCCHH-HhccccCCEEeCcCCccCCC----------------
Confidence              3445577777777766  78899999999999999999966 88899999988876533221                


Q ss_pred             ccceeeeecCCchhhHhhhcccccEEEccCCcccccCchhccCCCCCCeecCCCCccccccchh
Q 047451          657 SDYSLTLSNKGTEMEYEKLSNLITATILSNNSFVGEIPTSISNLKGLRTLNLSNNNLQVFLSPF  720 (778)
Q Consensus       657 ~~~~~~~~~~~~~~~~~~~~~~l~~l~ls~n~l~~~~p~~~~~l~~l~~l~ls~n~l~~~~p~~  720 (778)
                                 .+..+ .-++.|+.||||+|+++|.+|..++.++.|++||+|+|+|+|.||..
T Consensus       672 -----------ip~~l-~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          672 -----------IPDEV-GDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             -----------CCGGG-GGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS
T ss_pred             -----------CChHH-hCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc
Confidence                       01111 22578999999999999999999999999999999999999999974
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 778
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-13
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 9e-09
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 7e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 9e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 85.2 bits (209), Expect = 1e-18
 Identities = 70/326 (21%), Positives = 110/326 (33%), Gaps = 28/326 (8%)

Query: 2   LCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCC--LWDGVKCNEDTG 59
           LC+  ++ ALL  K+ L       G P+    ++SW      +DCC   W GV C+ DT 
Sbjct: 2   LCNPQDKQALLQIKKDL-------GNPTT---LSSWL---PTTDCCNRTWLGVLCDTDTQ 48

Query: 60  --HVVELDLASSCLYGSVNSTSSLFQLVHLQRLSLFDNNFNFSEIPSEILNFSRLTHLNL 117
              V  LDL+   L       SSL  L +L  L +   N     IP  I   ++L +L +
Sbjct: 49  TYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYI 108

Query: 118 SRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQKPGLANLAENLTNLKALDLINVH 177
           + +  SG IP  L ++  L  LD S+N                +             N  
Sbjct: 109 THTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDG-------NRI 161

Query: 178 ISSTVPHTLANLSSLHFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLPQFQKS 237
             +      +       +++S  RL G+ P     L                 +      
Sbjct: 162 SGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDK 221

Query: 238 SPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSF 297
           +  +      +         L       DL     N     LP  +  L  L +L +S  
Sbjct: 222 NTQKIHLAKNSLAFDLGKVGLSKNLNGLDLR---NNRIYGTLPQGLTQLKFLHSLNVSFN 278

Query: 298 NFSGTLQASLGNLTQLDSLTISDSNF 323
           N  G +    GNL + D    +++  
Sbjct: 279 NLCGEI-PQGGNLQRFDVSAYANNKC 303
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query778
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.76
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.73
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.69
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.57
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.39
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.41
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=100.00  E-value=1.3e-36  Score=317.39  Aligned_cols=293  Identities=29%  Similarity=0.447  Sum_probs=246.8

Q ss_pred             CCcHHhHHHHHHHHhcCccCCCCCCCCCCCCCCCCCCCCCCCCCCCc--cCceeeCCC--CCcEEEEEcCCCCCccc--c
Q 047451            2 LCHDHERSALLNFKESLVINRTASGYPSAYPKVASWKLDEKNSDCCL--WDGVKCNED--TGHVVELDLASSCLYGS--V   75 (778)
Q Consensus         2 ~c~~~~~~~l~~~k~~~~~~~~~~~~~~~~~~~~~W~~~~~~~~~c~--w~~v~c~~~--~~~v~~L~Ls~~~l~~~--~   75 (778)
                      -|+++||+||++||+++.++.          .+++|..   +.|||.  |.||.|+..  .+||+.|+|+++.+.|.  +
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~----------~l~sW~~---~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~l   68 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPT----------TLSSWLP---TTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPI   68 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG----------GGTTCCT---TSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEEC
T ss_pred             CCCHHHHHHHHHHHHHCCCCC----------cCCCCCC---CCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCC
Confidence            599999999999999998752          6899986   689995  999999864  35899999999999875  4


Q ss_pred             CCccccccCCCCCEEeCCC-CCCCCCCCchhhcCCCCCCEEECCCCCCCccCchhhhCCCCCCEEECcCCCCCccccccc
Q 047451           76 NSTSSLFQLVHLQRLSLFD-NNFNFSEIPSEILNFSRLTHLNLSRSYFSGQIPAELLELSNLEVLDLSFNTFDNFFLKLQ  154 (778)
Q Consensus        76 ~~~~~l~~l~~L~~L~Ls~-n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~n~i~~~~~~~~  154 (778)
                      +.  .+.++++|++|+|++ |.+.+. +|..|+++++|++|+|++|++.+..+..+..+.+|+++++++|.+     .  
T Consensus        69 p~--~l~~L~~L~~L~Ls~~N~l~g~-iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~-----~--  138 (313)
T d1ogqa_          69 PS--SLANLPYLNFLYIGGINNLVGP-IPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNAL-----S--  138 (313)
T ss_dssp             CG--GGGGCTTCSEEEEEEETTEESC-CCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEE-----E--
T ss_pred             Ch--HHhcCccccccccccccccccc-cccccccccccchhhhccccccccccccccchhhhcccccccccc-----c--
Confidence            55  899999999999987 677665 899999999999999999999988888899999999999999954     2  


Q ss_pred             CCchhHHhhcCCCCCEEEccCccCCCCcchhhcCCCCC-CEEEcccCcCCCCCChhhcCCCCCCEEecccCCCCcccCC-
Q 047451          155 KPGLANLAENLTNLKALDLINVHISSTVPHTLANLSSL-HFLSLSGCRLQGEFPQEIFQLPNLQFLGVMKNPNLTGYLP-  232 (778)
Q Consensus       155 ~~~l~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L-~~L~Ls~n~l~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~-  232 (778)
                       ..+|..+.++++|+++++++|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ .+++.++ ...+..+ 
T Consensus       139 -~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~-~~~~~~~~  215 (313)
T d1ogqa_         139 -GTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRN-MLEGDASV  215 (313)
T ss_dssp             -SCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSS-EEEECCGG
T ss_pred             -ccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccc-ccccccc-cccccccc
Confidence             4577888999999999999999998889888888776 889999999998888888777554 6888877 5566555 


Q ss_pred             CCCCCCCCCEEeccCCcCCccCcccccCCCCCCeEeccCCCCCcccCCccccCCCCCCeecccccccCCchhhhccCCCC
Q 047451          233 QFQKSSPLEDLRLSYTRFSGKIPSSLGNLTKLEDLYLSGGNGFSNELPPSIGNLASLKTLEISSFNFSGTLQASLGNLTQ  312 (778)
Q Consensus       233 ~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~~~~l~~l~~  312 (778)
                      .+..+++++.++++++.+.+.++ .+..+++|+.|++++ |++++.+|.+++++++|++|+|++|+++|.+|. ++++++
T Consensus       216 ~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~-N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~  292 (313)
T d1ogqa_         216 LFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRN-NRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQR  292 (313)
T ss_dssp             GCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCS-SCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGG
T ss_pred             ccccccccccccccccccccccc-ccccccccccccCcc-CeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCC
Confidence            66778888889988888876554 577788888888887 888888888888888888888888888887774 677888


Q ss_pred             CCccccccccc
Q 047451          313 LDSLTISDSNF  323 (778)
Q Consensus       313 L~~L~L~~n~l  323 (778)
                      |+.+++++|+.
T Consensus       293 L~~l~l~~N~~  303 (313)
T d1ogqa_         293 FDVSAYANNKC  303 (313)
T ss_dssp             SCGGGTCSSSE
T ss_pred             CCHHHhCCCcc
Confidence            88888888863
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure