Citrus Sinensis ID: 047545

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200------
MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ
ccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHccccccccccccccccEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccccccEEccccEEEccccccccccccccccccccccccccccccccEEEccccccccccccEEEEccccccccccccEEEEEEccccccc
cccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccHHHccccccEEEEEEEccccccEEEEEEccccccHHHHHHHHHHccccccccEEEEEEcccEEEcccccccccccccEEcccccccccccccccccEEEEccccccccccEEEEEEcccccccccEEEEEEEEccccccc
MAKIKPQALLLQskrkkgpnrisVTSIVLFTLIVVLALCFLFSsykhwsqrssfqaeNQELVvedensfmdskksdlpgyaiidthkgsITVElfkdsspdvVDEFIDLCQRGRLKGMLFRHIIKHYVIqagdidklgsiedwttrgkhysqldtSLKHEAFMLGtskakhdnqgfdlyittapmpdlseKLIVFGRvikgedvvq
makikpqalllqskrkkgpnriSVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYviqagdidklGSIEDWTTRGKHYSQLDTSLKHEAFMLGTskakhdnqgFDLYITTAPMPDLSEKLIVFGrvikgedvvq
MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ
*********************ISVTSIVLFTLIVVLALCFLFSSYKHWSQ**************************LPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIK******
***************************VLFTLIVVLALCFLFSS**********************************GYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ
MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ
**KIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQ********************DSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVV*
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query206 2.2.26 [Sep-21-2011]
Q94A16230 Peptidyl-prolyl cis-trans no no 0.980 0.878 0.543 1e-56
P0C1J1 533 Peptidyl-prolyl cis-trans N/A no 0.733 0.283 0.341 1e-13
Q8X191162 Peptidyl-prolyl cis-trans yes no 0.597 0.759 0.346 2e-13
P0C1I1 364 Peptidyl-prolyl cis-trans N/A no 0.606 0.343 0.352 2e-13
Q29RZ2644 Peptidylprolyl isomerase yes no 0.611 0.195 0.346 6e-13
Q8CEC6646 Peptidylprolyl isomerase yes no 0.611 0.195 0.338 8e-13
P0C1I4165 Peptidyl-prolyl cis-trans N/A no 0.606 0.757 0.341 9e-13
Q4WCR3161 Peptidyl-prolyl cis-trans yes no 0.606 0.776 0.333 1e-12
P0CP84174 Peptidyl-prolyl cis-trans no no 0.626 0.741 0.315 1e-12
P0CP85174 Peptidyl-prolyl cis-trans N/A no 0.626 0.741 0.315 1e-12
>sp|Q94A16|CP21C_ARATH Peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial OS=Arabidopsis thaliana GN=CYP21-3 PE=2 SV=2 Back     alignment and function desciption
 Score =  219 bits (558), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 152/206 (73%), Gaps = 4/206 (1%)

Query: 1   MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQE 60
           MAKIKPQALL QSK+KKGP+RIS+T+IV++TL V+L +  LFS+Y+ W+ RS     N  
Sbjct: 1   MAKIKPQALLQQSKKKKGPSRISITNIVIYTLAVLLLVFVLFSAYRRWTHRSEIPTHNGR 60

Query: 61  LVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLF 120
            V+ED  +F   K  DLP +A +DT KGS+T+ELFKD++P+VVD+F+  CQ G  KG LF
Sbjct: 61  SVLEDA-AFPGMKNVDLPRFATLDTGKGSVTIELFKDTAPNVVDQFMKFCQDGYFKGFLF 119

Query: 121 RHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYI 180
             ++KH+VIQAGD  +  +++DW    K+   +DTSLKHE FM+GT KAK++  GF+ +I
Sbjct: 120 SRVVKHFVIQAGDSAEFDAVKDWALDRKN---IDTSLKHEEFMVGTPKAKNEQGGFEFFI 176

Query: 181 TTAPMPDLSEKLIVFGRVIKGEDVVQ 206
            +A + DL+EKL VFGRV KG+DVVQ
Sbjct: 177 VSAQIKDLNEKLTVFGRVSKGQDVVQ 202
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|P0C1J1|PPIL2_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 2 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp14 PE=3 SV=1 Back     alignment and function description
>sp|Q8X191|PPIL1_ASPNG Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 Back     alignment and function description
>sp|P0C1I1|PPID_RHIO9 Peptidyl-prolyl cis-trans isomerase D OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp12 PE=3 SV=1 Back     alignment and function description
>sp|Q29RZ2|PPWD1_BOVIN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Bos taurus GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 Back     alignment and function description
>sp|P0C1I4|PPIL1_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp3 PE=3 SV=1 Back     alignment and function description
>sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|P0CP84|PPIL1_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP1 PE=3 SV=1 Back     alignment and function description
>sp|P0CP85|PPIL1_CRYNB Peptidyl-prolyl cis-trans isomerase-like 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
358248798232 uncharacterized protein LOC100803596 [Gl 0.990 0.879 0.660 9e-77
388516631229 unknown [Lotus japonicus] 0.975 0.877 0.640 2e-74
217071554230 unknown [Medicago truncatula] gi|3885148 0.975 0.873 0.661 2e-74
388504344230 unknown [Medicago truncatula] 0.975 0.873 0.657 1e-73
390134563234 cyclophilin-like peptidyl-prolyl cis-tra 1.0 0.880 0.606 3e-72
449436417234 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.880 0.631 4e-72
356576997230 PREDICTED: peptidyl-prolyl cis-trans iso 0.980 0.878 0.626 9e-72
356521078225 PREDICTED: peptidyl-prolyl cis-trans iso 0.956 0.875 0.621 4e-69
225431948234 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.880 0.621 2e-68
224099151234 predicted protein [Populus trichocarpa] 0.995 0.876 0.618 2e-68
>gi|358248798|ref|NP_001239686.1| uncharacterized protein LOC100803596 [Glycine max] gi|255634745|gb|ACU17734.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 170/206 (82%), Gaps = 2/206 (0%)

Query: 1   MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRSSFQAENQE 60
           MA+IKPQALL QSKRKKGP+RIS  +++ + LI+ L   FLF+SY+HWS RS  Q+E+  
Sbjct: 1   MARIKPQALLQQSKRKKGPSRISAATVIFYFLILALLGFFLFASYRHWSSRSRLQSEDHL 60

Query: 61  LVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLF 120
            V E EN+F+DSKKS+LPGYA+++T KGSI +EL+K+S+P+VVDEFIDLCQ+G  KGMLF
Sbjct: 61  SVSEGENTFVDSKKSELPGYAVLNTSKGSIIIELYKESAPEVVDEFIDLCQKGHFKGMLF 120

Query: 121 RHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYI 180
             +IKHYVIQAGD    G+ EDW  RGK ++   TS+KHEAFMLGTSK KH N+GFDL+I
Sbjct: 121 HKVIKHYVIQAGDNQGQGATEDWNLRGKQHT--ITSMKHEAFMLGTSKGKHHNKGFDLFI 178

Query: 181 TTAPMPDLSEKLIVFGRVIKGEDVVQ 206
           TTAP+PDL+EK+IVFG+VIKGEDVVQ
Sbjct: 179 TTAPIPDLNEKIIVFGQVIKGEDVVQ 204

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388516631|gb|AFK46377.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|217071554|gb|ACJ84137.1| unknown [Medicago truncatula] gi|388514865|gb|AFK45494.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388504344|gb|AFK40238.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|390134563|gb|AFL56269.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase [Cirsium arvense] Back     alignment and taxonomy information
>gi|449436417|ref|XP_004135989.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial-like [Cucumis sativus] gi|449507828|ref|XP_004163140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356576997|ref|XP_003556616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|356521078|ref|XP_003529185.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|225431948|ref|XP_002277818.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP21-3, mitochondrial [Vitis vinifera] gi|296083251|emb|CBI22887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224099151|ref|XP_002311384.1| predicted protein [Populus trichocarpa] gi|222851204|gb|EEE88751.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query206
TAIR|locus:2103420236 AT3G66654 [Arabidopsis thalian 1.0 0.872 0.548 5.9e-57
TAIR|locus:2065205230 AT2G47320 [Arabidopsis thalian 0.980 0.878 0.543 2.5e-56
DICTYBASE|DDB_G0269054635 ppwd1 "cyclophilin-type peptid 0.708 0.229 0.326 3.1e-15
TAIR|locus:2053491164 AT2G36130 [Arabidopsis thalian 0.665 0.835 0.304 6.9e-15
TAIR|locus:2076003631 CYP71 "cyclophilin 71" [Arabid 0.645 0.210 0.342 6.1e-14
UNIPROTKB|F1NAJ2657 PPWD1 "Uncharacterized protein 0.611 0.191 0.346 7.4e-14
UNIPROTKB|G4MPI6623 MGG_05731 "Cyclophilin-type pe 0.631 0.208 0.308 1e-13
MGI|MGI:2443069646 Ppwd1 "peptidylprolyl isomeras 0.611 0.195 0.338 1.9e-13
RGD|1310204646 Ppwd1 "peptidylprolyl isomeras 0.611 0.195 0.338 1.9e-13
ZFIN|ZDB-GENE-070615-16622 ppwd1 "peptidylprolyl isomeras 0.611 0.202 0.330 5.7e-13
TAIR|locus:2103420 AT3G66654 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 586 (211.3 bits), Expect = 5.9e-57, P = 5.9e-57
 Identities = 114/208 (54%), Positives = 155/208 (74%)

Query:     1 MAKIKPQALLLQSKRKKGPNRISVTSIVLFTLIVVLALCFLFSSYKHWSQRS--SFQAEN 58
             MAKIKPQALL QSK+KKGP+RIS+++I++  L+V + +  L ++Y+HWSQRS  + + E 
Sbjct:     1 MAKIKPQALLNQSKKKKGPSRISISTIIVCNLVVAVVILSLVTTYRHWSQRSRNTIEHET 60

Query:    59 QELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGM 118
             +    ED N+    K  DLPG+A I+T KG ITVELFK+ SP+VVD+F+DLCQ+   KGM
Sbjct:    61 RSQRFEDTNTASGQKTYDLPGFADINTSKGLITVELFKEGSPEVVDKFLDLCQKDHFKGM 120

Query:   119 LFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDL 178
              F+ +IK+Y++QAG       +E+WT +GK   +L    KHEAFMLGT K K +N+ F+L
Sbjct:   121 PFQRVIKNYLVQAGHSPSSIPVEEWTAKGKLRGRLHIGPKHEAFMLGTPKNKGNNKDFEL 180

Query:   179 YITTAPMPDLSEKLIVFGRVIKGEDVVQ 206
              ITTAP+PDL+++LIVFGRV+KGEDVVQ
Sbjct:   181 LITTAPIPDLNDQLIVFGRVLKGEDVVQ 208
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2065205 AT2G47320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269054 ppwd1 "cyclophilin-type peptidylprolyl cis-trans isomerase (PPIase)" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2053491 AT2G36130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2076003 CYP71 "cyclophilin 71" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAJ2 PPWD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G4MPI6 MGG_05731 "Cyclophilin-type peptidyl-prolyl cis-trans isomerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
MGI|MGI:2443069 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310204 Ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070615-16 ppwd1 "peptidylprolyl isomerase domain and WD repeat containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_LG_VIII0437
hypothetical protein; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity) (235 aa)
(Populus trichocarpa)
Predicted Functional Partners:
grail3.0108002501
hypothetical protein; PPIases accelerate the folding of proteins. It catalyzes the cis-trans is [...] (224 aa)
  •     0.494

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 7e-29
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 3e-24
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-20
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 2e-17
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 3e-15
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 4e-15
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 2e-13
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 9e-12
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 6e-11
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 1e-09
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 2e-06
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 4e-06
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 2e-04
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 7e-04
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 8e-04
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information 
 Score =  104 bits (262), Expect = 7e-29
 Identities = 41/125 (32%), Positives = 57/125 (45%)

Query: 82  IIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIE 141
            +DT KG I +EL+ D +P  V+ F+ L + G   G  F  +I  ++IQ GD    G   
Sbjct: 1   TLDTTKGRIVIELYGDEAPKTVENFLSLARGGFYDGTTFHRVIPGFMIQGGDPTGTGGGG 60

Query: 142 DWTTRGKHYSQLDTSLKHEAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKG 201
                            H    L  + A  +  G   +ITTAP P L  K  VFG+V++G
Sbjct: 61  SGPGYKFPDENFPLKYHHRRGTLSMANAGPNTNGSQFFITTAPTPHLDGKHTVFGKVVEG 120

Query: 202 EDVVQ 206
            DVV 
Sbjct: 121 MDVVD 125

This family contains eukaryotic, bacterial and archeal proteins which exhibit a peptidylprolyl cis- trans isomerases activity (PPIase, Rotamase) and in addition bind the immunosuppressive drug cyclosporin (CsA). Immunosuppression in vertebrates is believed to be the result of the cyclophilin A-cyclosporin protein drug complex binding to and inhibiting the protein-phosphatase calcineurin. PPIase is an enzyme which accelerates protein folding by catalyzing the cis-trans isomerization of the peptide bonds preceding proline residues. Cyclophilins are a diverse family in terms of function and have been implicated in protein folding processes which depend on catalytic /chaperone-like activities. This group contains human cyclophilin 40, a co-chaperone of the hsp90 chaperone system; human cyclophilin A, a chaperone in the HIV-1 infectious process and; human cyclophilin H, a component of the U4/U6 snRNP, whose isomerization or chaperoning activities may play a role in RNA splicing. . Length = 146
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 206
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PTZ00060183 cyclophilin; Provisional 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PTZ00221249 cyclophilin; Provisional 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.96
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.92
PRK00969 508 hypothetical protein; Provisional 96.85
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.73
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 96.28
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 95.41
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 92.65
PRK00969 508 hypothetical protein; Provisional 92.63
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 91.58
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-47  Score=300.53  Aligned_cols=123  Identities=32%  Similarity=0.528  Sum_probs=110.4

Q ss_pred             EEEEecceeEEEEEcCCCChHHHHHHHHhhhCCCcCCceEEEeecCeEEEecccCCC-CCCccccccccccccCCC--CC
Q 047545           81 AIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKL-GSIEDWTTRGKHYSQLDT--SL  157 (206)
Q Consensus        81 ~~~~t~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~Rv~~~f~iq~Gd~~~~-~~~~~~~~~~~~~~~~~~--~l  157 (206)
                      ++++|+.|+|+||||++.||+||+||++||+.+||||+.||||+++|||||||++++ +.+++   +.++.+|...  ..
T Consensus         2 v~~~t~~G~I~ieL~~~~aP~Tv~NF~~l~~~g~Ydg~~FHRVi~~FmiQgGd~~~~~g~gg~---~~~f~~E~~~~~~~   78 (158)
T COG0652           2 VILETNKGDITIELYPDKAPKTVANFLQLVKEGFYDGTIFHRVIPGFMIQGGDPTGGDGTGGP---GPPFKDENFALNGD   78 (158)
T ss_pred             ceeeccCCCEEEEECCCcCcHHHHHHHHHHHcCCCCCceEEEeecCceeecCCCCCCCCCCCC---CCCCcccccccccc
Confidence            678999999999999999999999999999999999999999999999999999987 55554   2455565333  34


Q ss_pred             CCCceEEEEecCC-CCCCcceEEEEcCCCCCCCCCccEEEEEEeCccccC
Q 047545          158 KHEAFMLGTSKAK-HDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ  206 (206)
Q Consensus       158 ~h~~G~vsma~~~-~~s~gSqFfIt~~~~~~Ld~~~~VFG~Vi~G~dvl~  206 (206)
                      .|.+|+|||||++ ||||+|||||++.++||||++|+|||+|++|||+||
T Consensus        79 ~~~~G~lsMA~~g~P~t~~SQFFI~~~~~~~Ld~~ytVFG~Vv~Gmdvvd  128 (158)
T COG0652          79 RHKRGTLSMARAGDPNSNGSQFFITVVDNPFLDGKYTVFGQVVEGMDVVD  128 (158)
T ss_pred             cCCcceEeEcccCCcCCccCeEEEEecCCcccCCCCcEEEEEehhHHHHH
Confidence            4669999999988 999999999999999999999999999999999985

>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 8e-14
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 8e-13
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 2e-12
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 3e-12
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 6e-12
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 8e-12
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 9e-12
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 9e-12
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 1e-11
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-11
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 2e-11
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 8e-11
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 1e-10
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 3e-10
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 3e-10
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 3e-10
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 3e-10
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 1e-09
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 1e-09
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 5e-09
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 9e-09
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-08
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 2e-08
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-08
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 3e-08
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 3e-08
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 9e-08
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 9e-08
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 9e-08
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 9e-08
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 1e-07
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 1e-07
1dyw_A173 Biochemical And Structural Characterization Of A Di 1e-07
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 2e-07
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 2e-07
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 2e-07
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 2e-07
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 2e-07
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 2e-07
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 3e-07
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 3e-07
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-07
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 4e-07
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 4e-07
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 4e-07
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 4e-07
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 4e-07
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 4e-07
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 4e-07
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 4e-07
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 5e-07
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 5e-07
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 8e-07
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 9e-07
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 9e-07
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 2e-06
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 2e-06
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 2e-06
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 3e-06
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 6e-06
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 1e-05
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-05
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-05
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 2e-05
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 3e-05
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 3e-05
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 7e-05
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 8e-05
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 9e-05
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 1e-04
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 2e-04
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 7e-04
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure 
Iteration: 1

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/127 (34%), Positives = 61/127 (48%), Gaps = 1/127 (0%)
Query: 81  AIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSI 140
           AII T  G I  +LF    P  V+ F    + G   G  F  IIK ++IQ GD    G  
Sbjct: 24  AIIHTSMGDIHTKLFPVECPKTVENFCVHSRNGYYNGHTFHRIIKGFMIQTGDPTGTGMG 83
Query: 141 EDWTTRGKHYSQLDTSLKHE-AFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVI 199
            +    G+   +  ++L+H+  + L  + A  +  G   +IT  P P L  K  VFGRV 
Sbjct: 84  GESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNGSQFFITVVPTPWLDNKHTVFGRVT 143
Query: 200 KGEDVVQ 206
           KG +VVQ
Sbjct: 144 KGMEVVQ 150
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query206
2b71_A196 Cyclophilin-like protein; structural genomics, str 2e-20
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 2e-19
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 2e-19
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 8e-19
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 1e-18
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 2e-18
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 1e-17
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 7e-17
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 2e-16
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 2e-16
2hq6_A185 Serologically defined colon cancer antigen 10; pro 5e-16
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 1e-13
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-13
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-12
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 2e-10
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 4e-10
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 4e-10
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 4e-10
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 6e-10
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 8e-10
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 9e-10
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 2e-09
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 3e-09
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 4e-09
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 4e-09
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 7e-09
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-08
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-08
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-08
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-08
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 3e-08
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-08
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-07
1z81_A229 Cyclophilin; structural genomics, structural genom 3e-07
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
 Score = 83.9 bits (208), Expect = 2e-20
 Identities = 44/154 (28%), Positives = 71/154 (46%), Gaps = 11/154 (7%)

Query: 59  QELVVEDENSFMDSKKSDLPGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGM 118
           +   +E++ ++   K     GY  I T+ G   VEL+   SP     F  LC+ G     
Sbjct: 19  KTKSLEEKIAYYKMKGHTERGYITIYTNLGDFEVELYWYHSPKTCLNFYTLCEMGFYDNT 78

Query: 119 LFRHIIKHYVIQAGDIDKLG----SIEDWTTRGKHYS-QLDTSLKH-EAFMLGTSKAKHD 172
           +F  +I ++VIQ GD    G    SI  +   G+++  +++  LKH  A +L  S    +
Sbjct: 79  IFHRVIPNFVIQGGDPTGTGKGGKSI--Y---GEYFEDEINKELKHTGAGILSMSNNGPN 133

Query: 173 NQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ 206
                 +IT AP+P L  K  +F RV K    ++
Sbjct: 134 TNSSQFFITLAPLPHLDGKHTIFARVSKNMTCIE 167
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 95.08
3kop_A188 Uncharacterized protein; protein with A cyclophili 89.07
1zx8_A136 Hypothetical protein TM1367; structural genomics, 83.68
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=3.9e-47  Score=300.67  Aligned_cols=129  Identities=29%  Similarity=0.469  Sum_probs=119.8

Q ss_pred             CcEEEEEecceeEEEEEcCCCChHHHHHHHHhhhCCCcCCceEEEeecCeEEEecccCCCCCCccccccccccccCCCCC
Q 047545           78 PGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSL  157 (206)
Q Consensus        78 ~~~~~~~t~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~Rv~~~f~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~l  157 (206)
                      +..++++|+.|+|+||||++.||+||+||++||+.+||||+.||||+++|||||||+.+++.++++.++..+.+|....+
T Consensus         5 ~~~v~~~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~gg~si~g~~~~dE~~~~l   84 (160)
T 2fu0_A            5 PKSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHL   84 (160)
T ss_dssp             CCEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTB
T ss_pred             CCEEEEEecCccEEEEEeCCCChHHHHHHHHHhccCccCCCEEEEEECCCEEEeCCcCCCCCCCCcccCCCccccccCCc
Confidence            34799999999999999999999999999999999999999999999999999999998877777666667777776689


Q ss_pred             CCC-ceEEEEecCCCCCCcceEEEEcCCCCCCCCCccEEEEEEeCccccC
Q 047545          158 KHE-AFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ  206 (206)
Q Consensus       158 ~h~-~G~vsma~~~~~s~gSqFfIt~~~~~~Ld~~~~VFG~Vi~G~dvl~  206 (206)
                      +|. +|+|||||++||+++|||||++.++||||++|+|||+|++|||||+
T Consensus        85 ~h~~~G~lsmA~~gp~s~~SQFfI~~~~~~~Ldg~~tvFG~Vv~G~dvv~  134 (160)
T 2fu0_A           85 NHSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVL  134 (160)
T ss_dssp             CSSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHH
T ss_pred             ccCCceEEEEecCCCCCcccEEEEECCCCCccCCCcEEEEEEEcCHHHHH
Confidence            997 7999999999999999999999999999999999999999999985
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure
>1zx8_A Hypothetical protein TM1367; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: 1PE; 1.90A {Thermotoga maritima} SCOP: b.62.1.3 PDB: 2ka0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 206
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 1e-21
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-20
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 3e-19
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 7e-17
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 2e-16
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 2e-16
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 8e-16
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-15
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 2e-15
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 7e-15
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 3e-14
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-14
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 3e-14
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 3e-14
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 4e-14
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 4e-14
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-13
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 4e-12
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 5e-11
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-10
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-10
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 2e-08
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 84.8 bits (209), Expect = 1e-21
 Identities = 40/130 (30%), Positives = 58/130 (44%), Gaps = 1/130 (0%)

Query: 78  PGYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKL 137
           P    ++T  G I +EL+   +P     F +L +RG   G  F  IIK ++IQ GD    
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 138 GSIEDWTTRGKHYSQLDTSLKH-EAFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFG 196
           G         +   +L   LK   A +L  + A  D  G   ++T AP   L  K  +FG
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFG 130

Query: 197 RVIKGEDVVQ 206
           RV +G  +V 
Sbjct: 131 RVCQGIGMVN 140
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query206
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Putative cyclophilin PFE0505w
species: Plasmodium falciparum [TaxId: 5833]

Probab=100.00  E-value=2.7e-42  Score=269.35  Aligned_cols=128  Identities=29%  Similarity=0.453  Sum_probs=119.3

Q ss_pred             cEEEEEecceeEEEEEcCCCChHHHHHHHHhhhCCCcCCceEEEeecCeEEEecccCCCCCCccccccccccccCCCCCC
Q 047545           79 GYAIIDTHKGSITVELFKDSSPDVVDEFIDLCQRGRLKGMLFRHIIKHYVIQAGDIDKLGSIEDWTTRGKHYSQLDTSLK  158 (206)
Q Consensus        79 ~~~~~~t~~G~i~ieL~~~~aP~t~~nF~~L~~~g~Y~g~~f~Rv~~~f~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~l~  158 (206)
                      ..++++|+.|+|+||||++.||++|+||++||+++||+|+.|||+++++++|+||+.+.+.++...++..+.++...++.
T Consensus         2 ~~~~i~T~~G~i~ieL~~~~aP~tv~nF~~l~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~~~~~~~~   81 (155)
T d2fu0a1           2 KSAIIYTTMGDIHISLFYKECKKTVQNFSVHSINGYYNNCIFHRVIKHFMVQTGDPSGDGTGGESIWGNEFEDEFFDHLN   81 (155)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCCBTTBC
T ss_pred             ceEEEEEcccEEEEEEcCCCChHHHHHHhhHhhCCccccceeeeeeecceeeccCCCCCCcCCcccCCCccccccccccc
Confidence            46899999999999999999999999999999999999999999999999999999988777776677777888888888


Q ss_pred             CC-ceEEEEecCCCCCCcceEEEEcCCCCCCCCCccEEEEEEeCccccC
Q 047545          159 HE-AFMLGTSKAKHDNQGFDLYITTAPMPDLSEKLIVFGRVIKGEDVVQ  206 (206)
Q Consensus       159 h~-~G~vsma~~~~~s~gSqFfIt~~~~~~Ld~~~~VFG~Vi~G~dvl~  206 (206)
                      |. +|+++|+++++|+++|||||++++.|+||++|+|||+|++|||||+
T Consensus        82 ~~~~~~~~~~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi~G~~vv~  130 (155)
T d2fu0a1          82 HSKPFMVSMANCGPNTNGSQFFITTVPCPWLDFKHTVFGKVTQGSKIVL  130 (155)
T ss_dssp             SSSSSEEEECCSSTTCBCSCEEEESSCCGGGTTTSCEEEEEEECHHHHH
T ss_pred             cCCccEEEecccCCCCCCccceecccCccccccceEEEEEEeccHHHHH
Confidence            87 6699999999999999999999999999999999999999999984
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure