Citrus Sinensis ID: 047496


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQNN
cccEEEcccccccccccHHHHcccccccEEcccccccccccccccccccccccccccccccccccHHHccccccccEEEccccEEEEcccHHHHHHccccEEcccccEEEEEccccccccccccEEEccccccccccccccccHHcccccccccEEcccccccccccHHHHHHHHHHccccccccEEEEccccccccccccccc
cccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEccccccccccccccccHHHcccccccEEEcccccccccccHHHHcccccccEEEcccccccccccHHHHcHHHcccc
MLKGIYLGYnklhgeipheIANLRNLEALALGMNNlvgvvsapifnmsTLKIIILINnslfgslpsriglslptvEHLNLELnrfsgtipssitnaSKLTLLKlggntfsglipdtignlrNLEWLGLAYNnltsstskLSFLSSLANCKKLRSlnlignpldgflpssignLSMSLETLLITncsisgnipqaISTKYLFQNN
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQNN
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNltsstsklsflsslANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQNN
***GIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLF***
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQN*
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQNN
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKY*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
C0LGP4 1010 Probable LRR receptor-lik no no 0.950 0.192 0.403 5e-26
C0LGT6 1031 LRR receptor-like serine/ no no 0.950 0.188 0.374 2e-24
Q9LHP4 1141 Receptor-like protein kin no no 0.916 0.163 0.427 3e-23
O49318 1124 Probable leucine-rich rep no no 0.936 0.169 0.387 4e-23
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.921 0.150 0.359 6e-22
Q9SD62 1025 Putative receptor-like pr no no 0.916 0.182 0.398 1e-21
C0LGQ5 1249 LRR receptor-like serine/ no no 0.916 0.149 0.350 2e-21
Q9LVP0 1102 Probable leucine-rich rep no no 0.955 0.176 0.370 2e-21
Q9ZUI0 980 Putative leucine-rich rep no no 0.950 0.197 0.373 5e-21
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.916 0.154 0.387 4e-20
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 117/196 (59%), Gaps = 2/196 (1%)

Query: 1   MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSL 60
           +L+ + L +N L GEIP ++A L  + +L L  NN  GV    ++N+S+LK++ +  N  
Sbjct: 187 LLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHF 246

Query: 61  FGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNL 120
            G L   +G+ LP +   N+  N F+G+IP++++N S L  L +  N  +G IP T GN+
Sbjct: 247 SGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNV 305

Query: 121 RNLEWLGLAYNNLTSSTSK-LSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLET 179
            NL+ L L  N+L S +S+ L FL+SL NC +L +L +  N L G LP SI NLS  L T
Sbjct: 306 PNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVT 365

Query: 180 LLITNCSISGNIPQAI 195
           L +    ISG+IP  I
Sbjct: 366 LDLGGTLISGSIPYDI 381





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 Back     alignment and function description
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZUI0|Y2241_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g24130 OS=Arabidopsis thaliana GN=At2g24130 PE=3 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
147853795 1420 hypothetical protein VITISV_005816 [Viti 0.955 0.137 0.482 6e-41
255572272 1089 serine-threonine protein kinase, plant-t 0.950 0.178 0.489 4e-40
147843440 868 hypothetical protein VITISV_043680 [Viti 0.955 0.224 0.487 1e-39
359485453 1202 PREDICTED: probable LRR receptor-like se 0.955 0.162 0.482 5e-39
302143442 999 unnamed protein product [Vitis vinifera] 0.955 0.195 0.477 1e-38
359485176 1160 PREDICTED: probable LRR receptor-like se 0.950 0.167 0.484 2e-38
255583727 395 serine-threonine protein kinase, plant-t 0.901 0.465 0.505 3e-38
359485451 1454 PREDICTED: LRR receptor-like serine/thre 0.950 0.133 0.474 4e-38
359483681 871 PREDICTED: LRR receptor-like serine/thre 0.950 0.222 0.494 2e-37
359483683 1228 PREDICTED: LRR receptor-like serine/thre 0.950 0.157 0.489 2e-37
>gi|147853795|emb|CAN81714.1| hypothetical protein VITISV_005816 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  172 bits (437), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 128/197 (64%), Gaps = 2/197 (1%)

Query: 1   MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSL 60
           +L+ + L  N + G IP+E+ NL NL+ L L +NNL G++   IFN+S L+ + L  N  
Sbjct: 409 VLQDLELXENNIQGNIPNELGNLINLQNLKLSVNNLTGIIPEAIFNISKLQTLXLAQNHF 468

Query: 61  FGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNL 120
            GSLPS IG  LP +E L +  N FSG IP SI+N S+LT+L +  N F+G +P  +GNL
Sbjct: 469 SGSLPSSIGTQLPDLEGLAIGXNEFSGIIPMSISNMSELTVLDIWANFFTGDVPKDLGNL 528

Query: 121 RNLEWLGLAYNNLTS--STSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLE 178
           R LE+L L +N LT   STS++ FL+SL NCK LR L +  NPL G LP+S+GNLS+SLE
Sbjct: 529 RRLEFLNLGFNQLTDEHSTSEVGFLTSLTNCKFLRRLWIEDNPLKGILPNSLGNLSISLE 588

Query: 179 TLLITNCSISGNIPQAI 195
           +   + C   G IP  I
Sbjct: 589 SFDASACQFKGTIPTGI 605




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255572272|ref|XP_002527075.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223533580|gb|EEF35319.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147843440|emb|CAN79970.1| hypothetical protein VITISV_043680 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485453|ref|XP_003633276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143442|emb|CBI22003.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359485176|ref|XP_002280075.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255583727|ref|XP_002532617.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527673|gb|EEF29783.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359485451|ref|XP_002276944.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483681|ref|XP_002268458.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359483683|ref|XP_003633001.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.950 0.238 0.379 6.8e-29
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.926 0.184 0.389 5.5e-27
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.950 0.188 0.358 6.5e-26
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.921 0.199 0.4 4e-25
TAIR|locus:2075631 1009 AT3G47090 [Arabidopsis thalian 0.926 0.187 0.368 9.5e-25
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.916 0.163 0.417 1.9e-24
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.916 0.182 0.367 2.6e-24
TAIR|locus:2046525 1124 AT2G33170 [Arabidopsis thalian 0.931 0.169 0.394 8e-24
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.950 0.192 0.362 8.7e-24
TAIR|locus:2120362 1249 GSO1 "GASSHO1" [Arabidopsis th 0.960 0.156 0.382 1.2e-23
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
 Score = 331 (121.6 bits), Expect = 6.8e-29, P = 6.8e-29
 Identities = 74/195 (37%), Positives = 110/195 (56%)

Query:     2 LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLF 61
             L  + L  N L G IP     LR L  L+L  NNL G +  PI+N+S+L I  +I+N L 
Sbjct:   176 LTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLS 235

Query:    62 GSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLR 121
             G+LP+    +LP+++ + +  N+F G IP+SI NAS +++  +G N+FSG++P  IG +R
Sbjct:   236 GTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMR 295

Query:   122 NLEWLGLAYN-NXXXXXXXXXXXXXXANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETL 180
             NL+ L L    +               NC  L+ + L G    G LP S+ NLS SL +L
Sbjct:   296 NLQRLELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSL 355

Query:   181 LITNCSISGNIPQAI 195
              I +  ISG++P+ I
Sbjct:   356 SIRDNKISGSLPRDI 370


GO:0004672 "protein kinase activity" evidence=IDA
GO:0006468 "protein phosphorylation" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IMP
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075631 AT3G47090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046525 AT2G33170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00025217001
SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (2202 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-21
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-19
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-14
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-07
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 90.3 bits (224), Expect = 4e-21
 Identities = 69/196 (35%), Positives = 100/196 (51%), Gaps = 7/196 (3%)

Query: 2   LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLF 61
           LK IYLGYN L GEIP+EI  L +L  L L  NNL G + + + N+  L+ + L  N L 
Sbjct: 214 LKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLS 273

Query: 62  GSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLR 121
           G +P  I  SL  +  L+L  N  SG IP  +     L +L L  N F+G IP  + +L 
Sbjct: 274 GPIPPSI-FSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLP 332

Query: 122 NLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLL 181
            L+ L L  N  +    K     +L     L  L+L  N L G +P  + + S +L  L+
Sbjct: 333 RLQVLQLWSNKFSGEIPK-----NLGKHNNLTVLDLSTNNLTGEIPEGLCS-SGNLFKLI 386

Query: 182 ITNCSISGNIPQAIST 197
           + + S+ G IP+++  
Sbjct: 387 LFSNSLEGEIPKSLGA 402


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.93
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.92
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.84
KOG0617264 consensus Ras suppressor protein (contains leucine 99.79
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.78
KOG0617264 consensus Ras suppressor protein (contains leucine 99.77
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.76
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.71
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.68
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.64
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.62
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.61
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.52
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.51
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.5
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.49
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.48
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.39
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.36
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.33
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.2
PLN03150623 hypothetical protein; Provisional 99.19
PLN03150623 hypothetical protein; Provisional 99.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.17
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.16
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 99.13
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.12
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.93
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.75
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.69
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.66
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.65
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.56
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.53
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.43
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 98.43
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.31
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.29
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.28
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.21
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.16
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.1
PRK15386 426 type III secretion protein GogB; Provisional 98.03
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.98
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.93
PRK15386 426 type III secretion protein GogB; Provisional 97.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.48
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.44
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.4
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.28
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.88
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.69
KOG4341 483 consensus F-box protein containing LRR [General fu 96.5
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.29
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.2
KOG4341483 consensus F-box protein containing LRR [General fu 95.7
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.57
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.43
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.98
KOG1947 482 consensus Leucine rich repeat proteins, some prote 94.76
KOG4308 478 consensus LRR-containing protein [Function unknown 94.66
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.81
smart0037026 LRR Leucine-rich repeats, outliers. 93.81
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 92.48
KOG4308 478 consensus LRR-containing protein [Function unknown 90.93
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.63
KOG0473 326 consensus Leucine-rich repeat protein [Function un 83.23
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 82.94
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 81.23
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=99.93  E-value=3.7e-25  Score=187.86  Aligned_cols=193  Identities=34%  Similarity=0.564  Sum_probs=126.6

Q ss_pred             cceEEccCCccccccChhccCCCCCcEEEccCccccccCCccccCCCccceeeecCCcceeecCCccCCCCCCccEEEcC
Q 047496            2 LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHLNLE   81 (204)
Q Consensus         2 L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~   81 (204)
                      |++|++++|.+.+.+|..++.+++|++|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+. .+++|++|++.
T Consensus       142 L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~L~  220 (968)
T PLN00113        142 LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELG-QMKSLKWIYLG  220 (968)
T ss_pred             CCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHc-CcCCccEEECc
Confidence            56666666666666677777777777777777777766676677777777777777777666666665 67777777777


Q ss_pred             CCcCccCCCccccCCCCCCEEeccCCcccccccccccCCCCCcEEEccCccCCCCcccchhhhccccCCCccEEEeeCCc
Q 047496           82 LNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNP  161 (204)
Q Consensus        82 ~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~l~l~~n~  161 (204)
                      +|.+....|..+..+++|++|++++|.+.+..|..++.+++|+.|++++|.+....+     ..+..+++|++|++++|.
T Consensus       221 ~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p-----~~l~~l~~L~~L~Ls~n~  295 (968)
T PLN00113        221 YNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP-----PSIFSLQKLISLDLSDNS  295 (968)
T ss_pred             CCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc-----hhHhhccCcCEEECcCCe
Confidence            777766666667777777777777777766666667777777777777766643311     344555556666666666


Q ss_pred             CCCCCCccccccccCccEEEeeccccccccchhhhhhhhh
Q 047496          162 LDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLF  201 (204)
Q Consensus       162 ~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~l  201 (204)
                      +.+.+|..+..++ +|+.|++++|.+++..|..++.++.|
T Consensus       296 l~~~~p~~~~~l~-~L~~L~l~~n~~~~~~~~~~~~l~~L  334 (968)
T PLN00113        296 LSGEIPELVIQLQ-NLEILHLFSNNFTGKIPVALTSLPRL  334 (968)
T ss_pred             eccCCChhHcCCC-CCcEEECCCCccCCcCChhHhcCCCC
Confidence            5555555555555 55555555555555555555555444



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-13
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-10
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-13
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-10
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-09
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure

Iteration: 1

Score = 73.2 bits (178), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 51/131 (38%), Positives = 72/131 (54%), Gaps = 3/131 (2%) Query: 2 LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLF 61 L ++L +N L G IP + +L L L L +N L G + + + TL+ +IL N L Sbjct: 420 LVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLT 479 Query: 62 GSLPSRIGLSLPT-VEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNL 120 G +PS GLS T + ++L NR +G IP I L +LKL N+FSG IP +G+ Sbjct: 480 GEIPS--GLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDC 537 Query: 121 RNLEWLGLAYN 131 R+L WL L N Sbjct: 538 RSLIWLDLNTN 548
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-38
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-37
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-36
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-29
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-15
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-36
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-23
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-23
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-21
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-20
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-19
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-18
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-17
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-13
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-23
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-21
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-19
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-12
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-22
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-20
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-19
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-18
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-18
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-16
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-21
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-17
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-15
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-16
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-14
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-11
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-10
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-12
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 4e-11
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-10
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-11
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-10
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-12
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-10
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-11
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-09
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-09
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-09
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 3e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-11
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 9e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-10
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-06
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-08
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 6e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-09
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-08
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 9e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-08
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-06
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  138 bits (349), Expect = 4e-38
 Identities = 67/219 (30%), Positives = 98/219 (44%), Gaps = 23/219 (10%)

Query: 1   MLKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAP-IFNMSTLKIIILINNS 59
            L G+ L  N  +G +P    +   LE+LAL  NN  G +    +  M  LK++ L  N 
Sbjct: 295 TLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNE 354

Query: 60  LFGSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASK--LTLLKLGGNTFSGLIPDTI 117
             G LP  +     ++  L+L  N FSG I  ++    K  L  L L  N F+G IP T+
Sbjct: 355 FSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTL 414

Query: 118 GNLRNLEWLGLAYNNLT-------SSTSKLSFL------------SSLANCKKLRSLNLI 158
            N   L  L L++N L+        S SKL  L              L   K L +L L 
Sbjct: 415 SNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 474

Query: 159 GNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAIST 197
            N L G +PS + N + +L  + ++N  ++G IP+ I  
Sbjct: 475 FNDLTGEIPSGLSNCT-NLNWISLSNNRLTGEIPKWIGR 512


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.95
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.94
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.93
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.93
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.92
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.92
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.92
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.91
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.91
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.91
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.9
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.9
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.9
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.89
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.89
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.88
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.87
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.87
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.87
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.86
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.85
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.85
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.84
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.84
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.84
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.83
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.83
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.81
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.79
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.79
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.78
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.78
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.77
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.76
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.75
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.75
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.75
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.69
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.66
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.64
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.6
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.59
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.56
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.56
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.55
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.54
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.52
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.52
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.47
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.3
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.13
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.93
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.71
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.7
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.57
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.55
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.42
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.91
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.62
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.24
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.13
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 84.51
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.96  E-value=5.7e-29  Score=185.57  Aligned_cols=191  Identities=26%  Similarity=0.441  Sum_probs=120.7

Q ss_pred             cceEEccCCccccccChhccCCCCCcEEEccCccccccCCccccCCCccceeeecCCcceeecCCccCCCCC-CccEEEc
Q 047496            2 LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLP-TVEHLNL   80 (204)
Q Consensus         2 L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~-~L~~L~l   80 (204)
                      |++|++++|.+.+.+|..+..+++|++|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+. .++ +|++|++
T Consensus       103 L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~-~l~~~L~~L~L  181 (313)
T 1ogq_A          103 LHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYG-SFSKLFTSMTI  181 (313)
T ss_dssp             CSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGG-CCCTTCCEEEC
T ss_pred             CCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECcCCcccCcCCHHHh-hhhhcCcEEEC
Confidence            44555555555545555555555555555555555555555555555555555555555555555554 343 5555555


Q ss_pred             CCCcCccCCCccccCCCCCCEEeccCCcccccccccccCCCCCcEEEccCccCCCCcccchhhhccccCCCccEEEeeCC
Q 047496           81 ELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGN  160 (204)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~L~~l~l~~n  160 (204)
                      ++|.+....+..+..+. |++|++++|.+.+..+..+..+++|+.|++++|.+...+      ..+..+++|++|++++|
T Consensus       182 ~~N~l~~~~~~~~~~l~-L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~------~~~~~l~~L~~L~Ls~N  254 (313)
T 1ogq_A          182 SRNRLTGKIPPTFANLN-LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDL------GKVGLSKNLNGLDLRNN  254 (313)
T ss_dssp             CSSEEEEECCGGGGGCC-CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBG------GGCCCCTTCCEEECCSS
T ss_pred             cCCeeeccCChHHhCCc-ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceeeec------CcccccCCCCEEECcCC
Confidence            55555544555555554 666666666666555666666777777777777665443      23566788888888888


Q ss_pred             cCCCCCCccccccccCccEEEeeccccccccchhhhhhhhhc
Q 047496          161 PLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAISTKYLFQ  202 (204)
Q Consensus       161 ~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~l~~l~  202 (204)
                      .+++.+|..+..++ +|++|++++|.+++.+|.. ..++.|+
T Consensus       255 ~l~~~~p~~l~~l~-~L~~L~Ls~N~l~~~ip~~-~~l~~L~  294 (313)
T 1ogq_A          255 RIYGTLPQGLTQLK-FLHSLNVSFNNLCGEIPQG-GNLQRFD  294 (313)
T ss_dssp             CCEECCCGGGGGCT-TCCEEECCSSEEEEECCCS-TTGGGSC
T ss_pred             cccCcCChHHhcCc-CCCEEECcCCcccccCCCC-ccccccC
Confidence            88878888888887 8888888888888887775 5555554



>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 58.1 bits (139), Expect = 6e-11
 Identities = 33/174 (18%), Positives = 66/174 (37%), Gaps = 10/174 (5%)

Query: 2   LKGIYLGYNKLHGEIPHEIANLRNLEALALGMNNLVGVVSAPIFNMSTLKIIILINNSLF 61
              + L  NK+      +  NL+NL  L L  N +  +       +  L+ + L  N L 
Sbjct: 33  TALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQL- 91

Query: 62  GSLPSRIGLSLPTVEHLNLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLR 121
             LP ++  +L  +     E+ +   ++ + +     +  L       SG+       ++
Sbjct: 92  KELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVE-LGTNPLKSSGIENGAFQGMK 150

Query: 122 NLEWLGLAYNNLTSSTSKLSFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSM 175
            L ++ +A  N+T+    L           L  L+L GN +     +S+  L+ 
Sbjct: 151 KLSYIRIADTNITTIPQGL--------PPSLTELHLDGNKITKVDAASLKGLNN 196


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.82
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.81
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.8
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.78
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.75
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.69
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.64
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.63
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.59
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.41
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.38
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.34
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.19
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.84
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.33
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.23
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.76
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.56
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.93  E-value=6.6e-26  Score=167.25  Aligned_cols=198  Identities=29%  Similarity=0.463  Sum_probs=144.8

Q ss_pred             cceEEccCCcccc--ccChhccCCCCCcEEEccC-ccccccCCccccCCCccceeeecCCcceeecCCccCCCCCCccEE
Q 047496            2 LKGIYLGYNKLHG--EIPHEIANLRNLEALALGM-NNLVGVVSAPIFNMSTLKIIILINNSLFGSLPSRIGLSLPTVEHL   78 (204)
Q Consensus         2 L~~L~l~~~~~~~--~~~~~~~~~~~L~~L~l~~-~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L   78 (204)
                      ++.|+|+++.+.+  .+|+.++.+++|++|++++ |.+.+..|..+..+++|++|++++|.+.+..+..+. .+++|+.+
T Consensus        52 v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~-~~~~L~~l  130 (313)
T d1ogqa_          52 VNNLDLSGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLS-QIKTLVTL  130 (313)
T ss_dssp             EEEEEEECCCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGG-GCTTCCEE
T ss_pred             EEEEECCCCCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhcccccccccccccc-chhhhccc
Confidence            6778888888775  4788888999999999986 678877888888899999999999888754444444 67778888


Q ss_pred             EcCCCcCccCCCccccCCCCCCEEeccCCcccccccccccCCCCC-cEEEccCccCCCCcccc-----------------
Q 047496           79 NLELNRFSGTIPSSITNASKLTLLKLGGNTFSGLIPDTIGNLRNL-EWLGLAYNNLTSSTSKL-----------------  140 (204)
Q Consensus        79 ~l~~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~l~~l~~L-~~L~l~~~~~~~~~~~~-----------------  140 (204)
                      ++.+|.+....|..+..++.++++++++|.+.+..|..+..+..+ +.+++++|.+.......                 
T Consensus       131 ~l~~N~~~~~~p~~l~~l~~L~~l~l~~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~~l~l~~~~~~  210 (313)
T d1ogqa_         131 DFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLE  210 (313)
T ss_dssp             ECCSSEEESCCCGGGGGCTTCCEEECCSSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCSEEECCSSEEE
T ss_pred             ccccccccccCchhhccCcccceeeccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            888887776677777777777777777777666666555554443 44444444332110000                 


Q ss_pred             ------------------------hhhhccccCCCccEEEeeCCcCCCCCCccccccccCccEEEeeccccccccchhhh
Q 047496          141 ------------------------SFLSSLANCKKLRSLNLIGNPLDGFLPSSIGNLSMSLETLLITNCSISGNIPQAIS  196 (204)
Q Consensus       141 ------------------------~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~  196 (204)
                                              ..+..+..+++++.|++++|++++.+|..+..++ +|++|++++|+++|.+|. ++
T Consensus       211 ~~~~~~~~~~~~l~~l~~~~~~l~~~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~-~L~~L~Ls~N~l~g~iP~-~~  288 (313)
T d1ogqa_         211 GDASVLFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLK-FLHSLNVSFNNLCGEIPQ-GG  288 (313)
T ss_dssp             ECCGGGCCTTSCCSEEECCSSEECCBGGGCCCCTTCCEEECCSSCCEECCCGGGGGCT-TCCEEECCSSEEEEECCC-ST
T ss_pred             ccccccccccccccccccccccccccccccccccccccccCccCeecccCChHHhCCC-CCCEEECcCCcccccCCC-cc
Confidence                                    0113456678899999999999989999999998 999999999999998885 45


Q ss_pred             hhhhhc
Q 047496          197 TKYLFQ  202 (204)
Q Consensus       197 ~l~~l~  202 (204)
                      ++.+|+
T Consensus       289 ~L~~L~  294 (313)
T d1ogqa_         289 NLQRFD  294 (313)
T ss_dssp             TGGGSC
T ss_pred             cCCCCC
Confidence            555543



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure