Citrus Sinensis ID: 047464

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MLTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
cccccccccccccHHHHHHcccEEEEcccccHHHHHHHHHcccccccccccccccccccccHHHHHccccEEEEEEEcccccccHHHHHHHHcc
cccEcccccccccHHHHHHcccEEccccccHHHHHHHHHHcccHHHcEEEccccccccHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHc
mltvsrlqpstvdiKTLQRRnaavgcngNSFIIRYLINVlnfkpgsnkkinakngynsitsypmafesgDIAAAFLvfprgsplaldISEAILK
mltvsrlqpstvdiktlqrrnaavgcngNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
MLTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
*************IKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDI******
MLTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
*********STVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
*LTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFLVFPRGSPLALDISEAILK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q9C5V5 947 Glutamate receptor 2.8 OS yes no 0.978 0.097 0.304 0.0002
>sp|Q9C5V5|GLR28_ARATH Glutamate receptor 2.8 OS=Arabidopsis thaliana GN=GLR2.8 PE=2 SV=2 Back     alignment and function desciption
 Score = 44.3 bits (103), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 53/115 (46%), Gaps = 23/115 (20%)

Query: 2   LTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLI----NVLNFKP-GSNKKINAKNGY 56
           LTV R QP+ +++K L +    VG    +F+  +LI    NV   KP GS+++ +A    
Sbjct: 664 LTVQRFQPAAINVKDLIKNGDYVGYQHGAFVKDFLIKEGFNVSKLKPFGSSEECHALLSN 723

Query: 57  NSITS------------------YPMAFESGDIAAAFLVFPRGSPLALDISEAIL 93
            SI++                  Y +   +   A     FPR SPL  D+S+AIL
Sbjct: 724 GSISAAFDEVAYLRAILSQYCSKYAIVEPTFKTAGFGFAFPRNSPLTGDVSKAIL 778
Glutamate-gated receptor that probably acts as non-selective cation channel. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
224137522 765 glutamate-gated kainate-type ion channel 0.925 0.113 0.520 2e-23
356560511 814 PREDICTED: glutamate receptor 2.5-like [ 0.936 0.108 0.464 1e-20
356560515 749 PREDICTED: glutamate receptor 2.5-like [ 0.936 0.117 0.44 6e-19
224137510 779 glutamate-gated kainate-type ion channel 0.925 0.111 0.447 8e-19
356560513 786 PREDICTED: glutamate receptor 2.5-like [ 0.925 0.110 0.435 1e-18
357933559 913 glutamate receptor 1.1 [Solanum lycopers 0.925 0.095 0.451 8e-18
357489077 753 Glutamate receptor 2.7 [Medicago truncat 0.914 0.114 0.414 1e-17
357489081 923 Glutamate receptor 2.7 [Medicago truncat 0.914 0.093 0.414 3e-17
356553947 865 PREDICTED: glutamate receptor 3.2-like [ 0.936 0.101 0.362 8e-14
255563044 843 glutamate receptor 2 plant, putative [Ri 0.936 0.104 0.370 5e-13
>gi|224137522|ref|XP_002327147.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222835462|gb|EEE73897.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  112 bits (281), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 73/123 (59%), Gaps = 36/123 (29%)

Query: 2   LTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITS 61
           +TVSRL+PS +DI+TLQR NA VGCNGNSFI+RYLINVL FKP + KKI      NSI  
Sbjct: 549 MTVSRLEPSVLDIETLQRTNAPVGCNGNSFIVRYLINVLLFKPENIKKI------NSIHD 602

Query: 62  YPMAFESGDIAAAF------------------------------LVFPRGSPLALDISEA 91
           YP AFE+G + AAF                               VFP+GSPLA DISEA
Sbjct: 603 YPEAFETGYVKAAFFVEPHARVFLGKYCKGYTKAGPTLKLGGFGFVFPKGSPLAFDISEA 662

Query: 92  ILK 94
            LK
Sbjct: 663 TLK 665

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356560511|ref|XP_003548535.1| PREDICTED: glutamate receptor 2.5-like [Glycine max] Back     alignment and taxonomy information
>gi|356560515|ref|XP_003548537.1| PREDICTED: glutamate receptor 2.5-like [Glycine max] Back     alignment and taxonomy information
>gi|224137510|ref|XP_002327144.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] gi|222835459|gb|EEE73894.1| glutamate-gated kainate-type ion channel receptor subunit GluR5 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356560513|ref|XP_003548536.1| PREDICTED: glutamate receptor 2.5-like [Glycine max] Back     alignment and taxonomy information
>gi|357933559|dbj|BAL15046.1| glutamate receptor 1.1 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|357489077|ref|XP_003614826.1| Glutamate receptor 2.7 [Medicago truncatula] gi|355516161|gb|AES97784.1| Glutamate receptor 2.7 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357489081|ref|XP_003614828.1| Glutamate receptor 2.7 [Medicago truncatula] gi|355516163|gb|AES97786.1| Glutamate receptor 2.7 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356553947|ref|XP_003545312.1| PREDICTED: glutamate receptor 3.2-like [Glycine max] Back     alignment and taxonomy information
>gi|255563044|ref|XP_002522526.1| glutamate receptor 2 plant, putative [Ricinus communis] gi|223538217|gb|EEF39826.1| glutamate receptor 2 plant, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
TAIR|locus:2066086 947 GLR2.8 "glutamate receptor 2.8 0.638 0.063 0.338 3.1e-05
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 79 (32.9 bits), Expect = 3.1e-05, Sum P(2) = 3.1e-05
 Identities = 22/65 (33%), Positives = 36/65 (55%)

Query:     2 LTVSRLQPSTVDIKTLQRRNAAVGCNGNSFIIRYLI----NVLNFKP-GSNKKINAKNGY 56
             LTV R QP+ +++K L +    VG    +F+  +LI    NV   KP GS+++ +A    
Sbjct:   664 LTVQRFQPAAINVKDLIKNGDYVGYQHGAFVKDFLIKEGFNVSKLKPFGSSEECHALLSN 723

Query:    57 NSITS 61
              SI++
Sbjct:   724 GSISA 728
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=NAS
GO:0009416 "response to light stimulus" evidence=NAS
GO:0030003 "cellular cation homeostasis" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00400300
glutamate-gated kainate-type ion channel receptor subunit GluR5 (765 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.24
KOG1052656 consensus Glutamate-gated kainate-type ion channel 99.22
PRK09495247 glnH glutamine ABC transporter periplasmic protein 98.68
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 98.5
PRK11260266 cystine transporter subunit; Provisional 98.49
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 98.39
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 98.38
PRK10797302 glutamate and aspartate transporter subunit; Provi 98.36
PRK15007243 putative ABC transporter arginine-biding protein; 98.29
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 98.22
PRK15010260 ABC transporter lysine/arginine/ornithine binding 98.13
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.11
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 98.1
COG0834275 HisJ ABC-type amino acid transport/signal transduc 98.1
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 98.08
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 98.05
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 97.97
PRK15437259 histidine ABC transporter substrate-binding protei 97.95
PF09084216 NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent 97.94
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.89
cd00134218 PBPb Bacterial periplasmic transport systems use m 97.71
TIGR03427 328 ABC_peri_uca ABC transporter periplasmic binding p 97.68
PRK11480 320 tauA taurine transporter substrate binding subunit 97.63
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.6
TIGR01729 300 taurine_ABC_bnd taurine ABC transporter, periplasm 97.58
KOG1053 1258 consensus Glutamate-gated NMDA-type ion channel re 97.31
KOG4440 993 consensus NMDA selective glutamate-gated ion chann 97.29
TIGR01728 288 SsuA_fam ABC transporter, substrate-binding protei 97.21
PRK11553 314 alkanesulfonate transporter substrate-binding subu 97.19
KOG1054 897 consensus Glutamate-gated AMPA-type ion channel re 97.14
TIGR02285268 conserved hypothetical protein. Members of this fa 97.03
COG0715 335 TauA ABC-type nitrate/sulfonate/bicarbonate transp 97.01
TIGR00787257 dctP tripartite ATP-independent periplasmic transp 96.93
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 96.9
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 96.57
PRK00489 287 hisG ATP phosphoribosyltransferase; Reviewed 96.46
TIGR02122 320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 96.31
COG2358 321 Imp TRAP-type uncharacterized transport system, pe 96.02
TIGR00363258 lipoprotein, YaeC family. This family of putative 95.58
PF03480286 SBP_bac_7: Bacterial extracellular solute-binding 95.33
PRK11063271 metQ DL-methionine transporter substrate-binding s 93.86
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 93.73
PF03401274 TctC: Tripartite tricarboxylate transporter family 93.44
PF12727193 PBP_like: PBP superfamily domain; InterPro: IPR024 92.85
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 90.89
PF03846119 SulA: Cell division inhibitor SulA; InterPro: IPR0 90.65
PF14503232 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B. 90.07
COG4521 334 TauA ABC-type taurine transport system, periplasmi 86.89
PRK11899 279 prephenate dehydratase; Provisional 85.82
PRK09861272 cytoplasmic membrane lipoprotein-28; Provisional 85.78
COG1638 332 DctP TRAP-type C4-dicarboxylate transport system, 84.7
PF00800 181 PDT: Prephenate dehydratase Caution this is only a 82.75
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information 
Probab=99.24  E-value=2.1e-11  Score=80.50  Aligned_cols=76  Identities=21%  Similarity=0.302  Sum_probs=64.6

Q ss_pred             CCCChhHHHhC-CCeeeecCCccHHHHHHHhhCCCC----------CCcccccCCCCCCChhhHHHHHhcCCeeEEEE--
Q 047464           10 STVDIKTLQRR-NAAVGCNGNSFIIRYLINVLNFKP----------GSNKKINAKNGYNSITSYPMAFESGDIAAAFL--   76 (94)
Q Consensus        10 ~i~~i~dL~~~-~~~VG~~~gSf~~~~L~~~~~~~~----------~~i~~~~~~~~~~s~~~~~~aL~~g~i~A~v~--   76 (94)
                      +|++++||+.+ +++||++.||+...|+.+ .....          .+++.|+      +.++++++|.+|+ ||++.  
T Consensus         1 ~i~~~~dl~~~~~~~vgv~~gs~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~l~~g~-da~v~d~   72 (134)
T smart00079        1 PITSVEDLAKQTKIEYGTIRGSSTLAFFKR-SGNPEYSRMWNYMSASPSVFVK------SYAEGVQRVRVSN-YAFLMES   72 (134)
T ss_pred             CCCChHHHhhCCCccceEecCchHHHHHHh-CCChHHHHHHHHHHhCCCCCCC------CHHHHHHHHHcCC-CEEEeeh
Confidence            37899999943 379999999999999987 43320          2566777      9999999999999 99998  


Q ss_pred             ---------------------------eecCCCCChHHhHHHhh
Q 047464           77 ---------------------------VFPRGSPLALDISEAIL   93 (94)
Q Consensus        77 ---------------------------afpkGSpL~~dvn~aiL   93 (94)
                                                 |||||++|++.||++|.
T Consensus        73 ~~~~~~~~~~~~~~~~~~~~~~~~~~ia~~k~~~l~~~vn~~l~  116 (134)
T smart00079       73 TYLDYELSQNCDLMTVGENFGRKGYGIAFPKGSPLRDDLSRAIL  116 (134)
T ss_pred             HhHHHHHhCCCCeEEcCcccCCCceEEEecCCCHHHHHHHHHHH
Confidence                                       99999999999999986

Prokaryotic homologues are represented by a separate alignment: PBPb
>KOG1052 consensus Glutamate-gated kainate-type ion channel receptor subunit GluR5 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>KOG1053 consensus Glutamate-gated NMDA-type ion channel receptor subunit GRIN2A and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4440 consensus NMDA selective glutamate-gated ion channel receptor subunit GRIN1 [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>KOG1054 consensus Glutamate-gated AMPA-type ion channel receptor subunit GluR2 and related subunits [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00787 dctP tripartite ATP-independent periplasmic transporter solute receptor, DctP family Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>TIGR00363 lipoprotein, YaeC family Back     alignment and domain information
>PF03480 SBP_bac_7: Bacterial extracellular solute-binding protein, family 7; InterPro: IPR018389 This family of proteins are involved in binding extracellular solutes for transport across the bacterial cytoplasmic membrane Back     alignment and domain information
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>PF03401 TctC: Tripartite tricarboxylate transporter family receptor; InterPro: IPR005064 Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth [] Back     alignment and domain information
>PF12727 PBP_like: PBP superfamily domain; InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily [] Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03846 SulA: Cell division inhibitor SulA; InterPro: IPR004596 All proteins in this family for which the functions are known are cell division inhibitors Back     alignment and domain information
>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B Back     alignment and domain information
>COG4521 TauA ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional Back     alignment and domain information
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00800 PDT: Prephenate dehydratase Caution this is only a partial structure Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 2e-08
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score = 48.6 bits (115), Expect = 2e-08
 Identities = 17/130 (13%), Positives = 29/130 (22%), Gaps = 36/130 (27%)

Query: 1   MLTVSRLQPSTVDIKTLQRRNA-AVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSI 59
            LTV R+       + L ++   A G   +     +                     +  
Sbjct: 614 FLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVF 673

Query: 60  TS-----YPMAFESGDIAAAFL------------------------------VFPRGSPL 84
                       +S    A  L                                P+GS L
Sbjct: 674 VRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSL 733

Query: 85  ALDISEAILK 94
              ++ A+LK
Sbjct: 734 GTPVNLAVLK 743

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 98.96
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 98.96
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 98.94
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 98.93
3k4u_A245 Binding component of ABC transporter; structural g 98.89
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 98.88
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 98.87
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 98.86
3del_B242 Arginine binding protein; alpha and beta protein ( 98.82
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 98.8
2q88_A257 EHUB, putative ABC transporter amino acid-binding 98.79
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 98.78
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 98.76
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 98.75
3hv1_A268 Polar amino acid ABC uptake transporter substrate 98.75
4eq9_A246 ABC transporter substrate-binding protein-amino A 98.75
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 98.73
3qax_A268 Probable ABC transporter arginine-binding protein; 98.73
3tql_A227 Arginine-binding protein; transport and binding pr 98.68
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 98.67
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 98.66
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 98.66
2vha_A287 Periplasmic binding transport protein; periplasmic 98.63
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 98.61
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 98.59
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 98.57
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 98.55
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 98.53
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 98.53
1xt8_A292 Putative amino-acid transporter periplasmic solut 98.51
2yln_A283 Putative ABC transporter, periplasmic binding Pro 98.48
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 98.45
3kzg_A237 Arginine 3RD transport system periplasmic binding 98.45
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 98.45
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 98.4
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 98.33
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 98.22
3ix1_A 302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 97.8
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 97.72
3ksx_A 324 Nitrate transport protein; SSUA, alkanesulfonate-b 97.68
2x26_A 308 Periplasmic aliphatic sulphonates-binding protein; 97.58
3qsl_A 346 Putative exported protein; unknown, structural gen 97.55
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 97.54
3un6_A 341 Hypothetical protein saouhsc_00137; structural gen 97.43
2xxp_A 398 CPS2A; replication, peptidoglycan, LCP, LYTR; HET: 97.31
2de3_A 365 Dibenzothiophene desulfurization enzyme B; alpha-b 97.25
4ddd_A 327 Immunogenic protein; ssgcid, structural genomics, 97.25
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 97.19
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 97.17
4esw_A 342 Pyrimidine biosynthesis enzyme THI13; thiamin pyri 97.1
2f5x_A 312 BUGD; periplasmic binding protein, transport prote 96.91
2qpq_A 301 Protein BUG27; alpha/beta domain, venus flytrap, t 96.76
1us5_A 314 Putative GLUR0 ligand binding core; receptor, memb 96.7
2zzv_A 361 ABC transporter, solute-binding protein; periplasm 96.66
2dvz_A 314 BUGE, putative exported protein; periplamsic bindi 96.62
2pfz_A 301 Putative exported protein; extracytoplasmic solute 96.61
2pfy_A 301 Putative exported protein; extracytoplasmic solute 96.49
2vpn_A 316 Periplasmic substrate binding protein; ectoine, hy 96.48
2hpg_A 327 ABC transporter, periplasmic substrate-binding pro 96.45
2x7q_A 321 Ca3427, possible thiamine biosynthesis enzyme; unk 96.19
2xwv_A 312 Sialic acid-binding periplasmic protein SIAP; tran 96.12
2g29_A 417 Nitrate transport protein NRTA; solute-binding pro 96.09
1zbm_A 280 Hypothetical protein AF1704; alpha-beta protein, s 96.0
2czl_A 272 Hypothetical protein TTHA1568; conserved hypotheti 95.95
2i49_A 429 Bicarbonate transporter; alpha-beta protein, C-cla 95.88
2hzl_A 365 Trap-T family sorbitol/mannitol transporter, perip 95.59
1sw5_A275 Osmoprotection protein (PROX); binding-protein, co 94.56
3fxb_A 326 Trap dicarboxylate transporter, DCTP subunit; peri 93.79
1r9l_A 309 Glycine betaine-binding periplasmic protein; perip 93.01
1xs5_A241 29 kDa protein, membrane lipoprotein TPN32; peripl 91.65
2rin_A 298 Putative glycine betaine-binding ABC transporter p 91.5
3hn0_A 283 Nitrate transport protein; ABC transporter, struct 90.87
3u65_B 328 TP33 protein; tetratrico peptide repeat, protein-p 90.03
3mwb_A 313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 89.45
4ef1_A246 Pheromone COB1/lipoprotein, YAEC family; periplasm 88.64
1p99_A295 Hypothetical protein PG110; structural genomics, P 88.4
3tmg_A280 Glycine betaine, L-proline ABC transporter, glycin 87.73
1ofu_X119 SULA, hypothetical protein PA3008; bacterial cell 86.77
2qmw_A 267 PDT, prephenate dehydratase; APC85812, prephenate 86.14
2qmx_A 283 Prephenate dehydratase; APC86053, L-Phe inhibition 83.45
4ib2_A 252 Putative lipoprotein; putative methionine-bindning 83.25
3l6g_A256 Betaine ABC transporter permease and substrate BI 82.76
2nxo_A 291 Hypothetical protein SCO4506; PFAM, DUF178, NYSGXR 80.28
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
Probab=98.96  E-value=8.5e-10  Score=77.47  Aligned_cols=77  Identities=17%  Similarity=0.262  Sum_probs=66.6

Q ss_pred             CCCCChhHHHhCCCeeeecCCccHHHHHHHhh---CCCC-CCcccccCCCCCCChhhHHHHHhcCCeeEEEE--------
Q 047464            9 PSTVDIKTLQRRNAAVGCNGNSFIIRYLINVL---NFKP-GSNKKINAKNGYNSITSYPMAFESGDIAAAFL--------   76 (94)
Q Consensus         9 ~~i~~i~dL~~~~~~VG~~~gSf~~~~L~~~~---~~~~-~~i~~~~~~~~~~s~~~~~~aL~~g~i~A~v~--------   76 (94)
                      ..+++++||+  |++||+..||....++.+.+   |+++ .++..|+      +.++.+++|.+|+|||++.        
T Consensus       127 ~~i~~~~dL~--g~~v~v~~g~~~~~~l~~~~~~~g~~~~~~~~~~~------~~~~~~~~l~~G~vDa~~~~~~~~~~~  198 (259)
T 4dz1_A          127 ITLNNLNELN--KYSIGYPRGMAYSDLIKNDLEPKGYYSLSKVKLYP------TYNETMADLKNGNLDLAFIEEPVYFTF  198 (259)
T ss_dssp             CCCCSGGGGG--GSCEEEETTSTHHHHHHHHTGGGTSCCGGGCEEES------SHHHHHHHHHHTSCSEEEEEHHHHHHH
T ss_pred             CCCCCHHHhC--CCEEEEeCCcHHHHHHHHhcccccccccceeEecC------CHHHHHHHHHcCCCCEEEecHHHHHHH
Confidence            3689999999  79999999999999988732   2222 4678888      9999999999999999998        


Q ss_pred             ----------------------eecCCCCChHHhHHHhh
Q 047464           77 ----------------------VFPRGSPLALDISEAIL   93 (94)
Q Consensus        77 ----------------------afpkGSpL~~dvn~aiL   93 (94)
                                            +|+|+++|+..||++|-
T Consensus       199 ~~~~~~~~~~~~~~~~~~~~~~~~~k~~~l~~~ln~~l~  237 (259)
T 4dz1_A          199 KNKKKMPIESRYVFKNVDQLGIAFKKGSPVRDDFNLWLK  237 (259)
T ss_dssp             HHTSCCCEEEEEEEEEEEEEEEEEETTCHHHHHHHHHHH
T ss_pred             hccCCCceEeecccCCCceEEEEEeCChHHHHHHHHHHH
Confidence                                  99999999999999984
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2xxp_A CPS2A; replication, peptidoglycan, LCP, LYTR; HET: DSL PEG; 1.69A {Streptococcus pneumoniae} PDB: 3tep_A* 3tfl_A* 2xxq_A* 3tel_A* 4de8_A* Back     alignment and structure
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>4esw_A Pyrimidine biosynthesis enzyme THI13; thiamin pyrimidine biosynthesis, transferase; HET: CIT; 1.60A {Candida albicans} PDB: 4esx_A* Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>2zzv_A ABC transporter, solute-binding protein; periplasmic substrate binding protein, calcium, lactate, trap transporter, transport protein; 1.40A {Thermus thermophilus} PDB: 2zzw_A 2zzx_A Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2pfz_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2pfy_A Putative exported protein; extracytoplasmic solute receptor, tripartite ATP independent periplasmic transport, pyroglutamic acid; 1.95A {Bordetella pertussis tohama I} Back     alignment and structure
>2vpn_A Periplasmic substrate binding protein; ectoine, hydroxyectoine, trap-transporter, periplasmic binding protein, transport; HET: 4CS; 1.55A {Halomonas elongata} PDB: 2vpo_A* 3gyy_A Back     alignment and structure
>2hpg_A ABC transporter, periplasmic substrate-binding protein; periplasmic binding protein, thermophilic proteins, trap- transport; HET: MSE; 1.90A {Thermotoga maritima} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2xwv_A Sialic acid-binding periplasmic protein SIAP; transport protein, trap, sugar transport; HET: SLB; 1.05A {Haemophilus influenzae} PDB: 2xxk_A* 2xa5_A* 2wyp_A* 2wx9_A* 2xwo_A* 2xwk_A* 2v4c_A* 2wyk_A* 2xwi_A* 3b50_A* 2cey_A 2cex_A Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>2czl_A Hypothetical protein TTHA1568; conserved hypothetical protein, extremely thermoph bacteria, structural genomics, NPPSFA; HET: CME TLA XPE; 1.55A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 2dbp_A* 3a3u_A* Back     alignment and structure
>2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic SO binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A Back     alignment and structure
>2hzl_A Trap-T family sorbitol/mannitol transporter, periplasmic binding protein, SMOM; trap transporter, periplasmic subunit, ligand binding; 1.40A {Rhodobacter sphaeroides 2} PDB: 2hzk_A Back     alignment and structure
>1sw5_A Osmoprotection protein (PROX); binding-protein, compatible solutes, cation-PI interactions, classical hydrogen bonds, protein binding; 1.80A {Archaeoglobus fulgidus} SCOP: c.94.1.1 PDB: 1sw4_A 1sw1_A 1sw2_A 3mam_A* Back     alignment and structure
>3fxb_A Trap dicarboxylate transporter, DCTP subunit; periplasmic substrate binding protein, selectivity helix, TR membrane; HET: 4CS; 2.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1r9l_A Glycine betaine-binding periplasmic protein; periplasmic binding protein, cation-PI interactions, tryptophan BOX, protein binding; 1.59A {Escherichia coli} SCOP: c.94.1.1 PDB: 1r9q_A* Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure
>3hn0_A Nitrate transport protein; ABC transporter, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; 1.75A {Parabacteroides distasonis} Back     alignment and structure
>3u65_B TP33 protein; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; HET: EDO; 1.40A {Treponema pallidum subsp} PDB: 4di4_B* 4di3_D* Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>4ef1_A Pheromone COB1/lipoprotein, YAEC family; periplasmic methionine binding protein, NLPA lipoprotein, ST genomics; 1.90A {Enterococcus faecalis} PDB: 4ef2_A* Back     alignment and structure
>1p99_A Hypothetical protein PG110; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.70A {Staphylococcus aureus subsp} SCOP: c.94.1.1 Back     alignment and structure
>3tmg_A Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein...; ssgcid, structural genomics; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>1ofu_X SULA, hypothetical protein PA3008; bacterial cell division inhibitor, SULA protein; HET: GDP; 2.1A {Pseudomonas aeruginosa} SCOP: c.37.1.22 Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>4ib2_A Putative lipoprotein; putative methionine-bindning, NLPA lipoprotein, PF03180 FAMI structural genomics, joint center for structural genomics; 1.76A {Ruminococcus gnavus} Back     alignment and structure
>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Back     alignment and structure
>2nxo_A Hypothetical protein SCO4506; PFAM, DUF178, NYSGXRC, 10093F, PSI-2, structural genomics, protein structure initiative; 2.04A {Streptomyces coelicolor} SCOP: c.94.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 98.9
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 98.8
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 98.8
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 98.61
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 98.5
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 98.47
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 98.35
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 97.58
d1us5a_ 298 Putative GluR0 ligand binding core {Thermus thermo 97.19
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 93.15
d1xs5a_ 240 Putative lipoprotein (NlpA family) {Treponema pall 90.62
d2qmwa1 184 Prephenate dehydratase {Staphylococcus aureus [Tax 89.49
d1p99a_ 255 Putative lipoprotein (NlpA family) {Staphylococcus 88.25
d2nxoa1 277 Hypothetical protein SCo4506 {Streptomyces coelico 84.23
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Glutamate receptor ligand binding core
species: Synechocystis sp., GluR0 [TaxId: 1143]

Probab=98.90  E-value=2.4e-09  Score=72.29  Aligned_cols=74  Identities=18%  Similarity=0.262  Sum_probs=66.4

Q ss_pred             CCCCCChhHHHhCCCeeeecCCccHHHHHHHhhCCCCCCcccccCCCCCCChhhHHHHHhcCCeeEEEE-----------
Q 047464            8 QPSTVDIKTLQRRNAAVGCNGNSFIIRYLINVLNFKPGSNKKINAKNGYNSITSYPMAFESGDIAAAFL-----------   76 (94)
Q Consensus         8 ~~~i~~i~dL~~~~~~VG~~~gSf~~~~L~~~~~~~~~~i~~~~~~~~~~s~~~~~~aL~~g~i~A~v~-----------   76 (94)
                      .+.+++++||+  |++||+..|+...+++.. .++   +++.|+      +.++.+++|.+|++|+++.           
T Consensus       105 ~~~~~~~~dl~--~~~i~~~~g~~~~~~~~~-~~~---~i~~~~------~~~~~~~~l~~g~~d~~~~~~~~~~~~~~~  172 (226)
T d1ii5a_         105 TPLFRSVGDLK--NKEVAVVRDTTAVDWANF-YQA---DVRETN------NLTAAITLLQKKQVEAVMFDRPALIYYTRQ  172 (226)
T ss_dssp             TTTCSSGGGGT--TCEEEEETTSHHHHHHHH-TTC---EEEEES------SHHHHHHHHHTTSCSEEEEEHHHHHHHHHH
T ss_pred             cccchhhhhhh--hhccccccCchhhhcccc-ccc---eeeccc------hHHHHHHHHhCCCeeeEeccchhHHHHHhh
Confidence            34588999998  799999999999998876 555   789999      9999999999999999998           


Q ss_pred             --------------------eecCCCCChHHhHHHhh
Q 047464           77 --------------------VFPRGSPLALDISEAIL   93 (94)
Q Consensus        77 --------------------afpkGSpL~~dvn~aiL   93 (94)
                                          +||++++|++.+|++|-
T Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~in~~i~  209 (226)
T d1ii5a_         173 NPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEML  209 (226)
T ss_dssp             CGGGCEEECSCCSEEEEEEEEEETTCTTHHHHHHHHH
T ss_pred             cccccccccCcCCCCceEEEEECCCHHHHHHHHHHHH
Confidence                                89999999999999984
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d2qmwa1 c.94.1.1 (A:1-184) Prephenate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1p99a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2nxoa1 c.94.1.1 (A:5-281) Hypothetical protein SCo4506 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure