Citrus Sinensis ID: 047624

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL
ccEEEcccccEEEccccccccccccccEEcccccccccccccccccccccEEEccccEEEEccccccccHHccccccccccEEEEcccHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccEEccccEEEEcccHHccccccccEEcccccccEEEcccccccccccEEEcccccccccccccccccccccccccccEEEccccccccccccHHHccccccccEEEEccEEEEcccccccccccccEEEccccEEcccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHccccccccEEcccccc
ccEEEEccccccccccHHHcccccccEEEcccccEEccccHHHHHcccccEEEEEEccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHcccccccEEEccccEEEEEccHHHHHcccccEEEccccccccccccccccccccEEEcccccccccccccccccHHHcccccccEEEEccccccccccHHHcccHHHHcEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccHcHEEEEEcccccc
lrilwldnntyggqipdnishcvnlESLFLAHNELvgkvpgklgslsKLRTLAVHHnnlsgeipssfgnlssLERLSAAANQFVGQIPETLGELKRMRFIgfganklsgeipssiynlsslsnfdfpvnqlqgglptdlgftlpnlerlnvgdnqftgpipasisnasnlmrltipqngfsgkvpslenlhKLQWVVIAVNhlgngekddLEFVNSLVNAYGLELLEintnnfggmlpeavgnlsTRIRILRVgnnqlfgnipSELRNLVNLEllelgdnqftgripgrnlTSLAILVFVENMlegsipsslgkcqnLILLdlsnnnlsgtipteVIGLSSLSIYLDLSQNQL
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNqftgripgrNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSelrnlvnlellelGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQnlilldlsnnnlsGTIPTEVIGLSSLSIYLDLSQNQL
**ILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSG*I*********LERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLD******
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query353 2.2.26 [Sep-21-2011]
C0LGT6 1031 LRR receptor-like serine/ yes no 0.997 0.341 0.394 2e-56
C0LGP4 1010 Probable LRR receptor-lik no no 0.994 0.347 0.371 2e-55
Q9FL28 1173 LRR receptor-like serine/ no no 0.974 0.293 0.397 5e-52
Q9SD62 1025 Putative receptor-like pr no no 0.997 0.343 0.405 1e-51
Q9LHP4 1141 Receptor-like protein kin no no 0.954 0.295 0.372 3e-48
Q9SHI2 1101 Leucine-rich repeat recep no no 0.951 0.305 0.368 8e-47
C0LGV1 1135 LRR receptor-like serine/ no no 0.951 0.296 0.347 5e-46
C0LGF5 1072 Probable LRR receptor-lik no no 0.971 0.319 0.351 1e-44
O82318 960 Probably inactive leucine no no 0.898 0.330 0.361 3e-44
C0LGQ5 1249 LRR receptor-like serine/ no no 0.949 0.268 0.353 4e-44
>sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 Back     alignment and function desciption
 Score =  219 bits (559), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 150/380 (39%), Positives = 210/380 (55%), Gaps = 28/380 (7%)

Query: 1   LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
           L+ L +  N   G+IP ++S+C  L ++ L+ N L   VP +LGSLSKL  L +  NNL+
Sbjct: 123 LQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLT 182

Query: 61  GEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSS 120
           G  P+S GNL+SL++L  A NQ  G+IP+ +  L +M F     N  SG  P ++YN+SS
Sbjct: 183 GNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISS 242

Query: 121 LSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGF 180
           L +     N   G L  D G+ LPNL RL +G NQFTG IP +++N S+L R  I  N  
Sbjct: 243 LESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYL 302

Query: 181 SGKVP-SLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPE 239
           SG +P S   L  L W+ I  N LGN     LEF+ ++ N   LE L++  N  GG LP 
Sbjct: 303 SGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPA 362

Query: 240 AVGNLSTRIRILRVGNNQLFGNIPSELRNLV------------------------NLELL 275
           ++ NLST +  L +G N + G IP ++ NLV                        NL+++
Sbjct: 363 SIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVV 422

Query: 276 ELGDNQFTGRIPGR--NLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIP 333
           +L  N  +G IP    N+T L  L    N   G IP SLG+C+ L+ L +  N L+GTIP
Sbjct: 423 DLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIP 482

Query: 334 TEVIGLSSLSIYLDLSQNQL 353
            E++ + SL+ Y+DLS N L
Sbjct: 483 QEILQIPSLA-YIDLSNNFL 501
Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of elongation factor Tu (EF-Tu), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs). Reduces transformation by Rhizobium radiobacter probably by inducing plant defense during the interaction. Binding to the effector AvrPto1 from P.syringae blocks the downstream plant immune response.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 Back     alignment and function description
>sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
224097750 1023 predicted protein [Populus trichocarpa] 0.991 0.342 0.513 7e-92
255585471 963 serine-threonine protein kinase, plant-t 1.0 0.366 0.485 2e-87
255577438 1028 receptor-kinase, putative [Ricinus commu 1.0 0.343 0.488 3e-87
224121306 966 predicted protein [Populus trichocarpa] 0.977 0.357 0.524 2e-86
359486510 965 PREDICTED: probable LRR receptor-like se 0.954 0.349 0.495 5e-84
224097752 1025 predicted protein [Populus trichocarpa] 1.0 0.344 0.482 6e-84
224081190 1011 predicted protein [Populus trichocarpa] 1.0 0.349 0.477 4e-83
255581223 1015 receptor-kinase, putative [Ricinus commu 0.977 0.339 0.473 7e-83
255575908 988 serine-threonine protein kinase, plant-t 1.0 0.357 0.469 4e-82
224127492 1022 predicted protein [Populus trichocarpa] 1.0 0.345 0.481 3e-81
>gi|224097750|ref|XP_002311066.1| predicted protein [Populus trichocarpa] gi|222850886|gb|EEE88433.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  343 bits (880), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 193/376 (51%), Positives = 245/376 (65%), Gaps = 26/376 (6%)

Query: 4   LWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEI 63
           L L NNT+ G+IP NIS C NL S+ LA N L GK+P + GSLSKL+ L    N+L GEI
Sbjct: 127 LSLGNNTFSGEIPVNISRCTNLLSIGLASNNLTGKLPAEFGSLSKLQVLNFQRNHLFGEI 186

Query: 64  PSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSN 123
           P S+GNLS L+ +    N   G IP+++G+LKR+    FG N LSG IPSSIYN+SSL  
Sbjct: 187 PPSYGNLSELQIIRGVRNNLQGGIPDSIGQLKRLADFTFGVNSLSGTIPSSIYNMSSLVR 246

Query: 124 FDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGK 183
           F  P+NQL G LP +LG TLPNL+  N+  NQF G IP+++SNAS +  L +  N F+GK
Sbjct: 247 FSAPLNQLYGILPPELGLTLPNLDTFNILSNQFRGLIPSTLSNASKISDLQLRNNSFTGK 306

Query: 184 VPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEAVGN 243
           VPSL  LH LQ +V+  N+LGN E DDL F+  L N   LE+L IN NNFGG+LPE V N
Sbjct: 307 VPSLAGLHNLQRLVLNFNNLGNNEDDDLGFLYPLANTTSLEILAINHNNFGGVLPEIVCN 366

Query: 244 LSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGR-------------- 289
            ST++RI+ +G N L G+IP+E+  L+ L+ L L  NQ TG IP                
Sbjct: 367 FSTKLRIMIIGENNLRGSIPTEIGKLIGLDTLGLELNQLTGIIPSSIGKLQRLGVFNING 426

Query: 290 ------------NLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVI 337
                       N+TSL  + F  N L+G IPSSLG CQNL++L L  NNLSG+IP EV+
Sbjct: 427 NKISGNIPSSLGNITSLLEVYFFANNLQGRIPSSLGNCQNLLMLRLDQNNLSGSIPKEVL 486

Query: 338 GLSSLSIYLDLSQNQL 353
           G+SSLS+YLDL++NQL
Sbjct: 487 GISSLSMYLDLAENQL 502

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255585471|ref|XP_002533428.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526716|gb|EEF28948.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255577438|ref|XP_002529598.1| receptor-kinase, putative [Ricinus communis] gi|223530931|gb|EEF32790.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224121306|ref|XP_002330794.1| predicted protein [Populus trichocarpa] gi|222872596|gb|EEF09727.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486510|ref|XP_002271317.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At3g47570-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224097752|ref|XP_002311067.1| predicted protein [Populus trichocarpa] gi|222850887|gb|EEE88434.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224081190|ref|XP_002306327.1| predicted protein [Populus trichocarpa] gi|222855776|gb|EEE93323.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581223|ref|XP_002531424.1| receptor-kinase, putative [Ricinus communis] gi|223528974|gb|EEF30966.1| receptor-kinase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255575908|ref|XP_002528851.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223531702|gb|EEF33525.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224127492|ref|XP_002329291.1| predicted protein [Populus trichocarpa] gi|222870745|gb|EEF07876.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
TAIR|locus:2075661 1025 AT3G47110 [Arabidopsis thalian 0.997 0.343 0.387 3.2e-56
TAIR|locus:2149922 1031 EFR "EF-TU receptor" [Arabidop 0.994 0.340 0.364 4.8e-54
UNIPROTKB|Q40640 1025 Xa21 "Receptor kinase-like pro 0.994 0.342 0.388 3.4e-53
UNIPROTKB|O24435 813 O24435 "Receptor kinase-like p 0.991 0.430 0.358 2.3e-51
TAIR|locus:2079142 1010 AT3G47570 [Arabidopsis thalian 0.994 0.347 0.351 6.8e-49
TAIR|locus:2079157 1011 AT3G47580 [Arabidopsis thalian 0.997 0.348 0.342 2.4e-48
TAIR|locus:2170483 1173 FLS2 "FLAGELLIN-SENSITIVE 2" [ 0.971 0.292 0.361 7.5e-45
TAIR|locus:2085537 894 RLP34 "AT3G11010" [Arabidopsis 0.798 0.315 0.343 1.4e-44
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.861 0.358 0.348 9.3e-44
TAIR|locus:2085949 1141 AT3G24240 [Arabidopsis thalian 0.951 0.294 0.341 2.9e-43
TAIR|locus:2075661 AT3G47110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 587 (211.7 bits), Expect = 3.2e-56, P = 3.2e-56
 Identities = 138/356 (38%), Positives = 191/356 (53%)

Query:     1 LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
             L+ L + NN +GG IP  +S+C +L +L L+ N L   VP + GSLSKL  L++  NNL+
Sbjct:   131 LQYLNMSNNLFGGVIPVVLSNCSSLSTLDLSSNHLEQGVPLEFGSLSKLVLLSLGRNNLT 190

Query:    61 GEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSS 120
             G+ P+S GNL+SL+ L    NQ  G+IP  +  LK+M F     NK +G  P  IYNLSS
Sbjct:   191 GKFPASLGNLTSLQMLDFIYNQIEGEIPGDIARLKQMIFFRIALNKFNGVFPPPIYNLSS 250

Query:   121 LSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGF 180
             L       N   G L  D G  LPNL+ L +G N FTG IP ++SN S+L +L IP N  
Sbjct:   251 LIFLSITGNSFSGTLRPDFGSLLPNLQILYMGINSFTGTIPETLSNISSLRQLDIPSNHL 310

Query:   181 SGKVP-SLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPE 239
             +GK+P S   L  L  + +  N LGN    DL+F+ +L N   L+ L +  N  GG LP 
Sbjct:   311 TGKIPLSFGRLQNLLLLGLNNNSLGNYSSGDLDFLGALTNCSQLQYLNVGFNKLGGQLPV 370

Query:   240 AVGNLSTRIRILRVGNNQLFGNIPSXXXXXXXXXXXXXGDNQFTGRIPGR--NLTSLAIL 297
              + NLST++  L +G N + G+IP              G+N  TG++P     L+ L  +
Sbjct:   371 FIANLSTQLTELSLGGNLISGSIPHGIGNLVSLQTLDLGENLLTGKLPPSLGELSELRKV 430

Query:   298 VFVENMLEGSIPSSLGKCQXXXXXXXXXXXXXGTIPTEVIGLSSLSIYLDLSQNQL 353
             +   N L G IPSSLG                G+IP+  +G  S  + L+L  N+L
Sbjct:   431 LLYSNGLSGEIPSSLGNISGLTYLYLLNNSFEGSIPSS-LGSCSYLLDLNLGTNKL 485
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA;ISS
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=ISS
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2149922 EFR "EF-TU receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q40640 Xa21 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
UNIPROTKB|O24435 O24435 "Receptor kinase-like protein" [Oryza sativa (taxid:4530)] Back     alignment and assigned GO terms
TAIR|locus:2079142 AT3G47570 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079157 AT3G47580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170483 FLS2 "FLAGELLIN-SENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085537 RLP34 "AT3G11010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085949 AT3G24240 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-61
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-44
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-33
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-32
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-25
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-13
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-09
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-08
PLN03150 623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score =  209 bits (534), Expect = 7e-61
 Identities = 138/355 (38%), Positives = 199/355 (56%), Gaps = 36/355 (10%)

Query: 1   LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
           LR L L NN + G IP        LE+L L++N L G++P  +GS S L+ L +  N L 
Sbjct: 120 LRYLNLSNNNFTGSIPRGSIPN--LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLV 177

Query: 61  GEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSS 120
           G+IP+S  NL+SLE L+ A+NQ VGQIP  LG++K +++I  G N LSGEIP  I  L+S
Sbjct: 178 GKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS 237

Query: 121 LSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGF 180
           L++ D   N L G +P+ LG  L NL+ L +  N+ +GPIP SI +   L+ L +  N  
Sbjct: 238 LNHLDLVYNNLTGPIPSSLG-NLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSL 296

Query: 181 SGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGMLPEA 240
           SG++P L  + +LQ                            LE+L + +NNF G +P A
Sbjct: 297 SGEIPEL--VIQLQ---------------------------NLEILHLFSNNFTGKIPVA 327

Query: 241 VGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTS--LAILV 298
           + +L  R+++L++ +N+  G IP  L    NL +L+L  N  TG IP    +S  L  L+
Sbjct: 328 LTSLP-RLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLI 386

Query: 299 FVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL 353
              N LEG IP SLG C++L  + L +N+ SG +P+E   L  L  +LD+S N L
Sbjct: 387 LFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKL-PLVYFLDISNNNL 440

Length = 968
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 353
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.95
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.95
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.94
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.93
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.88
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG4237498 consensus Extracellular matrix protein slit, conta 99.81
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.77
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
KOG0617264 consensus Ras suppressor protein (contains leucine 99.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.36
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.3
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 99.29
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.27
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.24
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.06
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.02
PLN03150623 hypothetical protein; Provisional 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.98
PLN03150623 hypothetical protein; Provisional 98.97
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.89
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.66
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.64
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.59
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.53
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.52
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.52
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.35
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.33
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.27
KOG4341483 consensus F-box protein containing LRR [General fu 98.23
KOG4341483 consensus F-box protein containing LRR [General fu 98.18
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.07
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.05
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.0
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.88
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.74
PRK15386426 type III secretion protein GogB; Provisional 97.67
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.61
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.39
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.21
KOG2123 388 consensus Uncharacterized conserved protein [Funct 97.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.05
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.96
KOG2123 388 consensus Uncharacterized conserved protein [Funct 96.88
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.41
KOG4308478 consensus LRR-containing protein [Function unknown 96.19
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.26
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.26
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.1
KOG4308 478 consensus LRR-containing protein [Function unknown 94.93
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.02
smart0037026 LRR Leucine-rich repeats, outliers. 91.1
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.1
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.52
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 88.23
KOG0473326 consensus Leucine-rich repeat protein [Function un 85.6
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.94
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=6.9e-39  Score=314.94  Aligned_cols=350  Identities=39%  Similarity=0.614  Sum_probs=246.6

Q ss_pred             CcEEEccCCCCccccCcccccCCCCcEEEcccCcccccCCcccCCCCCccEEEecCCccCCccCccccCCCcccEeecCC
Q 047624            1 LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAA   80 (353)
Q Consensus         1 L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~   80 (353)
                      |++|++++|.+.+..|..+.++++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|..+..+++|++|++++
T Consensus       166 L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~  245 (968)
T PLN00113        166 LKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVY  245 (968)
T ss_pred             CCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcC
Confidence            67888888888888888888888888888888887777778888888888888888888777888888888888888888


Q ss_pred             CcccccChhhhhccccccEEEeCCCcCCCCCchhhcCCCCCCEEEcCCCCCCCCCCccccCCCCCCCEEeccCccccccc
Q 047624           81 NQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPI  160 (353)
Q Consensus        81 ~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~  160 (353)
                      |.+.+..|..+.++++|+.|++++|.+.+..|..+..+++|++|++++|.+.+.+|..+. .+++|+.|++.+|.+....
T Consensus       246 n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~-~l~~L~~L~l~~n~~~~~~  324 (968)
T PLN00113        246 NNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVI-QLQNLEILHLFSNNFTGKI  324 (968)
T ss_pred             ceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHc-CCCCCcEEECCCCccCCcC
Confidence            888777777788888888888888887767777777777888888887777655655554 5677777777777776666


Q ss_pred             cccccCCCCccEEecCCCcceeeCCC-cccccCccEEEEeeccCCCCCcchh------------------HHHhhhcccC
Q 047624          161 PASISNASNLMRLTIPQNGFSGKVPS-LENLHKLQWVVIAVNHLGNGEKDDL------------------EFVNSLVNAY  221 (353)
Q Consensus       161 ~~~l~~~~~L~~L~l~~~~~~~~~~~-~~~~~~L~~l~l~~~~~~~~~~~~~------------------~~~~~l~~~~  221 (353)
                      +..+..+++|+.|++++|.+.+..+. +..+++|+.++++.|.+.+.....+                  ..+..+..++
T Consensus       325 ~~~~~~l~~L~~L~L~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~  404 (968)
T PLN00113        325 PVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACR  404 (968)
T ss_pred             ChhHhcCCCCCEEECcCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCC
Confidence            66666777777777777766644333 5566666666666665543211110                  1223445667


Q ss_pred             CccEEEccCCcCCccCchhHhhhcccCcEEEecCccccCCCchhhcCCCCCcEEecCCceeeeecCC-------------
Q 047624          222 GLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPG-------------  288 (353)
Q Consensus       222 ~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~-------------  288 (353)
                      +|+.+++++|.+.+..|..+..++ .|+.|++++|.+.+..+..+..+++|++|++++|.+.+..+.             
T Consensus       405 ~L~~L~L~~n~l~~~~p~~~~~l~-~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~~~~~L~~L~ls  483 (968)
T PLN00113        405 SLRRVRLQDNSFSGELPSEFTKLP-LVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLS  483 (968)
T ss_pred             CCCEEECcCCEeeeECChhHhcCC-CCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCcccccccceEEECc
Confidence            777777777777766676666664 777777777777666666666666666666666665543332             


Q ss_pred             ------------CCCCCCcEEEeecccccccCChhhhcCCCCcEEecCCCcCCCCCCcccccccccceEEecCCCCC
Q 047624          289 ------------RNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL  353 (353)
Q Consensus       289 ------------~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~l~~l~~~l~l~~~~~  353 (353)
                                  ..+++|+.|++++|.+.+.+|..+..+++|+.|+|++|.+++.+|..+..+++| ++|+|++|++
T Consensus       484 ~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L-~~L~Ls~N~l  559 (968)
T PLN00113        484 RNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVL-SQLDLSQNQL  559 (968)
T ss_pred             CCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccC-CEEECCCCcc
Confidence                        234556666666666666666666666667777777777766667666677777 6777776654

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
3rgx_A768 Structural Insight Into Brassinosteroid Perception 1e-26
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-13
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-26
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-13
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-12
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-04
2id5_A 477 Crystal Structure Of The Lingo-1 Ectodomain Length 7e-04
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure 
Iteration: 1

 Score =  117 bits (292), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/329 (29%), Positives = 156/329 (47%), Gaps = 23/329 (6%)
Query: 1   LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
           L+ L+L NN + G+IP  +S+C  L SL L+ N L G +P  LGSLSKLR L +  N L 
Sbjct: 396 LQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLE 455
Query: 61  GEIPSSFGNLSSLERLSAAANQFVGQIPETLGELKRMRFIGFGANKLSGEIPSSIYNLSS 120
           GEIP     + +LE L    N   G+IP  L     + +I    N+L+GEIP  I  L +
Sbjct: 456 GEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLEN 515
Query: 121 LSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISN-----ASNLM---- 171
           L+      N   G +P +LG    +L  L++  N F G IPA++       A+N +    
Sbjct: 516 LAILKLSNNSFSGNIPAELG-DCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKR 574
Query: 172 RLTIPQNGFSGKVPSLENLHKLQWVVIA-VNHLGNGEKDDL-------EFVNSLVNAYGL 223
            + I  +G   +     NL + Q +    +N L      ++           +  N   +
Sbjct: 575 YVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSM 634
Query: 224 ELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSXXXXXXXXXXXXXGDNQFT 283
             L+++ N   G +P+ +G++   + IL +G+N + G+IP                N+  
Sbjct: 635 MFLDMSYNMLSGYIPKEIGSM-PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD 693
Query: 284 GRIPGRNLTSLAILVFVE---NMLEGSIP 309
           GRIP + +++L +L  ++   N L G IP
Sbjct: 694 GRIP-QAMSALTMLTEIDLSNNNLSGPIP 721
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-81
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-76
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-71
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-60
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-54
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-45
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-47
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-45
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-41
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-46
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-36
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-30
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-23
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-28
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-36
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-32
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-30
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-23
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-16
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-32
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-25
1o6v_A 466 Internalin A; bacterial infection, extracellular r 3e-25
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-27
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-25
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-26
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-22
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-23
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-18
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-22
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-19
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-12
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-20
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-19
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-17
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-19
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-19
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-14
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-19
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-09
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-14
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-14
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-13
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-11
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-09
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 5e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 6e-10
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 3e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-08
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-08
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-07
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 8e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 1e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 1e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A 251 Variable lymphocyte receptor A diversity region; a 9e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 8e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  260 bits (668), Expect = 6e-81
 Identities = 114/360 (31%), Positives = 175/360 (48%), Gaps = 18/360 (5%)

Query: 1   LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
           L  L + +N +   IP  +  C  L+ L ++ N+L G     + + ++L+ L +  N   
Sbjct: 202 LEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFV 260

Query: 61  GEIPSSFGNLSSLERLSAAANQFVGQIPETL-GELKRMRFIGFGANKLSGEIPSSIYNLS 119
           G IP     L SL+ LS A N+F G+IP+ L G    +  +    N   G +P    + S
Sbjct: 261 GPIPPL--PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCS 318

Query: 120 SLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNAS-NLMRLTIPQN 178
            L +     N   G LP D    +  L+ L++  N+F+G +P S++N S +L+ L +  N
Sbjct: 319 LLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSN 378

Query: 179 GFSGKVPS---LENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGG 235
            FSG +         + LQ + +  N    G     +   +L N   L  L ++ N   G
Sbjct: 379 NFSGPILPNLCQNPKNTLQELYLQNNGF-TG-----KIPPTLSNCSELVSLHLSFNYLSG 432

Query: 236 MLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPG--RNLTS 293
            +P ++G+LS ++R L++  N L G IP EL  +  LE L L  N  TG IP    N T+
Sbjct: 433 TIPSSLGSLS-KLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN 491

Query: 294 LAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQNQL 353
           L  +    N L G IP  +G+ +NL +L LSNN+ SG IP E+    SL   LDL+ N  
Sbjct: 492 LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIW-LDLNTNLF 550
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A 466 Internalin A; bacterial infection, extracellular r 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.89
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.89
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.87
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.83
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.82
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.78
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.77
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.71
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.67
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.58
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.57
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.56
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.52
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.49
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.47
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.35
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.25
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.15
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.09
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 99.02
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.94
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.87
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.74
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.32
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.28
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.27
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.68
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.64
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.89
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.85
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-42  Score=330.31  Aligned_cols=342  Identities=34%  Similarity=0.550  Sum_probs=191.1

Q ss_pred             EEEccCCCCccccCcccccC-CCCcEEEcccCcccccCCcccCCCCCccEEEecCCccCCccCcc-ccCCCcccEeecCC
Q 047624            3 ILWLDNNTYGGQIPDNISHC-VNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSS-FGNLSSLERLSAAA   80 (353)
Q Consensus         3 ~L~l~~~~~~~~~~~~~~~l-~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~-~~~l~~L~~L~l~~   80 (353)
                      +|++++|.+++.+|..+... ++|++|++++|.+.+..|..+.++++|++|++++|.+.+.+|.. +..+++|++|++++
T Consensus       273 ~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~  352 (768)
T 3rgz_A          273 YLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSF  352 (768)
T ss_dssp             EEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCS
T ss_pred             EEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcC
Confidence            34444444433334333332 44444444444444344444444444444444444443333332 44444444444444


Q ss_pred             CcccccChhhhhccc-cccEEEeCCCcCCCCCchhhcC--CCCCCEEEcCCCCCCCCCCccccCCCCCCCEEeccCcccc
Q 047624           81 NQFVGQIPETLGELK-RMRFIGFGANKLSGEIPSSIYN--LSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFT  157 (353)
Q Consensus        81 ~~~~~~~~~~~~~l~-~L~~L~l~~~~~~~~~~~~l~~--l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~  157 (353)
                      |.+.+..|..+..++ +|+.|++++|.+.+..+..+..  +++|++|++++|.+.+.++..+. .+++|+.|++++|.+.
T Consensus       353 n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~N~l~  431 (768)
T 3rgz_A          353 NEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSFNYLS  431 (768)
T ss_dssp             SEEEECCCTTHHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG-GCTTCCEEECCSSEEE
T ss_pred             CccCccccHHHHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh-cCCCCCEEECcCCccc
Confidence            444434444444433 4444444444443333333332  34455555555544434444433 4555666666666555


Q ss_pred             ccccccccCCCCccEEecCCCcceeeCCC-cccccCccEEEEeeccCCCCCcchhHHHhhhcccCCccEEEccCCcCCcc
Q 047624          158 GPIPASISNASNLMRLTIPQNGFSGKVPS-LENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEINTNNFGGM  236 (353)
Q Consensus       158 ~~~~~~l~~~~~L~~L~l~~~~~~~~~~~-~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~  236 (353)
                      ...|..+..+++|++|++++|.+.+..+. +..+++|+.|+++.|.+.+.      .+..+..+++|+.|++++|.+.+.
T Consensus       432 ~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~------~p~~l~~l~~L~~L~L~~N~l~~~  505 (768)
T 3rgz_A          432 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGE------IPSGLSNCTNLNWISLSNNRLTGE  505 (768)
T ss_dssp             SCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSC------CCGGGGGCTTCCEEECCSSCCCSC
T ss_pred             CcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCc------CCHHHhcCCCCCEEEccCCccCCc
Confidence            55555555566666666666655543332 55566666666666655542      233456677777777777777777


Q ss_pred             CchhHhhhcccCcEEEecCccccCCCchhhcCCCCCcEEecCCceeeeecCC----------------------------
Q 047624          237 LPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPG----------------------------  288 (353)
Q Consensus       237 ~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~----------------------------  288 (353)
                      .|.++..++ +|++|++++|.+.+.+|..+..+++|++|++++|++.+..|.                            
T Consensus       506 ~p~~~~~l~-~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  584 (768)
T 3rgz_A          506 IPKWIGRLE-NLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMK  584 (768)
T ss_dssp             CCGGGGGCT-TCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCC
T ss_pred             CChHHhcCC-CCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhcccccccccccccccc
Confidence            777777764 777777777777767777777777777777777776644331                            


Q ss_pred             --------------------------------------------CCCCCCcEEEeecccccccCChhhhcCCCCcEEecC
Q 047624          289 --------------------------------------------RNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLS  324 (353)
Q Consensus       289 --------------------------------------------~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~l~l~  324 (353)
                                                                  ..+++|+.|++++|++++.+|..++.++.|+.|+++
T Consensus       585 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls  664 (768)
T 3rgz_A          585 KECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLG  664 (768)
T ss_dssp             TTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECC
T ss_pred             ccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCc
Confidence                                                        113456677777777776677777777777777777


Q ss_pred             CCcCCCCCCcccccccccceEEecCCCCC
Q 047624          325 NNNLSGTIPTEVIGLSSLSIYLDLSQNQL  353 (353)
Q Consensus       325 ~n~~~~~~~~~~~~l~~l~~~l~l~~~~~  353 (353)
                      +|++++.+|..|..+++| ++|||++|++
T Consensus       665 ~N~l~g~ip~~l~~L~~L-~~LdLs~N~l  692 (768)
T 3rgz_A          665 HNDISGSIPDEVGDLRGL-NILDLSSNKL  692 (768)
T ss_dssp             SSCCCSCCCGGGGGCTTC-CEEECCSSCC
T ss_pred             CCccCCCCChHHhCCCCC-CEEECCCCcc
Confidence            777776777777777777 6777776654
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 353
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-07
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-11
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-05
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-13
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-12
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-10
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 9e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.003
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 82.0 bits (201), Expect = 5e-18
 Identities = 70/363 (19%), Positives = 133/363 (36%), Gaps = 37/363 (10%)

Query: 1   LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLS 60
           +  L  D    G +  D + +  NL  +  ++N+L    P  L +L+KL  + +++N ++
Sbjct: 46  VTTLQADRL--GIKSIDGVEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIA 101

Query: 61  GEIPSSFGNLSSLERLSAAANQFVGQIPE------------TLGELKRMRFIGFGANKLS 108
              P +     +   L       +  +              T+ ++  +  +        
Sbjct: 102 DITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSSNTISDISALSGLTSLQQLSF 161

Query: 109 GEIPSSIYNLSSLSNFDFPVNQLQGGLPTDLGFTLPNLERLNVGDNQFTGPIPASISNAS 168
           G   + +  L++L+  +             +   L NLE L   +NQ +   P  +   +
Sbjct: 162 GNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITP--LGILT 219

Query: 169 NLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAYGLELLEI 228
           NL  L++  N     + +L +L  L  + +A N + N        +  L     L  L++
Sbjct: 220 NLDELSLNGNQLKD-IGTLASLTNLTDLDLANNQISN--------LAPLSGLTKLTELKL 270

Query: 229 NTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPG 288
             N    + P  +  L+    +    N     +      NL NL  L L  N  +   P 
Sbjct: 271 GANQISNISP--LAGLTALTNLELNENQLEDISPI---SNLKNLTYLTLYFNNISDISPV 325

Query: 289 RNLTSLAILVFVENMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDL 348
            +LT L  L F  N +     SSL    N+  L   +N +S   P  +  L+ ++  L L
Sbjct: 326 SSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP--LANLTRIT-QLGL 380

Query: 349 SQN 351
           +  
Sbjct: 381 NDQ 383
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.91
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.88
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.86
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.73
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.65
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.63
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.61
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.53
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.51
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.51
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.47
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.22
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.13
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.46
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.32
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.96  E-value=1.1e-26  Score=202.90  Aligned_cols=319  Identities=26%  Similarity=0.335  Sum_probs=206.7

Q ss_pred             CcEEEccCCCCccccCcccccCCCCcEEEcccCcccccCCcccCCCCCccEEEecCCccCCccCccccCCCcccEeecCC
Q 047624            1 LRILWLDNNTYGGQIPDNISHCVNLESLFLAHNELVGKVPGKLGSLSKLRTLAVHHNNLSGEIPSSFGNLSSLERLSAAA   80 (353)
Q Consensus         1 L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~   80 (353)
                      |++|+++++.+++.  +.+..+++|++|++++|.+.+..  .+.++++|++|++++|.+.+ ++ .+..+++|+.+++.+
T Consensus        46 l~~L~l~~~~I~~l--~gl~~L~nL~~L~Ls~N~l~~l~--~l~~L~~L~~L~L~~n~i~~-i~-~l~~l~~L~~L~~~~  119 (384)
T d2omza2          46 VTTLQADRLGIKSI--DGVEYLNNLTQINFSNNQLTDIT--PLKNLTKLVDILMNNNQIAD-IT-PLANLTNLTGLTLFN  119 (384)
T ss_dssp             CCEEECCSSCCCCC--TTGGGCTTCCEEECCSSCCCCCG--GGTTCTTCCEEECCSSCCCC-CG-GGTTCTTCCEEECCS
T ss_pred             CCEEECCCCCCCCc--cccccCCCCCEEeCcCCcCCCCc--cccCCccccccccccccccc-cc-ccccccccccccccc
Confidence            34555555555532  23455555555555555554332  25555555555555555542 22 245555555555555


Q ss_pred             CcccccChhhhhccccccEEEeCCCcCCCC-------------------CchhhcCCCCCCEEEcCCCCCCCCCCccccC
Q 047624           81 NQFVGQIPETLGELKRMRFIGFGANKLSGE-------------------IPSSIYNLSSLSNFDFPVNQLQGGLPTDLGF  141 (353)
Q Consensus        81 ~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~-------------------~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~  141 (353)
                      +...+..+  ......+.......+.+...                   ....+.............+..  ...... .
T Consensus       120 ~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~-~  194 (384)
T d2omza2         120 NQITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKV--SDISVL-A  194 (384)
T ss_dssp             SCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTTCTTCCEEECCSSCC--CCCGGG-G
T ss_pred             cccccccc--ccccccccccccccccccccccccccccccccccccccchhhhhcccccccccccccccc--cccccc-c
Confidence            54432111  11222222222222221100                   001111122222222222222  112222 2


Q ss_pred             CCCCCCEEeccCccccccccccccCCCCccEEecCCCcceeeCCCcccccCccEEEEeeccCCCCCcchhHHHhhhcccC
Q 047624          142 TLPNLERLNVGDNQFTGPIPASISNASNLMRLTIPQNGFSGKVPSLENLHKLQWVVIAVNHLGNGEKDDLEFVNSLVNAY  221 (353)
Q Consensus       142 ~~~~L~~L~l~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~~L~~l~l~~~~~~~~~~~~~~~~~~l~~~~  221 (353)
                      .++.++.+.++++.+....+  ...+++|++|++++|.+++. +.+..+++++.+.+..|.+.+.        ..+..++
T Consensus       195 ~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n~l~~~-~~l~~l~~L~~L~l~~n~l~~~--------~~~~~~~  263 (384)
T d2omza2         195 KLTNLESLIATNNQISDITP--LGILTNLDELSLNGNQLKDI-GTLASLTNLTDLDLANNQISNL--------APLSGLT  263 (384)
T ss_dssp             GCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSSCCCCC-GGGGGCTTCSEEECCSSCCCCC--------GGGTTCT
T ss_pred             cccccceeeccCCccCCCCc--ccccCCCCEEECCCCCCCCc-chhhcccccchhccccCccCCC--------Ccccccc
Confidence            57889999999988874432  45678999999999988764 4578889999999999887653        2366788


Q ss_pred             CccEEEccCCcCCccCchhHhhhcccCcEEEecCccccCCCchhhcCCCCCcEEecCCceeeeecCCCCCCCCcEEEeec
Q 047624          222 GLELLEINTNNFGGMLPEAVGNLSTRIRILRVGNNQLFGNIPSELRNLVNLELLELGDNQFTGRIPGRNLTSLAILVFVE  301 (353)
Q Consensus       222 ~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L~l~~n~~~~~~~~~~~~~L~~L~l~~  301 (353)
                      +|++++++++.+.+..  .+... +.++.+.+..+.+.+  +..+..+++++.|++++|.+.+..+...+++|++|++++
T Consensus       264 ~L~~L~l~~~~l~~~~--~~~~~-~~l~~l~~~~n~l~~--~~~~~~~~~l~~L~ls~n~l~~l~~l~~l~~L~~L~L~~  338 (384)
T d2omza2         264 KLTELKLGANQISNIS--PLAGL-TALTNLELNENQLED--ISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLFFAN  338 (384)
T ss_dssp             TCSEEECCSSCCCCCG--GGTTC-TTCSEEECCSSCCSC--CGGGGGCTTCSEEECCSSCCSCCGGGGGCTTCCEEECCS
T ss_pred             cCCEeeccCcccCCCC--ccccc-ccccccccccccccc--ccccchhcccCeEECCCCCCCCCcccccCCCCCEEECCC
Confidence            9999999999887432  34455 489999999998863  345788999999999999998877678899999999999


Q ss_pred             ccccccCChhhhcCCCCcEEecCCCcCCCCCCcccccccccceEEecCCC
Q 047624          302 NMLEGSIPSSLGKCQNLILLDLSNNNLSGTIPTEVIGLSSLSIYLDLSQN  351 (353)
Q Consensus       302 ~~~~~~~~~~~~~~~~L~~l~l~~n~~~~~~~~~~~~l~~l~~~l~l~~~  351 (353)
                      |++++ ++ .+..+++|+.|++++|++++..|  +.++++| ++|+|++|
T Consensus       339 n~l~~-l~-~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L-~~L~L~~N  383 (384)
T d2omza2         339 NKVSD-VS-SLANLTNINWLSAGHNQISDLTP--LANLTRI-TQLGLNDQ  383 (384)
T ss_dssp             SCCCC-CG-GGGGCTTCCEEECCSSCCCBCGG--GTTCTTC-SEEECCCE
T ss_pred             CCCCC-Ch-hHcCCCCCCEEECCCCcCCCChh--hccCCCC-CEeeCCCC
Confidence            99984 44 68999999999999999996554  8899999 89999997
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure